ELF( 4N4 ( C2E\\@0 6QQ O @@( @0 fH!@P@Q?3Р -LČK/c2e@bcmain() returned,c   ! X(@@T @@ 0/0>00!10B#6 !$1 03/03/03/ 03/xM@. 1J0JJ010! ,1,! (1(!($*0N! 1"̃lG Ѝ@@9> 0 DSBOdcᆳb@cAiPb@?dc`@` Accb` @-@kpP/o@"S5cp@-`PL]p@Pp  E$00Spp p@:5cp@-P`Ep@PpIFU  ' p@"  5cL0 H0R/p@-P4"p@Pp&U p@ c` 5cp@-P<p@, pP  Tp p@5cp@-P<o@,oP Tp p@5c@-@oP @ 5cP0 L0R/p@-P`8o@Pp /op@"c` 5c80 40R/@-@ oP @c` 5cA-0`P` 0RoPP 003/V@  ` 008#8A/``p 0 6/㗴 Am0 0c` 5cp@-poPlo@Pp0 0`6/,P0``6/0 0P5/,p0`p@/5c0 0R/p@-AoP=oU@ 0$ 0`6/3>$ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/c` 5cp@-doPTnU@ $ ``06/Tp0`$ p@/5c/p@-0 P T@``06/0 ``6/`0p@ /p@-P@~@0 T000S 0d00h00p0x0h0x0p@3 S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` c) A-0PST@ Sq _~ Bu 00 `0*b6/`P N~  @p0  `p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0   0 7/0 `p 7/ `px0 7/`` 0 6/ ``H0 6/000S00 0 00$0Ѝ@@@@bp@-P0 ` T@003/U U ,r  p 003/@᪮@-00 " Ѝ 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddA-0`PT@ Vp V t00 3/\0U00 U0 `P5/AU00 ``6/@|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A|{ձ @@-@00 S @0  P@oЍc@-0 00  0 0 0^ЍA-PS@`p * P PA觲 W    P 嚲UA-B@c@p@-P`}@PP00lŲh&d00 P0   0 0p@@bA-P`l@P 0S  U000V0000p0  U  R0 _oSRPU 0VW0 VW0 Ayh5cb@-@|l0P Rd T0@0@000@0  T  R0 TS0 @@Sh5cb@-@l0P Rl T00000 00T00S0 OoRB@T @+h5cb@-@hl0P Rl T0 0 000 0  T  R0 OoSB@T0@ h5cb 0o/c/0@-0M P@ 0hhP 000 kЍ0h3 p@-0@Tp@tt凱L$0dP 5/0 dP5/0嬭0婭 0p@襭c:>@p@-(MP{@t1Pl娱d `1`0: S#L!L1  00 8!0,0 5 W0 !00V0$  ( 4000 `0@ 6/0P (Ѝp@<   A4 00  f/0$ ,0 0( 000x Ph v0 0D0 0g(Ѝpc@cpbpA@6 @p3 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxddd@-@-A- 1@TA屰0P`dp 7/U 9U+ 5U U$ U A:)U  0dP5/,20dP 5/0 4P5/c:>@p@-0@TxxiPpPP0 4P5/ 0 4P5/P c:>@C-1M@TAЍp\0` dP5/ 0dP5/P 徬弬ɬϯpPP p d09/0 49/ 㺯0 49/ 0 49/PU 召卬勬0 dP5/0@?L$c@:>A-1@T  կPP0` dp7/ 0dp7/ TR_e0dp 7/0 4P5/ T0 4P5/ 0 4P5/P,c:>@O-,1P@`(*,'0$4!0p,崫(屫0宫4嫫  @P0 ( ( [P0 (劫 ,凫0儫4偫OLc0S@- S S@@W/@0 @o/c@-唲@PЍG-@Ђ2`RpP0CRch2R 3C7CR0 0 $ G,2RV 3C7CR008#8S800 0+B &'B004004 0(0PL00 0,0R0015 0 c , S  1X0 0,05 0,0hl60d007101000<P008#8S308#8S0xP0 pA t(P8p<A00500`P5008#8Ss308#8SmSW HdHd#@H0B =@@-@`xPh @`0 0X 0P0 P0H000g04 4P$UЍp;>b,$;>bA A @@-x]@-x@I00: S/9c;>b00@o/c` @-a@PЍG-@Ђp2`RpP0CR_P2R 3C7CR0 0 $ G2RR 3C7CR008#8S800 0"A &A1414$00PL0$0! 0R0015!1c$ S  1X0$0 05$0 0hl60d007 1010007P008#8S308#8S0xP0 p@ l(P8p<@151`P5008#8Sy308#8SsSW HdHd#@H0B =@@-@`wP@h `0 0X 0P0 P0H000f04 4P$RЍp,;>b,4;>XbE ,E @@-wz@-w@n0 0R/  ]c` ,;>xbp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/0/-/-/-/-/-/-/A-PpO`|0@ 2/ p 0S0@0 @0000@A-P M@`ᙬ0 0 0  p7/0P * * p7/0P  "( p7/ Px 000 00@0L1 R `   P $ Ѝ@0X@p0$0:0d0 00!S   1 0 0S0h006Qd  /|0000100 0000 8/0$000\0`  ,'_@@@@@c@ ~A 0 /c/$ R/P//A-`0S @+Pp  5@P# d@ 001Q0000!D0  3/,0  0Q05/ 00(0@@Ѝ0S   00C0/$ R R R  /` R X0R//! !  / /_W@@W@AW@EW$o  R0" //@- oo@@-@ 00 S@@cA-Q@P@@DT@ 0S 0S`T pH`T@T@ ᮪` 00 p@-@uP@<坪0`000```0P0 0P0| &Pdڪ0X P<Ъ04 Ppp@Ū@`;>cTO @_a`bU @` `Y Y lQ U Q b bb,<>b@-s //G- s@cVʀ 0! #"0""   !P0S& 㢨P0S+P0SPP0SW( ]0T S00Q0R  P0H"00 Sh0 J0x o{P0y U p g0S g ^P0p -P ,0S -0S (05#0x ,GP0p YP Q 0R(0l0 S$00 S YX0S`P\ dV!$0PX0 0 0?cN 0!D c08 0   !N@bxddd cbgfffA-X0P@0`0\00`cbgfff:@>Q@-Mp\q`@ puM4P dMM ]M p10: SRZ e0s(ߢܢ@  1g@  1aP0P0P 00P0@ 0@庚 0@峚 0@嬚|0x 0t00 0@_P <@00LЍB@@` ` c` a b PbH`#b@-@-@<0 @0Lb@-7@-0@P1 p002000 p0000 0000000000 Ϛp000 Ѝ0\ P/0 !8 00 (  , !/@bxdddp@-P@`0 à  00CS0 00p0 SpA-`Q`pSP@PW (c Pc Dc hc pd 0S0<000S0;Uc d d d c d $d ,d 4d c P00$Ѝbtce0@-M@P 0 SP 0 Ts | Ѝ0@-@ 0 =P Ѝ [s e@-@P T  c0/cp@-`PpPCTʀ 0! # 0    !0 2/P 0!H C0< 4  , !p|c@bxdddp@-HP0PSp P@ `6/h0  0p@/cT00S/p@-D@PP  B  R `6/U000pcbO-pP`ܠܐܰP@ P& P$ PV `FPEp@P P #P gP`T  0S R  0W0@`Q Ѝ@A@@/@-0,\ @T 4/Ѝc00S/ R//c00S/ R//cp@-@P4`G/ gA/0p@80/,c 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/bA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 bTt Xt 0  )?)/ 0  )?)/^/@-@q d嬡Q0P0Cडq 8埡 q (嚡q 啡@@@@@0@-LP$M@ᆡ f000 0W$Ѝ0@Tu 0@- 0@ ,MPr           0 040$0WP 000 yZ,Ѝ00b`t /0/ //@-@@-@A-pQP.  @P` t0EG7P Hp|`@U80#+0 'J b@Z>///1/8#81/1/  R/ R/ T0s S40o//03S0/@b/孝@p@-@0PT3/.p`R0p@8/ ,($$#  p@/ @@B>@ @Q0 Q Q // A @@AO-M@  0 3/ 0Ѝ0 3/PkQ% 0 3/0 P( `X+%>X !7/&!0A`YSz Ȁ ȁ { t  ||  | X | d ~    | @  X| } ~ ~ ~  (  ,~ | | |  | 4 | L h| ؀ | P \ 0c0C S+({ { { { { { { { { { {    0x 3/ 0h 3/@ 0X 3/Y  0@ 3/ 00 3/Y0 9  12/0 ( 03/0A CRS 000 0Rx3/  0H l[0`3/0L 0 80,3/00P ( 8 R0 03/70S 7'0S 0$3/<0S03/ 0S003/O8OS0 0@3/0S $803/ 08 @(@$3/0S 03/} 003/0`q V &S 0X3/ FR0\3/0`V0|3/0pqSh3/&0DLt0T0\0lX0,f0`000dO0hL@q,0S0s00&0l 0p8H0t0xA0=0|t90hh&7S0X! S0L0@3/ 003/ 0 3/ 03/0X000000  0R D3/03/0$3/<0S03/03/0S2 .003/0  `6/0403/40 0 0`6/0 `02Sp7/ 0A0CS003/00:0020%j4000000P0%4%&0 00#D040|20$0?0%90 0+?H000?à 0 %p 0h00 000100L02% %20|030,0,00 T0C `008X0@2Z<堡\ 8@  ` N ? dd!Q A x%@t`!p p # x0000#6l00s>(00 0u00(100Q503/ 0@B>M>@)A@A'@-@%@t@(A @:@/@@7B-TB+BE@M@W@A]@g@i@_@k@o@s@y@@ܸA@@:PAVA,*B@(AAA/@@@@@@@@@@`kAHM>@@ N>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$OӚ- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ 0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P N`4!"8`<` H @ 0 H H L  H 00  0(0pwwwwp@-@$0( S p@J@b ,00,0/0 R,00,0/@b@-(03J jWVP@b 2CP/2S @-/@-2@020@#R 0PL  R 2020 p x Q @ p@-\0!C ! 2 4Q0 2(0$! Ԛ (0$!p@@bR/L-,倣 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ倣 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-倣 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/@b -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-pM@TB @ T T T9 !TX ``0 P0 R =R  EG@P 0=SPX @ T h p x X 0  SR0U=S@&@ XP@@PЍ X  ,WP ]( 9P@7@- 0@P P0P R Sz @A( Ѝ0@-@0 |P V oGoЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 0 PN@ @0 4/@TP @> 4/@G8HIc41 !0R$04$0/Db/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQb(c,cp@-A0S! 0S\X l\Z0_03/UA 00<000S*0"*030103\0"#   B0" 0%& %6 " ! \ #30 00C 300000C0'$00pCB͒,cAi!i b,@1?/ //?0 0!0S 0@o/ጌb//0/////?  22//-P/6ᨍb N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: Nbbbb1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S 4 %(00(0/O- R\bY I* b$\" ↑in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0@bH00S/@-@0  "!$0p03/0 !!c,c03 /0@-$@4 W< 4 @ 8 L < @ 0 < /p@-P$@4 W40<080@0<0L00" @0200< @  00p/$ 0L 0 00/1 41400 001/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@04p<0001X1070 0 0\1pO-81MpC04 40$P刢!.!n@V0` V01018700f` !.pW 0000 0 00 `L<`刂0@0 0S101ߍ@b@00S/A-P@`4q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X?101101 0\! O-Pp4!00 Q00S@M 46CSЍO+t V000 0$00 L04P0C0C00ЍlPPPP 0  Z0ca 6V0 J<!`P741aZ 0 `P (0  3/ Z`(  `0v V  v L0 0C0CL00" 0 0 0`0`20p@-0@ c0, !0  P80T V0X1 01  L1  41 p@2/L00CP@bb02/ $0 " ~00000 0 0$00(00,0000040 080$0D0(0 L0/SP.!6  \* p@-PjVC0 L00L0p6t&0 p6t&phPC  P 1  0L00L0p6t&0 p6t&p/pp@bP 0@- @ |M l Q \\ QQSH0t ST0  !0 @|Ѝ0@b0!R 10/cp@-@P >tPp c0 S   -t0@-4 0S$ @ cbG-<2pP&TxM TP&  , ! LP PEPE LPR`L1  ` 8  V0 01! 12 S@ : V 8 \A! 0"@L!0000 0 2SD400V` YV# 宍 t HT0  !0 P,^xЍV@ @0 :/P t )T0 !0 P$@ xЍG<V @bІbc@^8 h  "O-`P|T&xЍdp@-@0 dd @QSQPQ0PS 8P@803/(0t@p0p@/` D ,c(c@- @p03/,c@-D0 @T  0 !!奈E@5Ѝb@A- ! 1M03/D0P `X^@P pX0 J5 T@Xs@@@ K9@ p`p0Qm /P ~]0pL p4P0$p00 Ѝ܀b,cZ>`ccbbЍb/@- X0@P 0S<"020 (0 P6 0S: 0 P8 0SB 0 P@ 0SD 0| PB 0SF 0r PD 0SH t0h PF 0SJЍL0]P!000 0Q P 0KP 0@000?P 00003Pp 0800'P@ 080\0P 070@d@@NA@PAA@@A@@ @ @@-H00S<00S~0 00000むЍcc00/O- 0@4Pl0\h`TD rXq pY > R7: R3* L` Y  L\!TWX# D p(p W*Y ) p 0S p  ``0@[ ЍpWr `@G-Sp@` A S5 S11P  @D`F@0p3/ L03/X(@`pGP pD03/ P03/Y@Pl`@03/ L0G/R8P@03/L0 PH03/T0cc,c@- ^ 0P \00C Q0啈N>@A-Pp4`@fnP 0Pp 0<0`@P00 (@0 0,0 @b4RnG-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0P  `FP@VU0,00,0000,000000/O-0p  tt,`0  X2d0 ЍO/@0@"0 S )4S 04PSz \  V @D P T*N0IY!80 0 @ `FV@DP T*0Z*BY! 0CY!(0 0 A3A3C?o20 0 @ `FJ0V@DP T*0Z*BY! 0CY!08 0 0 @ `FJ(h 咇 Ѝ2N>-@,cZ>B@_@C-@Pp T N Ѝb2"0S@A0j0O-M<`N@N@TpP3 :T3#X0 ?o[20S 0 PB 80P&; 00X0Ѝ`0@00 0SPT ' 0ZV: V*S 0S!>\0> jJD 0 0 bZ>@p@-PN@N@Q 0A p@07Z>b0@- 0P0@SP0S   0#0G-p`@00hTЍ PZe 0 `TP1 000 IP`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 Ѝ@bO-p , 0  (0MP @0800T0R0S R(0p,0001000ЍPU @0A#AR M<< P P P9H H0P0\H0 0 BH0P B`0 0 0 H`P``B@6*a"*U:bS z@0 0  0 P PE$0 00009 @bO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T [LP%@ @ P @[H0@@ ?:S P%0:0PD0@S 'L Ѝ2 O-@MLT) Pp` а@0SЍ0S   0 00H0  0D0 0@00 0P `@D<@<  HD@rccA-PP`@pU\\0.b Q   \ *8  00GS0!>000P-//G-)0PS@XqM` $ R xS +(0 PVPV1 0 02Ѝ R ZS *P0V0PV 0 0 x$ R @S +(0 PVPV1 0 0DN>@@ @@-M`@PP#Tʄ&HƄ&<„UH/, 2?0Rr pB```@Q```CPPP T@%PP `1l p兄 000T0 } @Ѝ@wЍ?@L@Y@lcdccccccf@@@A-CM`POTYЍA*RI  !pŸ *Q   0"r3SsJ0P 0Sh ^JX!\1- H J`8 ⠄( 9  2W3W)0pW0! 91 z  G RE3 3@3  plh1h!0S \1*B0S L!60S`kA@AB-@6@C@G@U@@N>ѦA@@@@@@AXV`A`Acc@@b@o@{@@@'@C-pN`NPP03/B03/0 3030?6?6sNsP2 00Z82 0E0rZ 2 0I0kZ2 0M0dZ1 0Q0]Z1 0U0VZ1 0Y0OZ1 0]0HZ1 0a0AZx1 0G0:Z`1 0K03ZH1 0O0,Z01 0S0%Z1 0W0Z1 0[0Z0 0_0Z0 0c0 Z0 0e0Z0 0g0Y03g ЍCpdE` ЍCރ,c@bU@b@o@~@@@@@@:@N@b@x@@@@@@@ @@ P-`@P p!c pЗ!P 4 R $LpL C耶 4/!`@S`!W , ,`! !oDЍ@b5Reset vector called, LR = 0x%08x-DMO-pBS )`!W , ,`! !oDЍN  0O   ! "`"Рo@@@t@@@@@@@(@5@2@=@e@C- @pP(`  0S P 00PAP 00(PU(Q 00(0L0 Ѝ@0?  0 L0 00S 0 ht zG  P$pA@s@-@ \ SP`t bG 00 `$PЍp@-41@d`QP R& $ z? 0    $!~0t0~$0`0~40(L0~0880L00~Ѝp@ ԍb]@@@@@O-T儔M0@c3/03/1p0100S  !00S0L1  3 "P4T0TP4QU 00 05/P8Y 0S L0 xV~P0 0S& z Z"*430S(0S L00R6BS 30000St F 8+? Q R6 < SPP 0  P1( 3 S& R000<} 000S00&R ! R &R ! R Q!PUPPP(0 0 0P(000S 4TS R 0S (0L0Ѝ0 }t F0 Y0 Y Y ( 4QdPz_P0 s0 l} 0(08@(cbL@z@@O-PM1c01ppWL1  00S  !WL@6們倡T7 T*p10S1 41  00 pP7 0 1P0 t E0 [0 04qdPzp0 s0  } 0 000 0vt E00 0 00 $00@4@!0  P0J$JTL@0* R @Ѝ@b@(cO-`1`d0P@3/sHHaWDʀ 0! # 0    !U U( U1 ?oT20S00 0!!s0   , ! Ѝ ?oT20S00 ?oT20S00 g~,c@bxdddZ>@00P (0341000Co//b@b!:!P/ 0  P/08 0. P/Q:#:/b @-DC.@-DG-08M@pl00 00,(p$@ @@ @`P|0,0L0 0D000000(p$@@ @`h8ЍA@cZA0S;0;0 / 0 R/<0P/0*4S/0S0 0 /000/,c*4S/@-0@03/0BN0,cQ(QP0\0 /)Q/R0 S 0@0D0/S/0H0,cQ@-@ (4S80BNX03/00)4S0<03/0)4,c0A  @/o!"Q R/p@-@ $Ph$ ,\!/%R 8AMw00CS0p0 p@ Bwbcc@-@|0T0S$D 0SXq 0S@@<0QD$   D$ @@DDb;c@c0 04Ē Q884/0H4S/zkb@cT H$R ck@-@@8P 084 $ 00g4@cbb@0P/-    B B  P^^ $ B$ ( Q !! B B!!b0S@0P//O-PP4LpQTX4Q9 @䀟䠟fU*%:1 RP$Q : 0000?0@03/@Y0Ph|%!1XLP L0뚟@03/@Z@c,c bAp@-0PXdT4S N@l $60L0V L0?4`003/03/+Bp@cb,cp@-D@[P\y_0``003/03/`E\4P_p@c,c0O-P` @P\Q pQ00܁U00SG R= Ѝ ^^p Q@` WW0p0U0 WU0 `` 0!&Q0 !SL   0-  @T00 ЍO/QᨰT ``  U Y00S`` `t!& 1!TL  00 @b,c@cA-P @`pTQ 0 "A9P 0`PR  V`p@V0A34100@bA-`P5@pᦿ<@[dP_\[_P`h003/`003/03/`h!*d4P\4P__;c@c,cG-1`S@!R0R 0 P\  0 \  1!qW0`0ó?0`PQ 0 ^ ` 0S0 SR! P YY S 0h0hS 1S 0h  PU0S0`000Z>bP/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B  b/O-`x64M@00PX=T6pHP 400(0(00 m00᩾5T"0P0 (60 00 0$01,0$01 0S ` P` 4`(0S" 0`S<V4  m`/((: ` 0V xs`P `(:  0000Q:   0dsP 0R  s   `y0SQ @mM (* 8yV0/ <3  |0  % ` 0 0 0  00001T"Z110011 040450S`8庽ḽ <   `$4ЍZ 0000 000 S0PP0T0R0S 0T4PV z30PS0 4pp0V :ERW @mp&: :6R01 0p0P `0 &? 00 0V:U 000 Uc0SP0P 4 4 0C40S+ 02P0' ꄭd@O-`λ[: 003/ ЍOy+J JFV0!0109p+U/P@唐P0[: B຀1P @   ,@   / @ 2/ 0 2/Pb,c@cA-@p`^჻$4$*$0Q0Sẻ.%ʠD ʠF0@00W@V X000$<01S  2# Rᘻ $60QᐻU 0S%ȠH Ƞ$HJ$J@L b00p@- 00@P0$ 00Sp`H4S d0)$4$=H P4vh5hE000D40@@DDp@cbAO-`MnP@p0G0000T :0 S:0SO,ЍO$::6W01 0_P @ $? 0T*. , 0 0 嚿뚿 R <0 ᷺ 0   + 0 S `!* J +4S 0,03/0+4Ѝ;c,cO-^PPE@pቺ댐匠ZT:O `fW`1P@ $5?0CV0 GQ!803/@Z,cO-@P$M!:0`2W%<01S 0PᎺ$Ѝ%:  0 000Z P%60q0W X [  D BJ0P <% <P 0 Z @00@0 00 0N0皿   뚿$ $0,$傂 !R4  0?  PX0P $߹ <P 0 @00@0 00 0 0皏    뚏Q R0lœ\l% 0S 00 Ls0 @  0ps 0  s;c@cA#AKA0 #4!R/080/@b,cs@-@PY~ %60/`P 8p0 00<Y姹᥹Ѝp@;cO-q3Sa4100@-4S[0,S儁勰U 4!0 PU ,$$#2$$0 SQ8 00 f;ccb,cp@-@0>00' 7ܴD h@t1q $4!*$010P,$020 0@01 0(1C0 0@@ @@@h1 0000 @@a0 0000@@ @@@h+000@0@0 @@@g 労<0,ЍO/@bb@c;c* 0 JpcctbbAccA@0!S@0L4 S00P4 S$0;00;010?/@c8 dp@-0`S0@TT!* Sp0XT S`0dUP0SH_P,o$EO0?p@cA A@-@ !:0? 00$ 0DbO-n0PP04 wo`nR@` R Rph1ě{`1dX Ѝ@18!L{T(1 !P{X X[#0$  U /FVH0Q  5o P  |($"(XR#  UJ뚿HXH B/JZH?A8 d@cZ>dAA !:!/ *b0 /8 d7@-P@<00@S Ѝ0     i8 d0@-h0 P00 AP0 S0@T0C0@S00(8 dX0 P/ -A ^0 S00CQ 8 d p@-@P`++`%L 0+T$;;L4;PdkXd ;/0SPLdkTd+;+ ;;+ ;0+0 ;;t;l;0+.h;0|+U.d;0x+.`;,0p+\;$0X;0?00?p8 d@c !i !!G-p0匐0@N@N@`THPFO0?0000?%: P(Hn%U_[qJD꜍bbAO-@ᨐ娀zT:00ЍO/ 06Wx`!`1$U?PPT:0?L0 HS @03/003/ ?J,cb0$4 /b0  ")//0 !Р!/0 ! !/p@-PM;P# @,`4~0t00 \ 1(Q$  ,0(&#(0 <@0?6/ߍp8;ccPb4002/ RB>00?0 S/c 0P/cd0qp/@-=P P8@ 0ASA008;cPbO-\2\bM<03/ sr @R0S0(("S  & PkЍOnk;pPo 0Sl =@ktЍOzkcP71@Q0@į 010 SxE 06 SPH1@HWk 0 $1y:0 0 0 0WA[%A9A@EAfAqAs@-` P0R0B!C!,C!$C! @P#41 00 `@x0d03/@ P40P@0  @P 4000400040Ѝp@,cb/0 3G-` pP /3T~M0@:0$@P ${3U 00<0 0@0$000 0 00@D@ //C-H0M00p0el00L`@@0P 0&&x00P`TEFЍ 40 00 JDAHdbZ>A- p,lP0@d >0`@T0@D@p 'i00 `L0000L0AZ>bO-pRMS `PP1P000 cP@  0S1 S9% DF Fd˂0 01/1/ Y 1! IE@VSP S0  003/03/Y 803/`J$JQJd$iЍ00?Z>,cA@- @ ̯m00A-@`@00SIlPP%U PH UG UN UA 00 03/le6Sn0ml48ozeXxe3pU qU00 03/n(je6Sojnpp W񟗉LZ!LZ!Z!X[!X[!Z![!Y!tZ!X[!X[!`[!tZ!|[!3/pP 8008080@8P80 3PP8 X203/P00 03/0201(e6SipG Wk[![![![![![![![![![!\ `0R0C?o20S0`0WPP8008080@x :RP P  80  x %Ry R P x0)Sy0SP80080808  PD0S0CPD0Pd D0S dP0 ds0SPdh`spXdTt`pGs 0Rd'A=A@A`b[>AAAAAAA4 *0 -$M0 0 001y$Ѝ/'C-$MP@ ``,00$0|pJ0 0@ YP0 S <3P J0 0 0@E$Ѝ'D[>@-4@$MJPp` ,0040 000`0 @@p%$Ѝp@- M@P` ,00@0< 0  ` 00@ Ѝp'`@-@ M , (* 4  0   @ Ѝ@-Z@(M0 .$ # 4  * <  8 @ $(Ѝ-$M(000 ,0 $Ѝ-U,M# #008$0 40 ,Ѝ@-@PP 0P0O-4@,MD5,0p0C0  ㋟\0@000@0$@$0>0?09 0`0 @@ @ lPy@ kQTXP}{,Ѝ P0@D1 T00 0 X@U PT  0@KP!A-@p0`HP0P0⁩tPP P0xt0p0`t0_0jA-P@4`pVd0T# T) T@t`@H P 0 S08 @TVA0900S 3/|@T s_\0Td0Sp!@8 0  S   8 d  @@@ P 0Sdp`0WQ Q QG-@@P(Mp0⭨d0Sm0Sj80 00 03/xbG0ר`0\SAHbD40X3/`I0Ũ@ 80;808```* 0/hj 0` l0  S80P`;80夠 Pd P0 d00 03/`Hb0d080` 0Kd0S `0⁨^(Ѝ0yd R񟗒Df!0f!0f!4h!f!g!g!f!h!Dg!003/`0"v0d00<00<0H00H0P`y0L00 03/$ad0S0(S@00D0 00 R0B0CS$000 03/a0$0 `D0S` 0CD00ڧ80P0 0`! X00O0 |`Q PL0 0L0!0 D @P``D0S0CD000 03/a00 03/dad0S ?0ϧ0 0S 3/0Ⅷ80r oXA}AdbAAAb AHn! A AO-q@`pP\ d0P0C?o2?3\0S0v`` V)`0S&0TU0⏧d0SP P 0} P05 Z|0Pt0Pl0Pd0P\0PT0`/0@ 1`/0000q Q[>P P P P P >/0( 1d/0000[>P@- P P P P (< 00 01d0000ꀖ[>00/00/G-@p0⽦x0S G0|`V @ 0R,L0S)80 &  80! P(P  P0צ 0␦P80 @00 03/ v``x00x0t00t0] R00 8080;80 @T0P eP_o PuQ!T0PE5T00RU0 0 03/ @`P0000Ⅶ yk AB Ap@-@P4`V05x00S0CVx0p0lx0Spp@ap@-@P|^ 00P 0Rp@Jt  t \p@0Fp@-@@`P0<0 09KP0 T0 00T00 0@ 00C08080;80  @0 1T"T <08 0<0d0 0S00L 0L0d0S0S80@;8080 p@0S 0@0>\d0S0p@0000@@O-L @`@RP P0S P1TSRL0003/<0\ 0<00` d0080@80   ! 880000080080p08S  0808pP 6 0[0 0"3/t7880808S S S 0"0!000 03/8._a3/)_0pi0+  0f_0!Y [ 00 03/x_@00Z<0 0GOp p0[& A A A A AG-0@S 3/dadQ0P0Xq0P0儀tXQ0Z t03/ t0  t0 5B!a 0 :0ⵤ t0 X R00 0ݤp [0Ԥ bgfff) AA-@Pp@@ @`0SЍ X`P@ 00 0X q- ^ /$0/p@-`P!P@ $@T @P  pp@-@ !PPp$0Sp p@p@-8@P9@Ttp0U @hdp@-M@P^ $0HS 00 03/ ^$00%PU !R00 03/]`^` @P:0`: 99000000PЍp@ AD Ao A ٣hdA-P@`h0C10@B1d0S6w!w!x!8x!lx!\x!\x!dx!\0` 0C 18000⿣0A0 lA!|&0C1plAq s&Cq00 03/<]00000 03/d] A AO-M<`V80 "PS S SQ He_ 0B E $8dP :_(0eK_ 0!B_ 0B  $; 0PQ PU 9_Ae*_ (_ 0  #_!_p0P04)D00@0L L_D_< _H AMbQ`kA A A A' A/ AS A@ AA> AA-P`@xp`0S 0P 80 @   R @R 8   ^@e AA-@p`00Sd0SA3/p@ l0#B@ Tp!!!!!O-M 0`;%L 01 2P !  $0 p\Wd1)0940B48 0@ 8 S@`D,0000ap 3d,C30HL0)(0 pD@ 0 p0  p9 R0 `0 +0 0 PT000 D0XFP@ 2ߍ@lbAAA"A j>\ O-`h0,M p $00 pA P 0d!S0 8   #8 S @000`0 S8 00 0 +PQ,Ѝ3/UY#00 0V%V0d0%0l040\@ 84/ X$tV0d0`P7#P0 HU0d0 PlbxAAbMb%pAAAAiA#A@-@$M`0HpP    0 4   ,  ,  P CPPPl0PPH00PP080 0`2400( 0PD$Ѝ!!,![>;AT! 0R://p@-P"@"`"P0⚛ oPcp@0̛A-`P"p@嘀l0S 0PP!QQQ4)P0c0 bAAp@-P(@ P@L PppdLA@-`@"0P ᥠPX`@i"W`0!S\Q l?XP08 X0 S[>5x! B00S 0L0Sp //O-qM( !P\00C000s"` 0B00,03 34100 0P$000U$ЍQP\0S00S`0 S0d0S @(0`H@L@P@3 3`@P0D@h0$ 40Tf0Pp 0uV00SH0вr :_0H0)8O0)4P02@00`0 0 @HJ@N@Q0P 0b0 8< 0 4 RY *S0! @:TU@IA:p140 0< 00 @S1 8< 0 8<  4   0$pR08040[F00 <1~V U: 0S㄀`@! ,@10 $"449#9p @V0p 0 @0p0 ,S00Q0S (V&:  P! (P @0S0$0@bU [>'$.A!@-@@A-`@P0P  =U0 0 pP0V MxH ` 0XR00 N47 0luCAbpAxdpd|dA-@a P@0 R p T T X0T 41 00AW A0AI 7cUU UP/p@-Q@P T0S L TpKAYAR/0@o/A-pP`0⒗\0S d@P 0S `RA0⻗p@-P` @0PPל MMM4P0Wp 00s @ Se /Q@-@ P\T08^@00 0 0 KTЍ踇AAAoAA-@P@P`U0d00`0S\0T4P 0 pLLLppy0 aP\SP\p@PWA803/@@AAAA@Q @-S/AA-`(M0Pp 00( P4 4@/0 0|0 0O @P j00 D0 @(ЍUSh>t!! B <0 80 40/0 8< 0///O-P`D1@ 0$PP3 ' p !)0   0 pWUc0SDx0⎖$$bjᬛ ЍHj>-05 ,M0 $ 00  02,Ѝ0up@-}DA@0  P80 (.80080p0-,M0G 0 20" 4 00# 8 !$   D,Ѝ0u0-K ,M2$0 ( 0 00 D 0,Ѝ0u0-,M0 !$ 0 *![ $ 00 2,ЍA-P`P@000S3 S  pYA@j>@p@-@@0PhQpP`0U0$00p@bp@-@P@0◕_bp@0PYbA-l0@P~0pSSn0@0SLx0SIypWF|`P(1 0Wn00Sx0Sy0S|`P0 0<n00Sx0Sy0S|@P00( 0!bHn!@-@`pP<M$,(E (0 00aЍH7cA-@p F`0@Pl- P D180 0S9@A VT(0 0`01eЍH7c@-T0(@!60@@ @1 (0$ 4cR$0D1@H7cO-R0`M$ @`p@0P044BdA0H D`$  `d0@`@P& F0L`L00e(T0  `40LP`N@Pp#"448#8SIC0X@X00Y0Z00\@ @^0`0  PXF`P-@PM0 $"44 %8#8S00 @僀3_0 0 X`@P2 c0H 0$@0(@@ P)?oQ20S AQ 0ASࠑ (0岠PS@ @0004 00 00000Ѝ pS PS SoUrpW SXpSS,<pSSSxKpSpGp ఀpYY @(Y$ U$ PU,, , 0 @ S@ᡉC0X@X00\@ @^0`0  PXF`P@P0 $"44x"8#R#B#<_0 @0  X`p@PPp0H0Xʰ0 0S; 00PJp 00 P0u 0\p\P@PER RH7@Y  &j"448#8 SH͑ f040 g04i 00000"20 00 0@0k 0@0 0Q<<<;0lp t~x{|xuX= U;<KP〗,@%P3 0up@-T@P0`S 0S 000 0000S 0S000 0000߈0Sp Rp00  Q0S0$00ˈp@@- 00 0 Ѝj>0@-P$0M 0 0 'Ѝ0!t!@-(0 0600Ѝ!t!G-40M;`i$0(020 0 01P0% 0$ 0*0 0@ 0$p[`PP  Q :;0 Q0S  Q(O;00Q 000 " 䐟ؠ3408 0 H000@P!R <@<  N0S>= @@D$0 D0 @l0<C@PtcP@0cS00Ѝ0uA G-P @P  P0$ bbH0$ H08<06000000 0(0T000$0@!-,MQ@4 B"0,4#00 (( $@ 00D,Ѝ 0uA-(M@P @p`,C00'4#0D0T %0:00 000Dp0000@"$p(Ѝ0us@- 0@P Da@0P40   H0b",4b4#0!4400 S0S000Ѝpp@-M@0Da Px0/K?4X0 X 8  !0 X0<0 00 0  0ߍp%A0@-DM4 $Pd@ 00 @0D;Ѝ0 @@00@0D N@-S\ 0000D RЍ0 0D / NC-P0,M p` @P 0 P 0S! "ĠČ  Ƞ,ȠH p `  P ,Ѝp@-0P(M ``P @P 0` }P 0S!0 "44 8#80  Q    0 (ЍpG-(M`HDq@0 HPL0/`a V S@1 0@1 PP XP PU Vt (Ѝ-+PP80L;D  0PPZ 0 S 000P P0S !$$ ("(R(  $(  R&FJ  14HL!;P1800 080 L1 0H1$ (0d0,0000t @1 0@180080  P;D  0P ;H10L1 3AkAO-MPdDAp0 0R80` 080F#@X@U $H@C 46QP'0$409! 00 00 80 40`000$@P0 U00 001(0*0 0"4 0 `0 u0D0H0PTX\L0hP@0ݏЍ  b!0u S0@-(M@! "0:0(0 00 0 f(Ѝ0us@-0@ CR 00  P0`P 0S D140;!$$ Ѝp0 T0C1Q   D!4  l(,"$l$" A0CO-MPO30 F0@`ᴳD9@18@@@$S@@T @g|/V pel?V/0CVX?VK 0 0 0 P`]P@M0 0 0 P`leclFbFVd!x!!!!!!!!!!H!l!!!>V >V >V0 @0d0@PD140d &"44 68>V  P >030/o0S@@" ߍ-V -V ^=VO =V =V@P`PUy V@=V@8`0`@D 9P_ P0D 1@PN00`0d '@P80SL !$$L("( l!      Dl<V ;C?CVs 0V0 ߍO0<V(U@PE0 fd@h@d0F"4k000 #30 ߍO:V0S.!h!!!`D0`d P 0@d @PD0S&g0h "44l 8#80   00@rG Hh g0 30 30 30 30 3ߍO  ߍO   RX#3P0 T0@  @P+  @P@1 0@1"  ߍO|  Q<00<0<00;&00    00 0Y d0d h0l0h  0 0l &0   d* [0 %D00  M0 0 d0D|@P0k 0"30[0D00 030N0:00 0x5M 00D d0^@P h[0D00 030N0:00 05 00D d0M C@P [0FD00 030N0:00 04M D00 d0D'@Ph 203"! 0  0 0d0[0D00 030N0:00 04M 00D d0@P\0k 0 1\0D00@030N00 hM@e0:00 0l3@ 00 0Dd0@P0604\0D00`030 @N0 0 hM@e0:00 02 00@0 d0D@P` 0[0D0003?0N000 0|200000 d0D* [0 @"D00  M0N0 0 d0D@Ph 00"320i00j00 N e  \0h * !D00  M0 @T@ E  d R0D00 J0:00 0<1@ 00D0d0M@O@P`dpTP  0`0F00F   F00F   V0 # FVH7ccx@c Q c@pd c@d@!cpd ccc ccccdc(c c<d@ j> A0uA N e R 0d  D0H0 0D0k j 00m  D0d@PFH00I00A@`P  e_ R0 d00#n *k00 l00 m00 @ d0D@P+X ހ@ E:  d6 R0D00K0?0M0:00 01@ 00 0Dd0@P6#$$("( 0BS C Bᓀ`P~  e R0*d00 k00l00 <"m00 @0 Ddq@P !$$("( R B  $@d`x  *F0 ",@,0 0 C @40 0 0 ,0@D@P0 $ "448#8RSh#00Nӑ;@$ 00@Ppp$0,0F0,p,0$4.00 0ps30/@ :03 00 0 p0,Pi 0 S$0 <00  000@<0;0pQ08p80"0x$`t @0 pd08000: 0d <0==vo0@O-2(@!62MD180 PP$0P0ЍO#0(p(0S  &}`P P 8<pt 0 2$0?0S0GP G A >1 $0 7:#:(: 0T tT0P LpJLP$0PAUPP$0PCP0; 0Y0 $0 ` 0PPpGW(P0 ?0S$ ?`PP $00|$|y P@$(00TQЍ PЍOTH7cj>0 8< 0/O-P` D0@ PP5)@p  !)0   0pW~S0l 0⧆]SË Ѝ!Pk>|k> DH0S40<-@,M@@5 0 , 00  02 ,Ѝ/᠆p@- DQ0`@1  @P@1`0 XB@1@0@1,80 .80080 p& A@-` @1  @P@1`0 B@1@0@1& A0dp@-@0@PC @1h@`0@1QpP`0U0$00p@BSp@-@0 P@0Rp@0̅RA-@`@ 8 P0p0Sn00Sx0$Sy0S80 00 03/`?80<80P, l0~0pSn00SFx0SCyPU|p?P|0 0Pn00Sx01Sy0SOPUd?0m800800⧅9()PPP H3B0Z800800┅PD AR AbHn!v A Ap@-@ Pf X14D180X00X0pO-M@8`p P*0D P0$<0$8P0 @$4@(0&4P 0 `0800D0p0L0 0T0p@-|0(@!60hhDa80 80000$00p@6P P p@Q(7cO-,M` p%0 0'zPP`@ @ 00j ` 0 0` @P `@(z,Ѝmp if` wa0 0% o 0  ` @PJ@`0HLlhDd`@@ N@-DP4 D@  \\ @@ @00D0Ѝp@@ @ 00D0pC-`@pLMP0 00 000Y0 (0 0P XLЍ0S!0"4408#80S 0?0S0 ă,4 48#80^QSQ0 $"448#8S.0 @- 00 0 Ѝk>X p@- &` DP<@P P  0p@Qp(7cA-P`%Mxp@PЍo P D180 0040 00000pQ(7c0@-P$0M 0 0 勄Ѝ0!,!@-(0 0600|Ѝ!,!0  `00000 +@PP$ ( 0000Q0q 0&?0P00  ! D 0 @Z  D0 -@O @1 @TG y@1@P@0`0@1>@<@: @8(7cvdpG-@pHM`0 00 000W0 00PP ZpHЍ0S!0"4408#80SPp0?0S0 48  RQ 00 t0 $"448#8S.P0 C-1PS@\Mj< 0D0p`\Ѝ4 00000D(0+P MP/00 $"448#8 0 D@P< 0@00 005:5 020,30(40$10VWSQ! 8p`;p` !<#$+4"0  t> "T1j/(0P1 ,0H100L1404D0p`Z0# 0$0 0(0,000 0`2 00 D(0$ OP`? Py+0Sv 000S6 Sp ,0p`i 201 483 00DP<07&4;d 0$`1S=x:D00(0SM@00 000 5:0>0:P0 (00 00 0( P0S"+0, "440 8#8S0 48D1 80 PT  PMPJ   3/P p A N$!AA- M`p@P ☁j X409400000Sg S  `L!!L8 @%0DQl0h100P 0X00080 080x<0=40 PPP RP =U. U/ UT`d^!<# V! T10P10H1L!<l<W d0d)PT< ЍH0 S@10@1,<$0l>@\l>`kA@!A!!@~!A!AG- PDap0=@P9/$0 Aₑ @Y S @PP@  OP@6@T#88PP RP80080 Y P.PP 80080.PO-!Ap@-H!@0PS }?!60#Q0P(?0` ; S00,0|0YZ2Xl0%XS40L10H3/H14 P3P@-P3@  L1H03/P3;P3O-M`@8p<{13`Ѝ*>0P P3` l0P 0  p$1$ @ WJX0H0/ @  ) B$ H$  ))`, 0徲4 #(08 <#L! H2/H! < "`H!aV0p@@0ul>A-H1P` d0dR PP7VL7@DDpDV4 !7@TA7l>!A!A`kA)AFgAAO-(`p\@_[00H17H*0LH1H1.p 4 d$t"<402P#  h3`S002ձ02ű@202(0@HL1<03/DQ"""""T47P27 D@<*7(900(b!A@!A"A"A!"A@-{@fP@%JG-pPW`@(  8 |@D (,$D00PT`H00#AD L (,W00 02P3  D:(0h, 0 Q0000P0S202l4S H10  W0 202 0< 0m4S H10  0S2<2P3@20202P3 0<2P30 0 2022<20mSp40p4|L1H03/G|G-p@m|H1PC@H1p$0 S 0!R* Pd0P_POP08 |#PC|bD"p@-]@S|x#Rp@|d0x3T-p@-]@B|#Rp@||d03T@-@`pP<M$,((0 00HЍ7cC-@ Fp0@`MrPP PP X#\30 P3A> S9@A WT00 00pnLЍ7cp@-L(0H@P#04BP3 @l3$0S$@p@~7c@-`MtPgp@T 10'*"*0*00(00,00 $0$00Ѝl>p@-PP@500$000H18 0P$P \5`0H15 V`p@n09SVSNGQ~P|0Sy 030 30303:303:33030400,0.04 ,$0 00$00202H120080$0<00L!H 2/0H1c-& c  00*00` 0C03 aS_S<00S 3S 0l3l0000 0 `~ ,00*0020 00#0-000 0#4>`j?"Az"A@@11p@-l0(@!60XXTP300$00p@P0P p@:H7cG-@02PZ H1ЍGr T`D00LpWvt"""""h""("p z0 00000/ R!44W 0S@00L0S03d00!C= ЍGzpt 0  0H1@H*0 U H19p$P0S  ppx3 d00xC0 z00 2@0S *"*Y40S 0S$00H1 Azp4 0Cp4|zGЍG?G(b"A#@"A@""A"A"A"A"Ax"b"Ap@-`L1H P0@3/P P4 P@/ 5L1 0H3/L1 0H3/P@ P PH10S( T6@00;00E0@0 0FFH1 p@#A#A0@-M@ PP *p0B8#8S 00ߍ0:@ <000l$RH!     8@-M` PpP`-*0B8#8S) ' Q#H16 0,00@400300r2L10H3/H1>4 H1`" ߍ-`0um>@-@0  6> C"l3t$(0W?0,0U?000P3@>040@ p@-L1@0H3/PPP3#P D6L1HP03/pP30P3P3;P3L#AO-Mp`P@ @a y 0pTL10~H1 H1% H1  xSS)=&#5 6PE h5 pPEH%E~ H1  P 4H~P5 `F~<00,(`$  P0P 0$5Ѝa@0  k_Q Q P\   t5QD1S /0T l#l 5D1 `5 H1  H16^ 4?0UW P3<P3>0 P3@0P3P3 o D4"> C E1h3? : S?/0 <8 p#*0 R l3t# !t#/  P! Bp###` lP3@ E0 ?4 E!l3Tl 000000G5t3S l 55p#R 0/5-5+5l#1"P1"@$A$AAkA m>]#Aq#A|#A#A#A&$A`$At$AA$A#A$A$A$A$A!%A.%AC-@P@M$0,c 0`DЍ7cX p@- &` DP<@P P  0p@.Ep7c0@-P$0M 0 0 xЍ00""@-(0 0600xЍ0""O-SMܣ V@ @0P` D0P# #[ p0G!'[ K!B'B[ !B[  0 0 @E`_8#[_ 0#[ 0 0 BPq 0pS   Sy*0Sv <0 00000 00,0 :60L2 00<:60 0Hx0X0P0S`  |` BЍd ,@jP X00X0@帄0 XH J 80(",!a!"~P!P0H!!0S`ЍOЍOЍO 00004100000` 080,0441 P0`p9PtcQU` 0 R0RX``F`H`` `7cvdndQ0"$"A-`0MX@p `P$P HP 40 000p0`0DЍ(b7cR/00S  0 r 0@o///p@-P`1H10@,0`02X0!40L10H3/H1  ;H1p@ze%A@@0uXm>O-p%@ 0 `P[x^puP !)0  , 0 P&UC uL1߿H 03/   =   鿄    u-BL 3BtTU OS0t4zF> iu0H!0H!0 Ѝ "l>dm>@-L1@0H3/P WL1H03/p@-PL1@0H3/P00>ph0   " ""   00H00D000h0m>p@-@"QP `" Q Q0L00QP0 <0L 6#p@ /0L00P0 .0$ANAp@-P@`Pp0D02( 02<06# 2/p@ 0,   , /  ,/  A, 0/ @  /O-@0(DM`<0P 0 0hpg [G 0 \0$ pp + t0S 3/$0 $_02\ 0:/ 0@ 87hP㸗 0@ 7YP80!0d R2  R00p + 0\ 0< 000(h0,00000$0$ 6哂" 000400S 2G 2p`(`X0 02 p  2( t x@0'x 00 S0!< 80 S( 2@ ĠŠ0t0S $3/,0( 0_0 $2\ 0  6'Ab'A~'A'Ap@-@Pf. j  pR/ 0 Pr  "/ 00 0/Q@-@ . .'AYAQ@-@ .0.'A'AA-@PD0S0 p`8 RS s-D08 R0ڞ< `V< < 0< X X <00<00 R p0'AA-@p 1SD R8 < #" R0Q 8`P\pVq`00PPq 0A; 0' (dp@-@]P0 Rp   &00@-@MXP 0T0 00p@@0 @0 q &Ѝ0(d(A (A 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddp@-  MP@0 `400 00 0@ ЍpA?" 0/@-@  08 000!3R@- /@b@-@<P80r080<0A-`PDP@p80S> 0Aop0 0AT6BP <00Q@Q<00P .P &&A-80@SP <0Sxp`<0S<` 0(S8P<  @< 00A-P@h003/P` P P;A&h003/pW h003/O-0P`00@T p p 4t& ЍO  0S0 00^& 0S     0R <0X2)QA    Q!PX 88+rP 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Qpqp (p  QP X 0R| R\ ` $ @` m>(A 0Q8dp@-@P` 0B 04@0 0%p@ 0`0S 3/ 0 pp@D8dp@-@P 0<X00X 0@0 00S` p@$00X0S0X  0@ 0 0 04$ 0 0 00 R0S 0=@Sp@A-`P@0pS0P 0\ ; 0`0R`0$0`0\ ( ?Q0010(000C0 0 <Y%AA-@p`p0<00P P ~h0 03/t<0P0 3%kA-@`帀(A@-@t0 0Sp80S0,8A- @$p1`00P 1T04 0T5 0T 2C7CT,A0,W<<0 R 4S @t T``@`pV<04#P@/P -h8cξ3A 2Ap@-P\ @`0T@ 0 <0S 3/@P 00C 00pC-M`@P`B*)@P40S  pᴀPlm00ppOm;x0 0 ``0Z P P)0D D[rP4ЍC)Ѝ@\b(A$)A4@- $!@000h8cO-@P唐唠唰M80SЍ< 0p R P `  0 000' 'P5)A@0S'@-@<0< Q> 0,à!>0 ,#1R0 @bMb-  2 05S=00 `a09#80 8802 0<<0A-@`Pp<`3  A G-pP@PPD   ,`0S00,0!=2?408`<00 3/33@  0#S 1RR00R0S40\ PS P ^0,0;200R80 0K0C?o20 $$ \0&\,PU "440 $$ 8dNEFXPi'TDG-p`P@PP 0,00202?Sb40003/P3 PP68dO-`M M @LP00S80005/;,Pv '000$0\"\RS007S= ; p0S700c Wed0S  PVX &Qd R  QG0 00000 0S@ R*7 p0S';pW*0 @00R D@000S0S00ą /p 0p0p00S /& 6&pW*Xۍ Ѝ&pPx &Wh W` WT&0PWD@X`kAg)A@4A@U)A)A)A)A)A)A)AO-4@4MPipi80S<0:l=S&08Q D R< #" R+T03/80 S&d0S 3/ `p80SH}Ti 0PR00  (i S gV0<` `00SQ  00  `00 00 00U< `V S<0 `6 <0 0Q Q<0` 0 (d)A(d?")Ap@-P@`#i PU^ip0S \P0 P/ 0 /p@-@P i@Eipp@-@`Ph0 @T7ip0S \@ Pp@-P1 P#UDP3 0 P0 0@$ 00(0U4,P$|4y<vp *A*A*A*A@-@nl4j<h@D @-@ h,AY0S#*Ap@-@P 00P`hhhAp@8A- a@SpUʀ 0! # 0    !  0  @ 0! S0t l   ! 00 0h0 03/@T \p P @bxddd@h~h/P 1?R, /8#8S00  R 0 0 000C00, 3,0/?Q0, ,/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-Z - Ѝ0P  @pnp Q=,L0帢,<zpsL!DH1003/{#- _?0QR 0x! 100100100 0!/@@@)*AW*AG-@p`My10 888/P< 8!IP j? 8 8P N(<03/ 403/+RZ@+Ap@-P@ 0 $0 +(<03/400 43/p@-Z -d}P0.X X%,à1 0")!0 <"#1o\Q } 䅤MbbCWc+A@-XM@X  f 010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X A701H0T@9C>H0 @H0P  $0 00 XЍp@-XM@X  < H0XЍ0@-P$@\M h\Ѝ0X  0 010408020H0P 020+A2p@-$`P`XM `XЍp,0@S QS 0R`,@X  0T`1 hT020`H0hTP`  YP,@ ,AE,A@-$@00 3/ 40S 3/00 3/00 2/p@- 0@ `4P4P0480(0p P  `PU 09 0PA-@p`b0 03/ 0PPy99 03cU W 09 00<0S 3/ P0p03/7/PP| 0 4pW  7/PP L$0 ,\03/$02  PP$05 0  4PU3 q币$0  0 NP m 0 y P bPU4P0S8PP$0 0 0 FCppԀU 0 9 0ab 0 9 0ЍAb0 0S $0p p00 00 PN PW ЍAЍa,A|,A,A,A,AYA,A,An"A-@`(H )bLp@PU  0R0D0 0 TPWb03/bT0S 0P  AbaP-A-A-A-A-A.A(.AG-0@P`*0) 눐刀K0S V `VP2"8 $Gs.A.AFgAA@.A.A$ X0R/0p@-)00+P@*0,,声KoOOPgVPp(!n>C-pP@d`㈐刀\MX  0 1PHP ?o 2?M`V<?oT20S 00\ЍC'C-Q @lM∀p0@4`+N+ B0PX @5020X00ST0TTX0,@X0LpPIP 8 T4000 0 5 lЍr:BԶA.AA-`MpP`@P*U@x 0PN0X TBPz402|0PS20`0$PP0@P(00 <T 8 U40000 0``Ѝ2@:BԶA.A@- 00 00 00  0@P EP P 00 0Ѝp 0 #^P  U 0(P0 0 40 00 03/ `PP, PP x꠆"/AM/AA-@00PP f0000P80P0800 03/pP` HN`0p`0808(0Sd/Az/A@-000 009Ѝ@-1 0 ,ЍA-@00pP0 3/$`Q\@    0 03/P t1`P X0001v  1T1T1 R004`V 6/P`  @T :0  03/tyPp`P)/A/AP/A/AMb/A/A0S/A-0@0PQ0 " WPP`Pp0S 00@0P30PU< b)B0S/p@-0@0P'0 " p@,@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`@X T 0  Ѝ0 P`@DC-Pp`@X T 1 00@ Ѝ0 P`@DC-P`p@X T 3 00@ Ѝ0 P`p@DC-P`p@!X T !3 00@| Ѝ0 tP`p@D@-0000  0Ѝp@-0@0PR0 " p@Wp@-0@0PC0 " p@HG-p0(0S@PS@P d{SP`SX `⊭P x]0S00(0 3/0000@00]p@-P0(0Sp@`Z] 0R000 Q0 (03/0]RSp@OS@-0(0St@p@-@`4]PUo]0 p@,0/0 3/Pp@-0@Q0`p P 2/P D$ @p 0`( "4`#/ 0 /T!\R TR /T@ Q/ 8 R //᠆,@ G-`0$ MP0K p  pp0@*4/@PD00p8@0 4/@PF81@ 00~@P80 p~X (0 Xd000p0$00(h`X0l`射@P$0 0 00~ QtRP@P $0 r~ <03/ 403/ЍwR Zrp@-P@<@X`TQpC-@$0\MPp`x( X  < YD00010<@1`1d`H0$0 00p0 0 ?P 2"0 2"P \Ѝ@ 0b0?o0cS2   $ $0` 1011SX h 010 80t0H0P X  W 01$0 080H`P 0  rr2 6$G-@$0XMPp`x@ ?0 S㣤030# 0 X  *011 H0P-X  < YD00010<@1`1d`H0$0 00p0 0 P 2"0 2"P XЍ@ 0b0?o0cS2   $ $0` 1011SX  01|0 H0gP X   01$0 080H`UP 0  2222 6$21B31 a1/G-0M01S`PX1 y Vw$0R p00 pp0@0*@4/@PJ00p8@@0 4/@PLl1@ 0@0|@P>p@0 |X (Z0Y!d0@0h0l00 41`0D00(p0$00X0@P$0 00 @0|@ @PP@P $0 |@ <03/ 403/T@ЍP@ rG-XM`@X p 0V100 H0PP% T @DOoXB@T 夠X   01$0 0 80V0 0H0w@P  0 H3PXЍ   (P6$6$2 2 /A 0Ap@- P40 S" 3/P@000S@  3/@P`04`V  H 6/P@p 2/0  3/a O- pT1PWp!0`4@ MT 4/P@ 03/@1S< @P  ߍ<1S R0 \1$0      `V@@   0@P0 0 3/$Z ($ &21T1 R0Q 0 4@T) 4/P@XM < @PX0S HY@Z 0 XPHZ 0 l03/Y  X  R Y0  @Pn @PR040S/   3/@PGHX1000 R0D!00X,104@P2\1S S]!  005`1`1S@3@0 !z@P000'  T1 R0Q 0 4@T 4/P@ 03//AC0Ab0A0A'n>0A0A0A0A1A#1A)1AC1Ap@-P`@v  0 <W P= PN0 00( 0DH1 r@ LXP `[1a, 0!?A1c LT1pX0H!2 SD!4D1p 6a `'\`` HDaTH^pP  rF 6@A `'<`` HDa4H0 L+XP' `["(0a, 0 ?A1cT1n>gfff[1A1Ap@- `P`@0  p `d XhPlHm@n8o`0pqa t x|p@!R0BS2l` ` XdPlHm@n8o0p(q rsa t x p `d XhPlHm@n8o0p qrazx1AC-lM@d p$X 02XP*00 0`40 ` 0 0 `h0&hS `P G$0 P 4I.$0 00S00P080P$0P8PX0 0 3/ p4P0`UlЍ$X r08,00X0VP  OP 000 0 Q PPC1A@-0000000Ѝ1AC-P@d`Ѐp\MX  z$0H010 0 )0  1 P$ 0  TP0  1/o"/`V<T0\ЍG'p@-XMP`@X @L0 H001`?oT20S $0$0 00XЍp2W@- 0@8 0 0$0dM 0 03/$0P$ P 0 R0 0Q P0SQ0 0dЍ$0 X :0U210$0;P0P,000 03/ `P$0` 0Q p zP0SQ0 03/T .P 0 0 X 20P0 02FPP 08 00@-\M@PX 010 PH0,\Ѝ02O-$0@pM ,PP ЍPP 0  T1圐 Y!04`VW  6/PPo$0P ` 000 ``0*0:/PPG00`8P0 5/PPI7P 00wPP;0 `wX p/00000070308$0p 00PP$0 0 00w i 03/KPP $0 w <03/ 0403/U PTUq KxP|Pmj< !4 4tpp000`p,(p(Vr$0t1ST1 R0Y0 SA 04`V 6/P` 0T堠哘(l00$0 0 0 0*@0;/`P008`@0 6/`P4` 0@0v`P@0 wX p{00@000`40 08$0p 00`P$0 0 0@0v@ 0P000 $0`X pJ082000p 0`P00 3/`P0 0j  hX1 e 00`P VV0[ P1 0s 0`!$0 J G  00pP% 0 j PEP 08 0 ^P$0         Ho28#t0媢T1Z0 3/`@LJPHP $0Z Kv@ <03/ 403/V x~0 h0 n0 c0 0 00`Sؚّ[ [%{!  y Z  X  V   `P pCJd Po/A r2An>12AR2A2Am2A3A2A2A2A2A2A2A@3A2AO-PpM`0 0S$0 0 h@ 0 `@PplZ@ SЍ2 0 u@P00SD$00A 08 S00 [ @b’E0uY 28d1 000 0bu@PL00 0ou0 @P00 0_uZut `00 0Ru0 @P 00  0Du00 0R`>:pXRX   0@  0#01020D@H0W@P X  0` !0$01020d`H0B@P X &0160 H05@`R\Ѝ@A-@@ pP``R0 n@IR!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-0 O-P)@P)i_Q01jaV!j1SKQ}o p\`ڴV \QrzA{$p(P pPW Q$00Q[ Pɴ1  P C-MPphQ@|10x1o0t1 0h![?dk  0l 0h1d!<t!0 rfk|!0 z]b\!0 T iQ4j0ᰁ10ḁ1ā @-01$ F40 00\` V1 㘁0l!1D1/p1 44AB4A`kAG4A(4AMb/A/AA-PL@m`iPP0j` APs@- 1`QPh@h000#<0RHЍpi__PUP (2,"0(20 ,"0P0P0t0L`000 01jo1010s 10CS1jvd@b"p@-hP@io%PP P2 "!N0 0 WPpPP0P0 P1$"p@-h@]PioPP#@ @@(0 @0 @1o0Pp"A-@p`x$0@PA E vPiOU 101 PUPAW101A-@h`Ppx1 AA-p@P@D0D!iϠQ  h v 00$00OOЍA 0 $0+ P`) 0S0 0000tj  00 0qO1S$0`0D0$@ 0ጲЍAO5T4A"Av4Ab"p@-@0P$ io MO$1S1p@O 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxddd (0 R 0 0040/4dddO-P(t P`@`p!RWㅡ& W6 @ P`p1S0 0@0 A\(0S0S  @ T   0R 0 00pT 0 Tz  0S 0S0S 0Sp4A4d4A4A 5A@-0@S e0h S 01 00S=@X \\ 04dPA-; S@`p0 100PU0S0 8/00PQU0S0 8/P4A4dPp@- P`0@0 P`00 R @p 4@0@ 1Sp R  R ,       04A4ddd;5A@-@ 0R 040 @4d-^ 0/$0a(!"$a$"  b"!4b4#0/0@-0#? t@ ? 0#?00R0S0@#? y BP.?  0#? 00R0Sy0@#?h AP.? 0#?00R0Sf0@#W AP. 0#00R0SS@^G @1PU @?o2T0SD@^: 1PU @?o2T0S50@#?, @P.? 0#?00R0S#0#?\ x!?Q0/o"0#?0S R000b Vp@-P@Q P p@0S@G-P@`pWZP @p@- 0 P b$bz5A/@- @q < Q 0(A q  5A5A5A0@-4M@P;000(00 0 0    , 0 0fP 000 4Ѝ0"O-4M`@2`2020  00 P0 5/0P  P 5/PP luz 0< `9/PT0 ! W0}>0 4P 5/0 4P 5/ZP  Wl 40 3/U  Wc^ 0  !0 < p7/q 0E'?ESc'/C#b?0EL>xPlu81  P,!, S 0P00 P(01! 010 0005P 000 P (00 000>00"Py  0 00 0墿4Ѝ>^ldpb,b5A0A5A5A@6AMbE6AX@5Ab6A6A"@6A6A@6A8"/O-MA 9090:08 0800 aq᠂᠓[0000LS\ 0 1\Ѝ0S @0\0 0S 003@ @4 1 = 200/ld@-D 0S 40@/0S [ld7A@- D0Q d@/Q 0Bld37A0/ldA- @0PS ` p 403/dU00 A/ R 0Q000ldY7AN  0O   ! "`"Рop@-@PᣗPpH. `@@@D὎$0孑 p@0壝Z>b00! $0 /@bxd 0(0S 0@o/xd@0 !!/@-0 !@@-0 !@p@-Px@x(Pe $0dP$0 ,0KO R0(,03S00!pxd7A"@bp@-@Ss  PPPDUT ʀ0 ! 0$ 040p7Axd0$/xdG-`0娠娀s$0@T0  0 0($0C"0C!0CR0CSPCGg1,Pb10, EP2/@bxd @- 0 ! 0^ Q    D $ 10@N@@@xd@bG@-0CPJ@bp@-$0C0P !6.p@bG-@`pr  P00TS\Z0 !HP10,p1,a(0 ℑ31 0, 7Axd@b@-@r  Pl ,00DQSQ @+0@!,1!,0,q@xd#8A" $0 0!0 00 /@bxddd,0P 0 Q>0//(d@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S (dJ8AP0@-  d@/  R 0(dm8A@-P`3@`0000  p 07/PPXG0Lq 2/y/,- 0 4 8 < @ D H L Pq  P   O R0 P P@ Ѝ@S0,0 0@ Ѝ@8A8A(d"8A8A0@- !" 0 !0@- ! 0 !`QO-ROB@AP`>pUpW  J21@ 010`q  P@ `U0 0p00TX Ѝ@U 00  0 @ZT ≐<0 Գ Pڮ 2/pZ 8A@bp@-P @@@@q  P`@p0/(dA-P@81_Q`0`AOS _Q`AO_Q`A Lp _Q`A L_Q`AR 021 pp0 0a000S$ SiAr(d9AR9AA-0 @`}_T`DPCP0Uq 0Ps3P_T`D@c P(dG-1xPP@ d)U 0ESL q,0S 8$ 0 @0P,0Y`0,!0 B0  sU30% U U _YOO@A &Y0 ` y_YO_PQ _YN @(d9A9A9A :A<"t"G-1Pp@b0  R1 /   , _T`DF _T``Dbb`C`a`$B@  A `PV& P_T`D I(d@-@40_Q0`A@C(d (0_Q0`AF#(d (0_Q0`A I#(dA-PP0_P`@@`BB@C@Ap0Sd  Ar(d (0_Q0`AR#c(dG-1@0pԃXP_T``Dbb`O`a0 S5_T`@DBB @L@A *W("t"X"t"t"`"l" P 0  ,G  P (d@bB:Ap@-@@0SpP0 PpA-`PP8` `p00p 81@ 0P   8/P Ѝ0xt Z l0Q  6CQ@ LQ[Ὢ0( &Qbl:Ap@ @%`A@-P 0|!SF &BS &SG `ЍpH!S0Sn  P(A 0SnA1  P@`p2 0@0  倬0P` ` 6/P@0 \` 6/ ᄡ0` 3/0Sn\@\0 0SnD@D0 0@  p@`Abbbblbbbb/!/!`!//` `! /! e!e!e!'e!/e1/c 8!0/c#c4 4#1/!-e!5e!=e!Fe!Ne@-`Pf@ P0@00 p0 7/0P *P d`6/0d` 6/ Ѝ@@Иb:A:A@-o 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddA-Qp@ 0d`6/0 `P0d 8/0 48/V *V``U`3V  P~V010!SV0`4P 5/ P0d 8/ИbbA-0p@ 0dP5/`P Pd08/0 48/V *V``U`3V PV010!SVk0`4P 5/ P0d 8/AИbp@-D00@ !0 4P5/0 , !pИbp@-T0@P04P 5/0 00dp@/Иb@0A-\!\Q\a0@0m  PD p8+ $p" `0 00`x0 00`p0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/0`0ЍA dИbdP1b:AH"d"7@-0 "6 @FC$0S0 XPV0@T :PE@d0 0S B @DT Ѝ0ИbQY'A-pP@`0!0 48/0dp0 7/0 dp7/0 !!Иb@Bp@-8 0403/8 0d`6/pA-0` Pdp@403/ ;7/0 4P5/P0@ `dp403/ ;A/-8/18/-8/- 8/-$8/-(8/-,8/-08/A-@`k8!  P010 dp@`0 Q00 7/ 0B!dp B(%00C 00C< 7/0  0dp? 1 B85<0 7/ ;30*&40 dp37/1d A?/xx0A- PPp403/ 0 d8/ 403/ ;d8/8 403/ zk   P00 d8/JKKHLE0M?0@0 S S@@9@@D19TAT@x0x 0 /0dG-p0p 0`  d0 !,00CS p40 3/'k  P'44|0 d:/, 40R 0,dp7/40d`!.06/08 d`6/U40 3/ 0d`6/0  !!Ѝxo>O-04M 0 Ap0 QH#H#8#H#8#8#8#H#8#8#8#8#8#8#8##8###8#8#8#8###PPBEQQ30YS `p0 PPP  0  0,(0   0P@ 5/PP R80QP(0 00 0 0B ( 00C` 0 00S 0K0 0 0F; SV0 0J$003,000  0 C 0壐 000 00`4$0S0@0@00000@UPPB0EQ0RS P4Ѝ @03/d03/,0( P, L0 0R0@ 0R0?ZiPT (Q  <03/ R 40 3/Y0 0Wc,b,c0b:A:AZ>A-PM@0 00". `6/`P # 001! 0@0P $ 0 dp7/T1 R `   P ,@Ѝ@(0@8p<0$0:0 080 S@   1H0D 0S0009Qd  0000810E? 00000 8/0 0000 ;^,H;A@';A,b"K;A0d@ ~A 0S/@-@ 0S/@-@ @0S 0CS/@-@QM`pPK/eT0 ى00000 -@P@Qߍ,qP: h0 0 `S0 p1ʖS  1d $0X@8000010@ 0Q Sp@-@P  Pp/A-@p  `PP+: 0 (08<00^@00HD0ʑ^001H00|0 8,0 000A 84/ 0( 0000Ѝp@-0PS @  00C0 0S0 0PX:(Q $ <03/ R 403/p@Y-t;Ap@-@R 0 0R 0R pR 0Rp/00p   ,0 0pH00 4P5/ @o_W@@W@AW@EW@- /o"/DH \ D  @@ ^ 04/Ѝ,b-0 4 0/-0d /40P 0S/0S<0//<d0O-@<0PzP R \ R *R!SG  R < &    q D @ D<0  D!(LT PP@X`` ,\\LP\ Q  R QY<0ZSL Ѝ0::0C: 0S ,0S  P 1 !1R !0YH <<  Z T@ TYPLITP,Z`L `Y  \ `X` B`\  ::0:0 & RG-@`၁rp::S1YLR M"L"8 R 'g  P  d0%S  DPQ  O-@ PK pჟ0 . Q ` !PU p`f  P  '0`S V03/pW㋰   } Ѝ<0SQVX 020LMLr0 D0Q @P 0R \Q   RA @  3 r! B"4AQ4 A!, 8\, ,0@8 @8  V 02/0` ::0:0cP 1 R8 8  01Pd;AG-M`pw@p0000, 00 P0 5/PP dЍGꃟp H2@  p@Wf  P ("( 0 00 00$ (0,0 0S3 DUn"0" n2U]"L" ]2L2PUP*00 PPp008/P 1 000:88/P u)>0:! |^P!: z^P< : ? P \* 0\ Ѝʑ:” 0;A8A<d;A;A&0`@ P  B` 0ŒQΌ Q @60T00 P05/P  0 Ѝpx<$0 03/\4XP$003/Pp}*PUp3/$0 0 N'p@-0P`@  0 0T @ ` BT0 0p@/0@-@  T A-0@kDqDDa`PU P Py%0 ~x R00 C1ux$003/P00P$003/P0 00`(d0 U T0X 4P5/T0 dPX5/P`=Abj=A/O-@,M d1!Q d0S TX00 P0 5/pP \,ЍOd0T 0C?odP2X5/x0d0SS0pd0S 幬,ЍS CS 0C0(P` 0pPP3/0 0|0 0 0$ʭa h p@0 pI h00깇A`kAt=A=A=A #!#dLAb #p@- R 0@P5/00 *p %p@-@9dP8 5/0dP 5/p@ @-@@s@-@00 P0 5/PP `:00Ѝp00 (`06/00 0 00=AO-` R܂p p9 d:/ d0":/0 d:/`0 d:/0 d`":/ 403/ 0 d:/ 403/ 0 d:/ 403/d0 :/ԡ 403/@D @0 d:/ 403/ 0 d:/ 403/ 0 d:/ 403/d0 :/ 403/ 0 dP 5/ 40 3/0 =dP 5/ ЍZ 'Z "Ye9 dPT 5/ dP0D 5/0 dP( 5/= dP 5/'O-p S0 09 d`6/ d`06/@0 d`6/`0 d`6/ d`0"6/ 403/ 0 d`6/ 403/ 0 d`6/ 403/d`0 6/b 403/@Q  403/T@0 d`6/ 403/ 0 d`6/ 403/ 0 d`6/ d`0L!6/ 403/d`0 6/a 403/@  403/`@0 dP 5/= dP 5/ Ѝ`V W`V RYX9 dPT 5/ dP0@ 5/@0 dP, 5/= dP 5/'O-p a졟⁀9 dP5/ dP0!5/@0 dP5/`0 dP5/0 dPt!5/ 403/ 0 dP5/ 403/ 0 dP5/ 403/Q 403/@ 403/P d`@0 6/= d` 6/PU Y dP9P 5/ dP0@ 5/ dP@0$ 5/= dP 5/'O-0 0@d@t0"409 d8/d0$8/@0 d8/`0 d8/d0#8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/8 403/@  403/@0 d8/d0"8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/H 403/@a  403/d@0 d8/d!0 8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/X 403/@*  403/(@0d`!6/40 3/0d` 6/=d` 6/ ЍX ZX X [ 9d`T 6/d`0D 6/@0d`( 6/=d` 6/'p@-@9dP 5/0dPl 5/\0\ dP5/08 4P5/90d p@/G-P@ep|0 4`6/`PpW 0;@@ 0@<@0dp 7/@-0d@ 04/d0@-0d@ 04/d"p@-0P R@0H d`6/0d`( 06/ p@@pA-P@  `000dpH 07/ PP0 4p7/p@-@PT 0d`6/  00d` 06/ p@`^O-00pS (Y+0d`0h#6/40X#3/d`B?@#6/`4,0HSX$XJ 403/CBP SY`k ` Ѝ0d`"6/d`="6/ `㌢ 403/P `V i<d`H"6/404"3/`  0 40 3/C0@SC NY=d!8/00YV40!3/0d!8/|tX 40 3/0S3 #3/?d(!9/$Y 403/ჰ[+  d`9/X0d0 9/ 403/ B?d9/Rdp 8/@0dT 8/`400 3/0d` 0 6/ `'G-`40p@!3/o>Pd(!:/0 0 p0840 3/?dP 5/00p 40 3/pp40 3/ <dP 05/p 00=dPL 5/  8 8000( "(0o>=A=Ap@-@ 04P5/0 0p@-0 d@4/s@-`P1@`0000 ` 0 6/P Ѝp@$ -@0`<SH8008080(040,0Ѝp@5 0 00$0=A>A >ApB#A#>#4?#@-@вP 0SZ  P<000 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddA- 0 @ ?  0FJ3?=00 P@`HH@pi x0P4R0^P@JF@p0d 8/0 dP5/A-@`0p4P 5/0P4 8/`{?0@ 0%3?0 00 02d%VP0 P0`d/// QX0S/X0@0/-0d$ /F>A Q/0x>AD0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/  U 0PEpU ANb>A>A 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddp@-@P`T [Y  P0T@0p T /0S  `@pt x0d@ 4/0d@ 4/@&>Ap@-@`TP T &Y  Ph@@p@p@-@P0d` 6/0d` 6/( d`\06/T00T0app@-@Pt`\00\0dP( 5/p@N@-@$X H00H00X0@dpep@-@`UP\00\0d`( 6/p@/Q G-@P?10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlP^DpPpQ  $:0L0GP00 d:/ 0dp 7/1 dp7/P0<0'%H 00`@00  00004040CP  L0L0H00H00X0( $00040(0CX  P (@ P T0`ZT0XP0T0@`0dp 7/ d`x06/0d` 6/<``p`X0V0C?o20SX0S<0 0n`F>A ?A?Ab>?AO-0@4P, 5/0P( 4`6/P ooPX0S   P0_ X0@0S X0<0X0H0@(: X0L U  X`H0p8 ē,p0< 4:/04< ;/ 0 W0L00 4p7/pH0p  p<0 1 / W  P+H0 0S'0L0@ 0< 48/04< 9/04< :/2$p 4 << 0(p,pLpL0S@0SP0<0OW  P H0@(3 P a?P 9PX0Sk  `  X0L P0 X0<0X0H0@(1V\P \PJV ! P` XpP X` `0HP0H0@% V P0S+`P + Y'0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@?AC-4MP@P84 0P 0 P05/pP T p4Ѝ0"P ?0P P5/jV  P>N?l0l0h2h2lp0twV  P;<PP`d0hP`O(d 2P0MP 0 0@0!`0P00  0 0 P0`0 P0$P0( 0,`10P,0#Pt(? @(0d!`(0P(0(0  (0  (0 (0, `(0,P(00P(04 (0 ` b0@ 00000l0 0p0$0P00(0 V  PP0(00(00 ޢPX|P0P (P D?A@A>AK#Y?A,L N{?A@A?AC#DA?A(C#4A b?AP0\0/S(00, /A-@` F@PP 00S lp,@ T@  X0@0 @`VX00X0,@@4c@dp@-lP VP`У@l`Ph,UX0 U0 X00\0`0,p0X04cA-L@`ᲣlpPK,A@ \X3@,4cA-@L団PU `80lpPH0.,5i,4co>p@-@P`lP,&p@W,X0 @-\0@S ` 0\00s00`R`0(0C#p@   t X0/@dd0S/p@-`0d`@P̒l0 0!X0#PL D   !p@@c@d@bxddd\ P/0 !8 00 (  , !/@bxdddp@-P@dP\0 0T ?S5k@0u2 03/Ppp@b?A@d P P) @ R%Y# Y#LY#Y#TY#\Y#dY#lY#tY#|Y#Y#/P P p0`Rl/d/`/\/X/T/P/L/H//</8/4/AA?A;AA@A,@AO@An@A@A@A@A@A?A)AA@A-@-@4,3# Ѝ@ Ѝ/[AAѦAA-S@ 00MS 2 03/xcxsx2 0 3/P0S L 0B S񟗈P[#[#L\#\\#\#$\#l\#t\#Z#[#d\#\#30S' 0S P000  00 0203/0 00020S 0SP0002 03/203/ 0S P0000 000 0S2 0 3/ ~d0Sy v 00 0$0Sn2 03/2 0 "4 R10!5j[Qd`V 0 0d0S 00 00000Ѝ 00 d0 `S pdp9p0 0h ?0fj- 203/P M@diAA`AAo>AALbbAAA-@DpD`lP.*j*S 0 :jbAAA-p`zlP@*1W 1W 0W% @F*h1W$ 1C7CW2  03/@P1 ,@ 10S-@ ; !000@3 000\0S#@ `L0|0 cR(0L,p\00C\0p0$0S 0@000000 @4cA @A A(@AALb@dQ @-/AA0( o( /@dp@-@8M2!! Qi Qj QQ CQP,$  R C$ R0S,0 0,00$0$ Hv0(0r$0S2 03/203/2 0 3/P 20S 3/`P l1)d`0h`0  00l09P 20S 3/H8Ѝp@ ALb@dAAAAA^#AAp@-@P]P " " " #p@h@-.op@-@`FPLcD@00000 81A.Ppp@@@p@-Pᣣ@P9.pG-0M`p K?0S-0APT) 娠 0S 0s S$Q0 0$1 0(1@00 00$Ѝ奞$@T0Ѝ5@g#p@-P@01Sṯ8 p@Z R $ R $ p0BBA@-,0D ,@ 04/01/@-,D@0\ 0@/C-pᵯP0A嘐T <1S 0,03/000DXQ01 01FgA`kA)ABAp@- 0PQ@ `M ` 8U < 0 ܍p踇ABAG-p`@ V@0s5 S2 r/ PPE_oRP! Q P P Q ۨPP Q ҨPP Q ɨP Y U @`FPY P 9/P@-@Ү0@00/X0 @->(/BA@-<1 SA-(0 pS0@(0X``01V `PX P D ARJ:@ PE,,00@@D  BD H0H0L yM uN qO mL0P  Bg(00   _ [(000Q?0@  Q T RC G JX00X0Ѝ0S 0, P 5/PP H 0 D  P 05/PP 0  2/$+`CAGCAp@-(0 `SPX@ 01S 0S P X00X001S 0H  2/ 0,  2/p@X  D  BQ:@ Q0CAA-pX0@`P  h10 p 07/P  0L0Q0CL  QL P R*P0ЍaCAp@-X0@ P 00p@/CA@-pX0@P` \T0S L  0p p07/PT$T ЍCACACAp@-X0@P 8T0S( 0 $ 2/0T0pDAKDAO-p`@㤱M 0SP㸐 @0 S03C S#3P^ \  00 P5/PP$ 0S@XЍ 0 @ 2/$p 0  P 5/PP,0S0S 0 S @X 0  @ 2/, 0  2/$ptDAA-@`(Pp 0S `p0S 0 ` 2/,p 0 ` 2/$pG-`p(@ 0SPp㸀- !0PP$p 0S$4@WЍ  0   P 05/PP,p0S0S$4 0S ,0G'T 0,@  2/A-@P$(`4p 0SP,p0S 0  2/PPp@-@P`Up6/PP Q(Pp@r@-@@M@-@h0 01 0!0!!01(!10!0(1A-@PUP@`PPqO-0p"SMSS# Ѝ0C@ Su#t#t#t#t#y#z#t#t#t#t#v#tw#w#S0S00001I0S000S 0 0,P5/1 0 0,P5/P`1 0 00,9/P X1BP`00!01P0`!BP0UVڑ0S 0 0,P5/ 0P 0,`6/1TQ 0 0,P5/ 0P 0,`6/1TQa0S^ 1S+ 0s01& 0 0,P5/1J 0 0a,P5/1S= 0S:0S70S S2P0 0 0,P5/PPP 0pRP3U`W\pP 0 0,P5/\ 0 00,9/P0S 0 0,P5/` Q0`PP S:1S 1 0 0,8/11 V1U0C/᭥    0 00,9/! 01 0 0 000,9/!010 0 0,P5/aPV@? 0 Sc CC/`ť011B/X0`1 aP 0 0,P5/P0000@000 000000 0 00,8/00000P 0,   ,03/P:8   ,03/PX0C/aX [0S 0 00,8/0S0PPSPPP0SS 0S 0 00,8/0 0000@0 0000 0 00,8/00S 01>  000P00 Y  Y Y 0S[ S00 @SG 0$00000 0R 0S4 0S 0 00,8/0=@00@000 0<0J 0 00,9/ 0  ,:/ᴚP0`0S  Rl S0 @S| 0 00,8/00S0  10 01>  0P 00 R&0S  ,0   \}3/0PP1>  X㰀  X,0   3/P0S00  ,0   \3/0P 0,0 00Y8   ,03/   ,03/   ,03/    ,03/ P   ,03/P   ,03/   ,03/P0S   ,03/   ,03/   ,03/    ,03/ P   ,03/P   ,03/   ,03/P #P 0P 00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0 P<<00;00;001 0 00,`6/P 00 0 00,p7/ 0p 00,8/p 0  ,8/ 0 00,p7/P\ 3/   ,03/q3/   ,03/   ,03/  V00YX 3/   ,03/]3/   ,03/   ,03/  B\ 3/   ,03/F3/   ,03/   ,03/  +O-M$( `8@ 03/ P400\00@;P5/P 03/@$80 `0<0d00X000 @% 7R0P0($0P3/P6  043/@083/ߍ`d,03/P\0P0 P X \`,,0 d3/P0T CR#`#`#`#`#`#`#`#`#`####`##\04\0\08P 043/TR 0pS0 000 S; 7/80`0<0d00@S\000\00X000`\X ,0d3/PP'X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0OP/0C?o\ `X2 0d,03/\ X@` ,0d3/\ XP` ,0d3/\ XT` ,0d3/@<@0\0T 00\0P\ `X ,0d3/\ XP` ,0d3/\ XT` ,0d3/\ X` ,0d3/\ Xp` ,0d3/X\EXP U*t0 S3 1* W X 0l`X d,0R"3/P @PQ\ `X ,0d3/ 0 T pRhU p($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X`0  0d,03/\ X,` ,d9/,0\ 4 0 `0X ,d9/P@=@ 0 SSi<p1A!T <T ;!7/T\000\00X0000DA@-@M.  010K/0  $!(! 111 1014!, p1>  ލt#O-P尤Dq  Q)R, R f@䟤 ``t0SX咤(1$!Q0aVKO0S儤 OCŨ@V ;`7Vn d.0 S14#`#h#p#x#######Ē# @T`\0S.0 0S S 0SS0S hp\\\ R^Q D@0 00 0 0 0 0  0@ 0 0  0  0  0  Athq 0 S~Q 0 Av$ pQ AhQ cp,DADADA.AFgAA@.AFADADA.AEAEAEA B"EA.EAbGA@FgAA 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP (㕉)Q ˜`P P Q œP(㐅!0S~>p@-@ 0P` P@HTppA-`PX4S@ @Tt t@Pp@-0@@ T<PPP T-PP PTU0P4pxR%@-@TPTI0P4C-PQ4MT4@ 0p`  8/P T4  0   p  09/PPD @T4 0  2/4Ѝ0 , 9/P UT4 0  2/eGAGAA-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-Mp@\:p PT P <ЍO 0(0  RC> 0800P 5/P u @ 8$D0<4>`P2嬢42 4GV`G 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4r0Py cP0 YP0X4Ѝ@̗#GAGA|#0%ؙ#GA@%X%%%H%%H%p%%L% %%̣%%ܥ%0m%l%GAHA 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0܉>A-`pBT P*v@Pp@-a@0 oPSPp[PP 011D 0(1S5Q  %KAb@-@d01p@-`Pᤠ@P w P p@ 0t(0 tP p@y0H1x0p0p0@1l0D1X`:~P0P PP@0H102p@ꘟ#GA #l#A %%P%@ 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`|4S@ P&@Ptp@- 0 R\0S 0 00P00 Ѝ >p@-@Ο00S @pTPt 0  tI@P xQ to0x4@ 0DPx@xQ t\xDd%O-M`᚟@` tkP  f P ЍO 0(P000A>h 00S(0404pE>L00 9/PB4Y 1000  L0p0 7/pP@0pL4D0P4Y0SSx 0L0X0; 9/P@10<100:00 P0P   0 @00P00 l0؄0pP0<00 0C0 0 ?0W0 Ptd၌Ὢ0|4ЍL4X4$4\4@##GAWKArKA$## >#bKA#HAKA 0R R ?R//p@-鶞j1S@ P*f@P$Q `pO-@M`P *0 SP*0 SP*0 S ✗ ▗PU :Y@00 0 0Y6Ѝ0S0`pX d0`\h0Pl0UtT=S3t 8: #8;/T=X \Sx < 0`;/X=\p`T=S00| 0> 6/P p `$ (, d  0hl 0W*0p4W Q0CpT=X \S3t 8: `#8;/T=X \Sx < `0;/X=o\pT=``S| 0> 8/z0@-01 0P Ѝx>p@-@T=X PS0@  ``\6/0  VT-X=\R B 0`6/T-00X 8R B `P\#85/L 0 }VT=X \S`PA0 @ 5/p@0  mVkLAO-CMPpᦝU@a 0h#0P$  "PP $J0$=P1S 0 # PP  `ԲԢԂ0 .VT-X=\R(  09/ P\X T=' S  ` 09/T=X \S  `09/T=X \S  `(29/T=X \S(  `99/`VS  ``06/T=X \S  ``06/T=X \S  ``06/X 00`` \6/daT-X=\R` 0 08/&`VT=X \Sh 4 ``06/T=X \St : ``b06/T=X \Sx < ``06/X=\@`T=S0| > 006/0 SW0l l 0-POCߍ$Q |$]$C%?rLAkLA#E>G-`@ᲜPh@ X P G@! 0( 0X= \ R R! R pWT-0R @ 9/APqpP0,=T}U \0S`ea0P x GW oP 01@#GA#C@LA@/ 0P/Q/db@-@> R`0S0`Qd\0@-@*T0$0-p@-@PH2Sp$0SpH20$(\003/$@-@$003/$@冶A-`P@` pH0D0%00pGWX0$0` M``2Sᬛ`D0$03/H0S <A,>MAMA@?NANA#)NAdb##A-@P0S}$R 0H"$L>$Gd2Vk =_37V H2VP0 @/ ` V R01@0S V4 0 0000!00?$04100 `(0 `&$0S @P X 4Ѝd1V0 S01@PE  B$1 000 1<PP@@V@T $0S @ 0B~Sx01@@T `FP 00  pl07/@KNT_M@0%>@}f]cpdH4cUtUUĈWc##p@-@ `(Pp@pdH0 6P @-@,(0 x@0 @/]cpddb@-0 R@Q  @T@ D <04x@,P $0S@@db]cpdH4cp@-@X &P@@PA@ 000S g@ pddbpdp@-@TT0 6PP<0P@8H0^,e ppp?dpdp@-`@ RPP Q. 050S0(0000C0ppdbxbp@-@MP6d /0PP0!00cS0`0e@QN@P@, x000S RtLT BЍpdbdpdA-P`Q0@S"%0S Z0QOA! !s! !oP//C-p`P0 03/@P* 0|D0q q 0p@`l00t00㼑x0HHI0t ;P H/0@@0H @0H( (00ЍGϦPAPAQAQAp@-`Q@ Pp 㿦P $ ᵦ p贇APAp@-P` 㦦@ p㟦0I"RP Q 00#+-, ( ,# )EWcbMbQA #0A-0000p 0A4` P 0  @P 2 @P0 0X@Ѝ @@-@0P 40`CV^^p`W ^^P@U\p@-P@0D@Pp0S0 p0SSQ QS Up DQp@-@00$0PPuPP00$Opp@-@00$!0P 0P!00$;p@-0@0$0 !0@0$+p@-@00$0 rsP P0 0 00$p@-@00$0 0S00  0@$O-8PP TpP#@T` ዥ`P  0$0\>RP 0w0 0` Ѝ R 偽V @dRż^ NoRࠓ^ 0 R   R,   00@^(4@  ^ "$ l?QA7QAUQAuQAO-M0,MS=` 0@SP0P`x%,ЍO8:8rP3U8P0TP 0080P0T0 0 `PY Pp 0 pi`P ]PU  ӤUP 0ˤT0S0!4R  00CSP! wPaV`P᪤P0 P.P "[ᚤP TP0 `RZ 0L 0 ``  囼 `0S0!4R0`#30 0s`P0S`  0c8Pp 0 8`  0B8刢 E `8 tV 0 Hx8 B080f/8e8刢 _S,ЍQAQA@-`QPp@MЍ@ P 0S Ѝ@M0Sp@-`0P$@)0s S@@T00 @0$[pp@-P@0$00C00p@$LG-p$ `PP'0أ000@0PP4P8`pP M P  0 q0<@|0P0 0(PP!PPd00 PXf  0PP 0g|00p$00@0000CS0@030h 60,0X 0C0 P`00 @S R;\0 $Y7彻YRAb?4RAC-0M@LP`0}00 000b0`pD$V+ 1n LP03g$I> $ $ @04A04B04 04 0S004 04``V* J>0V"`cpQ  1Od0P †rJ~p JN2೔``0X*V\0S4Ѝ` `0NS  S Rą \ C!< R 01 $  AQ    0 A-@P 80SP0P`2PP 0TP 0`Q d 0`0tP xP pP A|88rPU8O- @`M3T `0S6P0$ 0 1P P0$-Ѝd01S 0 N0 rP ĸQ Ὸ 弸p`0SpPRARAPAA-pXPQ0 ^`  PQ  P AX   R_ PU0 X @ P R- 0 \ 0$ 0 4D\\\\\\ ? @-[dO-`P "M@p+TUd,)[@P`  0   00P 5/PP+YP  08!:/PP0 PP  PP PP0PPG <0 3/40 3/ ݟ,ڟ@Q\$)P&P#: P : \PQ(0(0(0$WP00C080@  D00 0PЍ@t80W@  000 0ܛbdO-鄑`0MPS@8p `,@Z@TN<@0 p6PP0 PЍ@T) 00@ 0PP 0 @ 0 @0P@PS 0  U@ 0dP0000S   0 0 R 00[S @ܛb8 $db@-@J 0t0  Q$$((0   @@x    0R  0dܛbb@-000^4 8@ ^240C” \  @-00  ЍP/p0p@-P@pP>@P UL0`P(PPp@-Ph@S1 01  hp@\D A-0SH@D`ɏ0P%@ p `30  4@pG-@` pD 0SPT%P zpp@G-@` Dp$0S0 00PT%P c@O-0@DPM Z `DP3S0 $0R 9 ЍOPI T! L! "  HP<\pW 0S000000C0(P 0 S00 03/3$ 00 0 $0R*2nQ 0px'0 03/0P>Z0 3Y 3!$'"ep@-`_OP `Up000/A-`00S A/@PpD4Pl0 0S P P0S 0 03/0S  ϖoG-Dp`P $@P(G520 0,P00~GdA-D`P@P(pA5 2l~AD0%/D0/D(/D(/D0\/D3//D0/D0M300Ѝ/G-D@` \x S UPE S_oRU(p (DPp 0Sf0S 03/0(0S 3/RX 3SP03/3SP0s^GzxSAbO-0D@P 0`S\ p+0/00ep"s^  sW  s Q ]^ 0  Z  AD0OP WnP00S 3/7HD3@033 @/O-@P$MNP `$Ѝ3@  00S5DP:`PDpß0ŏQ0 0F?oW20S$ 0 0000@00P D0` m`D~s3/`P 0 `V` D p@0S  (  Pt` 0V:` D p@0S  , PU`$0V:5@050 0S `D%?( 0 03/00y` p3cpDpܠ+c 0V:`d"0cS][00SC?oD 23O:!2`00$Ҷ7`c$SA$bSASAp@-D`fPp0BRS@pRP >P P2< ᯶Tpp@0,0Spp@/SAG-@MpD` P7PB3S?0EUS;U%  kP  ᴳU P&SU# 0P0200 xЍ 0PW0 S*4W0$03/ SA$SAA-PD@pm3S AP 0U(`0C 0  U U uU0S0A/g=P  GU`#TAp@-@D\"P <0Sp@8PU PpA-pP`q@P0 0A/A-pP`]@{P0 0A/A-P?͚0`D20@2bR[ O\     `:3/ Dp埚$Dp噚(`u0 /(33$$dC-DP@(` <H1X`01(p⸕01e01003& D`(021垟 2|1|!2x1202D0\d1`0 0 00 2S " <" ^0S@0380ScV0 0 P08/ A0 Px ЍCd8P4`zP Sx Ѝ$$h$L$"$`"$"$$,"e@$8TAA-vD@T_ 3S\ 0P033\b(pSW  5@ !CV %3S 80S<3S90003/%pD0\rD`P  0ཙpD`P $0ങ003 Z13S  ?ᚙ0D0ЍHV"e@-PU-`D@(`003pccpc Ѝ00S0  S/bO-`~\0SLP U\0 E2#<@T `0S0 Pd Qh 0 Bh `QhpWd6dp`pTTAp@-~P@O0/0pG-p~0\`V3 @ P0Z/ ;  &DP 0SPEH 0\ $P ( P (P (⹬ 0S P O-\0$MP 0.0SC 0`S > 0/@ /0&TF$00 P A ( #@ 0 0S1 0( ,0R P $y( *y -@P k-@$Ѝ\0 D2#<Q 0 b@ 0 0S@p\0D♃#8  8 $ !R!  0 DⓂ"<P \0S 03/0 09# Pw01 02p3 t    0 070S  x+0 DⓂ"07 R7( H  p   p@    0S  0 DⓂ"<0S    00  ~ Kf eP  Ҳ@) 0D⒃#0p1 pW20   ^ 0<   p ppWp0GS  xQ 0 P  @噲 0 DⓂ"7<60TATATATATA UARp@-@p@ RPp`( U:,PU 0 ,0$dx( x_p@ 0000PG-XMp`|@P!j`P00p|t刲 0S 0 CR L&LSD60@& <倲  pP 0S  )Fjv( 0w 0Si 00CSe_0000*00 0$ $p(p,pp p!p"0#pp 0&pS  W   !R00.0700w%02p10'030(040)050*060X02pSS $4Q0$W040 CWK$P (і P (̖P (ǖX pGH⿖0\0_0000)0p0 00 "0p p!p#p  @/o20"S R 01 00 "0#pX !! R0R!0GH↖t3\0@0 00CS R ( B␰ 0$ % 0C&0$C4'0( ) * + PH$ PA0S$P C$NP0 00St+(8(5 (0 $H(( $v0,0001 0(0$00@0 0P  900S  0 CRS <@P6 078S}?d030C^DS010CDW \0  P K 0 ǰW00S F0.0-00 APd寰XЍ@ѦAACUA`kA@LUAiUARBBUAUA*$UAUAUA VA&VA>VAVVA 0$]VAyVA@p@-@{P0 $ S00$p@x`V 0p@-P`z@pnPPP vP$P  0n0$0 ,3(pQ@-@ 咰Q 印VAVA 0S$0]S(0S/GS(0S0SS @-0  /O-MP`z@P0$彯X (7,0@0D048< p^ 0 H a 0  P 5R0CSp劯 0A0 00 00 S 0s! 0PЍOů P R0 R  x4R0S S0CS  \4  CS 8$S p  4   0t0 0S$0]S(0S00 3 3R x3R/0S,0V R(W R%X *R"Y R W $3R0S^0000 00000 0!0#02" 0000( 0 `D0dp(|`P`iw WW  L\  p$  "0  X ʨ $0 @ 00! 0P 0-  0 $``xt0(0t1t!,0080(0h$ P %X0 Г3(0S$`0q0`0u00AD0Wp`  0gP 0 `P y: 4GS W! pP! d售Ѝ@VAVA@j VAWAVAd>??LbmLBWA58$?,WA@-@ P  0kT T LЍp H`R @ 0R0C 0`\z0$ $$00 0V 0 0S Hu0 3/QWARRG-`@P P(pb0@00X\40X0\0, 0G/000/G-p@ MP( `A0P P`PyVP<X< w0St ,80S  PP 000f! >C0CT7 a?T0|02 a?C0CT0S& p0S041! @Ѝ2T 47CW0CTQ 1TQm Qm Q0 0 0 S1 tPXp0@@0p0S1 0 p0S  qd0 R @|00@T 0R0S7@ f@P-@xSxSQ Q Q0d 0 p 0W0 S HW@  oT@ 0$0 0$0 V Lpv@P |0 0 @l04/| )^ 000Px 3c|fh@iU@pUDUvt]cnUWc##p@- @fe ` ?o2R0S@ P(s@P|0(S  P@p 03cC-M pp:ex0P00 @0@T@0S7@  P0 s@Ѝ`@0S@X #@0S @ ]@P ,@ Ro0SQ S0#S@1@!  Zs@P~3cs@- d@P& Po0S ` Hqladp` Q(6(`,T000000x0Ѝp3c]cPp@- @d@P P900徣sp3cA-d Xd@PP p 0SPU XPЍ`P0x0`,L p2 P(Pێ(`p`9 PP  Hxpp`* Q(Ž(`0000x000 P3c]cS$@-@P`p, I$Hp000S ,pP  Ѝ@]cp@-Ps@ @Wv`s0 fCHp ?@-P`s`0@00H0@00<0@h +p 00 0  $t0 q|`٨"Tr Q@0 P" Ѝ@WAWA@$0 0!0 00 /@bxdddʀ0$R/ -0^ "G mP Q H0Q -1CQ0 /@-:10/ W@ W: Q/Q  :04Sh= Q /Q 0(h=0@-h=a/b$G- M`p P@n 01 0SđS: 018#(# 0 R R0S 0 @ T Ѝ@-s0 $2@-@sT0 04-A-@`rPz 1DT" l=S rt劥=! h0 $P ^_Gm@N8N0  h= WAd@-:! Q \ \ !R0100  Ѝ@-@ 0 NPЍO-MprPp0@000000 00h]04垧0 P2P  d]$`سծ;P|T]PFm%, 0 #P8`G0#` 0 X#P 0 8#P\ h=0h=h=0h= 0!  Ph= 0h=ڧh=;"Ql0l=02$@Z00 0M2`1081 aaAaMj.@2 b04"0 ("!M0"`0$14Ѝ8 h0"Q+ P(Ssl0 h=0h=p:txl0Q`4P\p! Q \Au LЍO0S IU 0C#pTtXx\0T,P;i@Q c@t0 S 0t0x0 X@d=S Q@p00t0 0x0`=t0d=l=Sd < \@@H?d`?X$bMbV$,NXA`XA7XA$XAXAWA@-<0CT 0 !0  !@b0@- ! 0 !s@-P@ UD`J 0(00WЍp(00CdG-p@0`SP 0S寣00h=0h=,2S -h=0h=,2S000#.p0C ,2 20j 00p0pXGdsXA0/C-h=@`M 8! P,1400#S0 Qh=  pW <h=PP  R 4 lU h=`   0l,Rߍ < h== p $`  UߍC@ꀥ?G-@P` kpTT-0GR9`-!d=S@h= F h=P<h= < h= h=0S0*1S001 k0 0@a0 GLP T< 030p 0S 030G>ꐥ? ?bQc$p@-@Z1Qp* 0 /d0 -  /00Q/-0 /@-o 0 @-@oT00-A-P@` pP V|`@P MV@P O@UA-Ppo,`@c00p P ]X_0S  ADPP \10PSS@U Sg@-MpPo`@,P圤7 I` 6O00000 0`P 000010040 0800S 3/00S 10S!$00CSlh$dh$dh$\h$dh$g$c4`8`(0S S0 ЍS PS0000010000C0S&611  B R&! |V 0S 3/PX?`p0S 0R S 0Q+Qlv000z0PЍ@e 0 SR 00SRR`QA400>^   0 B$ 0%00 0 00 `P 0FS0S80 080 0P  #Ѝ@wn@ 4 xЍ@00 0yP D00S 0mP  |0p  Q00`SG 0CS0 p0P  ~0P  v0P~  n0Pv   f0Pn   ^0Pf  VP^000 M0PU  L000 ?0PG  70P?p 00P8  (0P0   0P(   0P    0P  P000 0P  P xL'00S& 0CS|00S 0CS1 1 (0RR7P` |0RH| '0 PGL@A0?v1BXAYA!YAVAuYA>YAZYAYAYAYAP?ZA\?YA@@-@P p 0S$00CS (0SSPS@-M$@P  (.@ 0zPЍ@-`@V Pp1T0P 00$00%`b P   Ѝ@ Ѝ7@-0PS @ P P2 " 0  P   Ѝ0@ Ѝ0!@-@P (Ƞ0,Ƞ  ePЍG- 0,P(S8p@-0@0Ph10SZU - U p00 00P00p000p@- MPd0`@00@00 00`Ptc,00$ 0@`W Ѝph>PB !@-@΂00p@- MPp0`<0h0@@00`08 000 PGc000( 0@`V Ѝp܀$?;AT!P/p@-Ph@71 01  hp@@p@-P@!T0SpPT0`pp@s@-@P`TЍp@00S000 DЍpp@-0@( AR P0(00(0C40(pp00@-M0@P0P Ѝ0?      0 0 P 00P@-p0@ R 0 0>0LP Ѝ ,0RP 0S ȩ?!@-P`@P?000 00   @ @ ` @0@ZP Ѝp@-P`@0P@       0 ` 00<ЍpA-p@Pi` %(@ c@P 00(opW<p&A-@p`BPE0P @ &   $D   @ @ 00 % ($@P (4pW<Ѝs@-P @` tD0  R= 080#80C?o2S  [D03 Q J@0 D0  R= 080#80S0S @P @0  0F0 0gЍp@ p@-@ _Pp PUPft@0~$  & ~@0  { p@w\A'G-`ဂMpLf@`hTP <00H000(00 ,0L0d0TH ` @ $ P0zP  ᚛Ѝ  PP0 0>0]Hq0@00S 00S 10S 20S4w0P   0 SR0 R2R1PN`P㬐 d #`#Ze ^!58X@9`0 $P0@0@! X$0 PP3,0P FP 0 S,0 00,0 00SP 3 .ȱ 0X00S 10S4P gߍO ᰓ R00S 10S P,   PR0 RR1  0$P *080巐 9_$d=0 l?gߍ P 8P@A?x]A]A]A]A]A]AVA^A@-@0P00`( AR@p@0=@0 ( (0{_ Ѝ@-1@00  0b0P  P$0SЍ?@-Pp@@0` T@D T h0 0 0 h Ѝ@ 0 00 Ѝ @-8@0,00Q #^  P/p@-0P( 0CR@00(0 0(0 C40pp@-000 P  Ѝ?@-@ P@00 0  0      eP Sc }Ѝ\A@-p@P|T` 0$ R00@DR0S h}0 0 0 h Ѝ@膄00 Ѝ@- 0@00 000 Ѝ@-P`T@P?000 00   @ @ ` @0@ P Ѝp@-P`cP@4Ϙp Ҙ [P l Ѝ@y\100(00,00 0$0< P`@00 PP   Ѝ@`hp0S?00 0 00  8 00000P b_0 | Ѝ@E0P \  0 SR0 R2R1P@A\A$?\A@^A,^As@-`@P P @000  0` P   oЍp@-@ `@p@-Pg`@ "P00P `FaVmP  ` $ # " pO-`dPX@KHpP0 HL2H0L20  S O SHX  cPM!H0[H L2H0L2= QH0H|@p@-P`ho@P 0 0 0 i 0$ k0 0$ 0$ m0 0$ 0$ 0 0$hp@P/s@-P`a@\P W00X00088C|0\0Ѝp@>s@-(0P@ ?@@R@3: 0`0000( 0V  D\Ѝp@-0#00 P  Ѝh?@-Q@0#400  ,Ġ 00\ Ѝ@- "$@0  0    L Ѝ@-@Pz@0`0 \0 0 05 @ ЍpC-`$MP?a@[ ` x0(00p,002 00 @`P `@ 001 00 ,`P `@   > P v`X7   zP0P r  0 SR0 R2R1`~)00H000 `PPK 8[W0 0X0 0z0\ T$ЍCN@A?\Ad^A\AD]A^A^A!_A"?^A?^A\A,^A:_AO-`MNpT@>5P0057PP HL2H0L2%  % ЍO505HXWP    ((R  aP\  l[Z  Z PL2H0L25 0500\008 #8W%@-@M`pT DP00000R !X0<BP h0 0 0 hЍ@000ЍP/@-000 P  Ѝ?p@-P0( R@0(;Pp0< `Z<pp@-@h奀0 0 0 h@诀s@-@P`TЍp@ D0 4  0007ЍpC-(p`@{PP V jZV@000000  @0PPpP&FoPQ@  KZ Ѝ@- @0@PЍ@-0@ 0 0 @ @PЍp@-PQ`00R@R@BT"ꨨ$x$x$$8$x l0R ^0T T厑P00p QF7.?e_AB@-B4 0B800 B, 0 0jЍ@- B$  0^Ѝ@-0 0 0TЍp@-@Pp\{P _<`Ppn 㻓PUp@趓.'G-`r M^P@奓@V C \000(00 ,0<` P@ $ 00P a lޓ Ѝ APP UD 0 0004G00@0pS2P0S 00S 10S 20Sᴓ0P    R 0S0 ĵ1 ĥPR 0S2 ĵb0.080 P00$D?@A\A_AD]A_AD^AA-Pn@pCP00P `0VTL '   &/.p@-PQ@T T@DTꌭ$|$|$$4$` T0T ]0< <OPpQF7?e_ABG-p0@00PKnPH8PL2 0HL2oP ЍGbV0L2V H\ XP  &_P L2HP0L2E? 1@- Y `!  00Ѝ&*P/@-0$00 P  Ѝ䰿?C-@@@p`(P 0@ 0S8#800@0I5Q0``0 00BUPT  {X0( 0)V  nX Ѝ@-P@@-( PO:_0_b@-p@P`P @00@`PFdETDF  0`P@ Ѝs@-P`@P3@ D0FT@@ 0 P# Ѝp@YT  "@@ @ AOCO R= 080#8S S S @LЍp_AA-p`@4X@@P0 P@0 @00`0  @~VЍ! C-pPM`@o4XPP0 Pc0 0 0\0 hPUX TPЍDo00@  RP00 _A s@-40a S00@/0PS  `0P   PP40S 00  0P 0S   0P0S Ѝp@b"@-@h|0 0 0 h@|O-M@ pP` @` ( RЍO 0@ BD0P40#0 @R03`1:0D00`B @0cVPЍj& R000 40# 0\ @@R::P  00 0 Q0  Q0`B @D@0C-`Mth0@00p0P   TcPP HЍ0H00BPL2 0L2H000 0 EbVp0L2pV HU000000 . \P L2H0L2000 = 0QW`20A00Pp _AO-`K,MpZP  坐 ᠐ 000 (00 ` P,0 $ P p>,Ѝ0 0$0D0  @0 P(4@0< 0 0S9;@00C2@0SIIK000 PbL0?SK0?S4040@0@ l0 0 T00P010 ,봱 9[<  Y 񟗝ꐻ$$($4$4$$4$4$4$$4$4$$$$0P    0B?o 2 00S0@^00S 10S1R00S2R:$ 0;0S'  10,0S  00S@  10 d0S'<<0 (0+*@ [f0 0*@ 0 0*@ 0  H0  0 D  0 8000 P@ <R00ĕ 60Sꘕ 00S | T<00Su m 0z0S@f ^<0 R0 0 1b0SN F1 |00R0S> 61 <0B0S@. &1 0020S  YJ40 0 4~40 14 0s0 4n/B 0 @( 40S+0   0 < H0  0 (0  000 h  H0 0020S y 0  010S 0 0P 01|:04 0 4P  01!Z H"$ H;0 0p@0 0 040J0@0 [0 2@0 Q0  @0 <00.sH  tIP h᧍g?@A\A\A _A  ,^AbVUUU"`*`A``A U0K`A@-Pp%@'P"@`800`Y0 H0 `I0 `J0 E`@0 !nt40 0 0 < <  K"40 0 0 < < @0 00 !;@00 ?  f??P P Ѝ0 4J T@0*@ 1L  >;5@0:@005@0:a.*aUP/@-000 P  Ѝ?p@-MP`@P?00^00&400  @ @@@@@`0@5P  PG0 Ѝp?f`AG-P` V@P 0   /pWA-pP+0(`0CV,@,@010VRu @u3@@t30l!l嵉C04@00T@3 S0!uH00 0 "448#8 S0 S  S,0 <% 0R0000'$ '(  p '|$($L p@0 0Ѝ 0<'R 0 0?y`A݆@-@hw0 0 0 h@wG-P`@pPxx T0l!l<ЍG0 $0(0?<,!0@ J * J("( R ("(R  0 P"# P% PRA!@ S@  : 0 \0 0S8#8@TPЍR BR@??`A`A`A@-@HP @*p@-M@`P: P $4 0$80@00_00%400 @   $L @P0P @0  媈Ѝp*?f`AG-p@P蠟萟pGE$      0  `P   0 P H Lm`Ѝ0HPU( 8?`A`A@-@@  `p0PP 0S SL0  ЍO-@P@Pp P&Zp1 @2`P <`@0  CV Ѝ J @!9; 0@1`P $DYI?`A`A@-@@@ @Ѝ 0P@@DOoBO-Pᬨ!0H PH$ $ p` ,0  (0!0$0P pW?`A`AP/@-0$00 ?P  Ѝ?p@-Ph@q1 01  hp@qs@-`P@0   Č \@D\0 Ѝp@ L(00"(wЍpp@-0@( ARP0( ;R< bK< B4 0ppp@-P@Pp@0pD0  R= 080#8Spp@wA-P`p@P ?0  0@@@@p@;PP  fKЍG-P r MBP`@^  000(00 ,0<P `@ $ 00wP  tᗅ Ѝ `P L  000$G00i0@0剻0p3200S 00S 10S 20Slv0P    R 0S0 ĵ1 ĥ`R 0S2 ĵ0208 0_ P<@000$ ?@A\A_AD]A_AD^A07@-@P0P Ѝ00 ;Ps@-`@P P @000  0` P   uЍpp@-@PPp   _Pp ㌄PUp@臄'@-@P`pP 0P0 ЍU  @    0  00@-@pP`YP @000  0p` Ѝs@-`@7 0P J0 Z jS0  b P% G V? N7 F/ ?U PЍp! PP @-@Pp`T@  @ 0 ` &d`y      ЍA-@PPO@0    ЍAP H/L2H0L2j 0 003HbV+ p )PP L2H0L2I  Ѝ= > SWC`pL2H0L2% 0 G-p@ `APCQR U010! A-@` 0$ pD\: QU0 A\ P QUG- @$`(p,00 N\: QY PPU0 G V P QU/C-@P@M$0,=c 0`ޓЍ:cP p@- &P <@4= P l1  0p@p:c@-@xP$hMp\`=P l1 0040 000p`00,Ѝ:cG-`&P0pt=|0@U  Z 40 00 pÔЍ0 00:/p :cvd@-@($0$!60G=@=:c@-@`pP<M$,(3=(0 00ጒЍ:c@-@dP$TM`Hp=P l1 (0 00'Ѝ:c0@-P$0M 0 0 Ѝ0$$@-(0 0600Ѝ$$@-@L |1R0@-80(@!60$$<$h@:cp@-`@PL^ 0 p@/p@-L@s@-P`LAT 0( `4/@P OЍpvdbA@-p@-L@]4l10 F P"x1(0X1!,0T100P140JT 3CH0H HeP8Ӏ0h(ЍA8(ЍjbAt?rbAX$$0$@p$p@-P@mQ%pp@-lA@ P0  R@Pp$l1/G-}@`PQL1S  yP }VCNMeM`JP!QY0  =`0 =VPPQQF 9yGbbA??p@-@]L1!0CSL1Qzp@}p@0S$00M0S 0S 0 d=;d=//0S0 d=;Ód=//Q9 )R4 -09/00@-DM000,00(0\0 0T0@00P0<$  0A<0m P }DЍ0bA@?bAA-@PT=X `S80  `p\#87/T=X \S8`p8  #87/pT-X=\R8  08/  pW0 t9<l=D=S^  J0 ,|9l=hml]衆cA,cAG-@`pPT-X=\R` 0 09/D=S+1XT-X=\R0P  5/x0PX0 `|<T=X \Sh 4 `08/ 0 i蠆LcAscA000 ͓0\Smnp@-Ph@j1 01  hp@jG-@}`Je1匀01!3R R11P011S xPP 10CS1xP@bp@-@mP8 10CS11xp@lO-`p@0pPh=Sl=SX=\pT=Sl 06 ;/l=0l=d=   P Ѝ T=X \Sl 6 ` 0;/T=X \Sl 6 `0;/l-9T-l=X=Rl 6 0\;/ P D~T-X=\Rl 6 0;/ 0P4xVcA@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=Pl] ЍP =  -0=X T=\`Sh 04 / A-@P`}X= 0\8/  D=S}pWI~<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/cAp@-]p@1-P X~= S-<<%{=0= 0>03p cA&?cA 0!< 04 0 (   !/@bxdddO-p`@P㔰Ȑ0S # 06  z0P U SC0000@@ T ЍdA\ P/0 !8 00 (  , !/@bxdddp@-@P T⻨9S 9S 404 0@a 0 (#p@}$bgfff%D=S/p@-@=P0C==0CS=>3;3p@c=A-=PS`p @PVD=S@ 0| =@S蠆A-@p !P`P  0P Q- 0T  \}Ѝ0A S 0 } 0 e9dA_dA@-@00PPЍ7@-P@@=S 0 5 00009Sd=000 PH=S Q  Kl09S`%h%h%\%h%h%p%h%x%Q  Q  Ѝ0  DG-0Q@p`0MQ w0ЍQ o 4=3/|7S ("h70?0?h70?|7S 0 0@a 0 ("|7S H/ox" "0`" 0 S 00 B0{kq BBdAbgfff%Ap@-PAM@`X# P00C0S0Aލp S;03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?601|2QY 0Q ᔎX2QG 0Q *0CQ@=S d= .6M042QF 0CQ0Q 5>8#8ST` A0SS`   /  ("(  v@=S d= 0 GP6M0100@=S d= N@=S d=N0@=S d= N09S >S$\:'0 SUL S*0C#100L 00+AD0QN0 mN0N0%*FA-όpP 0`@PU ,Ѝ0 PP!@-0  ЍA-`@0Pp8=3/h7U) 5h72A9#9 @s@-H-0PR0CS@t 0@ӕn R 3 0HHw <@Ѝp@S @0.@ӕЍp?_?dAO-@lM@=S D=Sd?`< ,0:@=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 $06 p 0 P 5 0 03/039Sb.030@]  nP303TvW ?9SyP嶽U rPU 0S000000C0夽 Z0(P 0 S30 03/\pP2 0 Ѳ>t PP4\2(傿9S0 d=00 0H\ʔ# 0 G  0  ᷸D9Sㆍ P0S ` P 0!:> *00! D20a08/>0 (00D100 00$ 0C!C195 S' 10170< :0F(0 501ଽ,0 P( 0h!dy3*d=    qP0 0HYX0S S0! 0 0  b=0  0  0OPjD10=   =0C== S-"0>0>0p"eo?dAA-0=@S 3/`pD]U'x PP `V|yT=X \Sd 2 0``6/T=X \Sh 4 ``(06/ P NYAA-S@\`M 3` <3 >`0 `ЍP  bV p E0E?o2P0S P7   >WP `pPP(3<30C-M M@p|$PPo``$A0Vl  V7* V  V @-R v$VE ? V Vv  V@=S0 S0N0B Sh*$AS0N09 S06M03 AS0N0-l#VP)  V * BV H RV=d= $#VY  BVd= A 7>0 0 ۍ Ѝ Q  P RP@-R 6  -> P P@2Vd= d= S0N0 S0N0 VAS06M00 PqP0T 0C. PM 0SP@=S 9S H=S S S@!}0>039 0000 P0 00@=S2P 9S#P{ 0XP Pt P9S9  09j }PP c:@=S_ > :S0?Tӥr*F%- S/@-@pP`,M" = @e="0 I,ЍC-3@@DM > H=S  CRP-)9 R L)"" JPP> CPP@ <[0 l U C(=@PV0@0 \P3@ > Ud=;d=DЍSP- 1R >  =H=  S9S PPn PP`0 S 30| Q ;S d`P{0 PP` V@p * !(#?$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \Sd 02 `:/> ?P=0 .:^^XW3XR=3 ,=3/@]GO-@`@}W,=3/PP0@= @soH-娂R00S989d=0d=9SH!%4!%h!%$%h!%h!%$%h!%$%PP  ?;< ?5989H-R9 ;Sږ_%#>  ;c("( ;p0 0 ;0 @9  )%$ מ  d=   d=  d=6   d=  :S0?ӥ=t ?9S H=S)> L <H=S $> CN0\V ; 9S 3   9 : 000======H=SX S`3`3ڎۮ= ⨽  P& ,fu P bu  H=S ?V  %00C0S00\0ӕ ꠲T-X \R` 0 003/2t[d0u>0.>0R 3;@030)9R032凜T=X \Sd 2 ``06/W9SHQ P Ѝ eA  -%3?2D 1dAeA8 ;eA?Ip@-P`e4P@@MT @:p0p@-@2@=Sp>PS 0CS>02lqp@>S 0CS>H=S >S02p@bMeAC-P`Mp>P@ @P EЍ1W0CWE1Wg 1W 9 -09 ⋊94P@4 =$@=S( Od1W8 1W  . @P#@= S8 9S    S@1 4P@3@ @h0 @0 0i@P 4P@3@ QH=S@2iii9iO-@=@SdM '>P 3@  0`0 T=X Sh 4 `<\dЍO/T-X=\R` 0 0P5/   T-X=\R@  0P5/<00p  0P 0`+`ys$ 0 T-X=PRD " 0p\7/=-0C==0=1  a 0& T-X RH $ 00\3/00P (0P㖏, 0p*h;s=0.U3 ;37 0& {T-X RH $ 00\3/<0 0P 0} P▯> 0)s= 0.+3 ;3 0 T-X=\R  0P5/p 0pU1<)S { S  BS T=X \S=h 84 `P#85/= d3  d=0S P0=00S0 ( {0=T=X Sd 02 `2 9S588Y9S-2"8'0PP# Y!0 .80< 0(320@@00` P! (dw:"!(' (& (ʔ0!.0" ( (.70 p07/0)0RSК >P 3 #*8S00C82 Ἑ?0 0 0{X44EoQ +_ 8P 0/S)P U0%ZE'K+~Qp  Ʊ 0H(མ=[)0D%dq= -JZ%4q=0= 0E%>=~)0 S$RcP qX n n n Tt$ n0S xntnU)pXG%^P K+Q 0 /0H(མ=[)0#q}= -JZx#|q=0= ᢘ0G'>=^e S0 0 02_0CSy4%t5%4% 5%5%t5%d=0d=9S9Sj p43/Q`d=0d=\H=S >Sl"PP 0>M9SJd=0~9pS 4QpPEUP#D랄 U >^pP>P\ 0$ 0 0$ p\" 0i2p 02"0000H-Q0R RK RE2H  0M> i:Ppp:w>  s6L>ZP 1>#G'U  001  ?& 622?2 ?"LP0C.>2>2?5?3 S 0>.6tpnD?aeA??̨"e?xeAeAeAeAdbdeAeAeAfA%fAKfA@YfAO- @$MP(  m,] ♳:FiT=`X Sd 2 `P0\5/T=X \Sh 4 `P85/0D=)P0D=T_}0 DNP 0<PXA  26᪵Xm0p 00 pp:ImH}0wQ R)>m0SH=40S"5m0H=0 000l0 0d1!H2# 0L=4m( 0(=y p m0H=0dp0 0 1!2# 0H-P=R0&SS+ 000  P0@S0.S0-S0 S0H=00 C000C 2# 0 B2# 0 B2# 0 B0P=:H=S% S% lH=̥̕S L}dBx>:/9"b0AglPd14-:9ȏ"a@h 0Dl9 c5 )+5),|05p@05\r0404043099!= 0 SP o:0㠠 0I10S S2 Ԋ\베YH0X 2PJ0  SBQQr  `RQ"< 1?0:H=מS0 d=  0 P0 d00d= d-H-R' R RB d-P#Qb?d= x#Qژ0d=h3)Q8<9 9<9< (S:S$n/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0h 0 uPg 0SdڴyZ 4> 2 t=2(x=6=⾠ᰠX2]ۤᒣ44=4!8=141:1:141=1=1=1 =_@p1X 0>9/  3>p`1a  83>p0T8H2$43/02002嶨o`ǰp5: w0@00 Q00G%E%W%LF%F%H%Y%8R%8TA@-@4S@/G-3PA@,p0 <300U XHGbV  W7P 3<300UHGr = >Z2> `Hd3<3O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03\"A09/p(p0 7/p/0 0\00 p:/W .pß0 \p)P  0$@ 04/p@ 0  寪p@ UF ۡ1UV 1U0CU 1 P 1?A3c0媡8c\t]t@{t d1@Xt@1(@jt@mt1(Mb31S/ !*! 0 ! !啟 ᓟ0$@=L0K<1h t0L ,0L0H00, ), , (, ,06,00`1Y1810<1t1D1ᾝ ) 111@1 01 10 1 W - 0 ◟pP0  03/pP3 0@00S-*aRs Sh00SZ=9 R =?A3c2#d S 0"#!0 "#1R 0 34]I8cjAMbd d+hbb@p@-0 `"6 0?%H1Sp@&P 31S ^ᲞV 1  10 p 10 10%10 1 10 1:8cO-H!R %P %!`R %! A(0q 01pBR0  R<" 0" P@PV0@S @DWc ANZ!p PGQUV: !K !  !-! -!8!R:-! -!90@PES AU    R<1! 0 N03/p !  !  !0@PS @DP BR-!Pt5/ ! !  !:$!R ~$'Q(A(-5!@ 0 2/4!  #! #! , 2/"!R "! $  h0A(0,0 ЍO/ Ѝhbbdr%O-H1S` Ѝ@$P  tP⩝03/81` SP0f03/,!03/03/`81 S 0S @0{ 3/1q0+ ``n 03/  &1S 0!&11!aV5 0V`!ؠ0!:/10C110103/`103/ 4 R $ Q P$x|  PQ0x0 x8!R0 !Hd `V03/03/`0S`VmY FO3/0>  3/,!0 3//!03/0!03/,!03/ 03/Xs03/ pW03/0p3/ 0Y0 3/0@,! 3//!03/0!03/,!03/, 2/d20S  $0 R Q x0| 00++P04S x00pHS q0x003/ Xq 10%1 10S 10 1X 10 181S3 0CS-100-1-!03/03/'at!`&`'  H ~)!" (!`(a)! 00110$1-1-1 -10-1-!03/!1S0!10"1 Z%1$"!00 `Z'dc djA!kA@-@K<4@8A-p@`0S @S0C0\0@3/\03/\0P$3/t00S "SRP x0|00 ! P4Sx00x0hb dc dA-P0@`0 p0 7/pP p8U `0H3/ Yp` U+8 `#88/ }`0 83/ `0<3/U `0(H  (3/U`0) U@   `0 3/Ѝ0ES `083/ `003/`08 3/`0 3/F$`0 3/C <3/ `043// `0,3/ `0<3/ V  `0H3/C-`ph@(h 0 iPP 404 x {1(1lpph`t Ѝ dcxb^kAC-@0`pMtP0`uW X" Q M4p W ܚ081@0f-10-!3/t奼P0 | Q S'  S  h D@60S t0h$0P T81 0CSt,%W0S0@00000810C S񟗽ܜ%L%%,%%H%d%%L%L%Ğ%000e00 W0M  \W0  0H0W858eAl105Pp1(5t1 ` 0 1ᰜ *10*1@ $!d d `!0p$  $00gWx @1S0H1[0< 0Q0 jЍ000d00@000d00000c00000 0003/c000 0003/ct Pt0 4`x6/  `R006/,cZ0 006/cR0 003/dQV03/PbL03/PbD00081 SB b81 S803/0` 3/ 03/03/ 03/,,0 3/ 03/03/ 03/ D B @000a;0 03/03/ 0`3/ 03/03/P,,0 3/03/0P00 0000 03/0S` S` 03/ 0`@R`OV@ElAPlA% dc^lA'kAlAlA$q%hbl%%p?~A%kAkAkAkAlAlA(lAlAkAkAakAkAjkAkAkAѦA0@-@PtM0 0 00tЍ0p@-HP0S p`@ǺP 0ST00p d@-D 0 0 t3/p@-8 @tP 03/03/pp@-) @^͘ p@-A-4@@``03P`=#=\p"07/2",p7/$00 #002#,p7/ @&& 0\"A/p@-4@@PP03"P=#=\`06/"\`06/2#,`6/l"?0 \` Q- ( "(R0#6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@,ZU0\P 5/2 ,P5/2P,` 6/ `R 0@S! R P0 \`&N6/0 `xp0 `ӤVAHQ$P@ 4Q0P,Q#PlAlAlATD%8D%?lAlA# mAO- P\h p(` ,@,4/ R@ Wd?T0 0 ,P5/0D(0@0O-P\h@RpC$P 00d10`0YPP Ѝ[ t0S 3/0 \$8/ T ,0,3/ t0S 3/0 \`$6/ S ,0,3/[` d0L +[ 0002c00000 mAb\0O-Q x5pph` M@c |03/}S0 ,9/p +40\89/ k0 00 l0 X0 $0\p 7/0 ,P,5/t0S 3/0 \$9/ nS0 ,,9/t0S 3/ \0$0% !@-@0Q !@\0@00A-`P@0S P 0q@P ,P!Pp@-P@R"p@p@-0`@hPPp 0 \00 ,@,4/p#)P 0 0 0 0h0 03/P 00 0pp@-@P)p@0,#O-Pp@)04)Y 0 S0 0 ЍO0 `P` ЍA!@P`  0 P  0]@ T@nAO-@MphP)lv!`P ߍO)tP" \0W%p,, P@<0 R80S@p<0$Rtc)Nس80SOʅߍ 80S<0Qt0S 3/0 \p$7/ M ,0,3/p<00St0S 3/0 \$8/ M ,0,3/<0 R@ 8 R4S@0 %00S)<00  (<0S( 0 %P (0 "%( < %P (<00 Rp    (`nt0S 3/_02 \$0:/ vMX0\ :/0 \:/ ,03/XP<0p00 ,03/P@ 000p<0p \0(0'% @-d0   # ##   #   00800<000h0 ?\O-@  hPt pR0048<` 02/0 20_00$ \0:/ 0\0 :/ 0\ :/0\ 9/0\ 8/ '4\ 8/ \0( ЍO/O-M4h`040\0t0@DpSP P 3/ 2 \0$9/p *4**0  03 ` 00:/ `0:/ <0 `8/ < `0 8/* <`  08/ \0(ЍO/0 \0#4:/0 \#4:/ \0 :/ \09/'4 \ 09/0 \p007/0 \p07/ \p 07/ \p07/ \p 07/\0O-  0h`t0S@p$M 3/> 2 \$C\#<;/. 0040p0 P2 3 p +4 0\89/3,   $p -0P00P+ 00 0400Ba 03<3$Ѝs 4 @ppP ^8P P#8 JMbb%A-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`& 00 0@%PP 0S  0  0` "08 "U P 0,  p@nA\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \00/@-W2 ,@4/p@-PL@2 ,`6/”0P\0p@ /@-P`p@4@Đ$0\ p Ѝ?@-P`p@!@Đ$0\ pH Ѝ?p@-@P0 \`6/'J 0 \`6/JU0\ p@/PG-p@c尐PV㬀ʀ 0! # 0    !& 0!!c0    !0G@bxdddb7@-@ &^0202020 DR2|0@4S000 0p2S "  " Ѝ0@)p%P%%%8D%TD%@-@j &@@-&yPp@-@P&⣋2020p@-@4@SS&d 0@?b@-@C&@袋/@-00 僌 Ѝ?@-@L8Đ<0\ @/@-A84< ,@4/@-00  Ѝ?G-p@c尐PV㬀ʀ 0! # 0    !&0 0!!c0    !0G@bxdddb7@-@&^  0202x02p0p DR2h0B000 0崉2S " M" Ѝ0@mt%P%%%8D%TD%@-@ &@Y@-&⽊Pp@-@P&2020p@-@&⬊ 0@b@-@&@/p@-@DP0`,0Sp$A//p@-@Q P` 00T0 0  @D RTʁ@p @D0Q/ P /P  /G-.001 04@`50 pDP MI s}P/ .04#$4\#8#8Sh ) SS 0CSP%%@%%D%%P%%X%S "S CS" BS  Si @% ST00Ņ@"S ʜ"S ST@ S h"S(T(@#X OT90I2,pS$0 $09/I2PS$啋@0,@BU0P&$0~ ЍT 1YQ  YI 0CY!K  Y  Y0ST@#t  Y!  Y-  Y0S 0T@#0 S,(("T 1 #S@ T @# 0ST@#  0 00S*T*@# @ T 0@0|Z8ƕ@wZ9ƕ  ?@Z?$?6?H?y????!nA0 0`( "4`#/0s@-@Ph0l(`p2 6/h2 4l0Ѝp@/0P/0?0/ D00D(/0-#20$A?0R,, 00D 0 QD$ /0/T 0$Q00/0 0H00S00@-#@R 2S00H⎍0\ @㈍A-@P` p 0  }0 0 0 0 0sP$8Sr  0A eO-pH$MS00HP  O$8S7 2XL 000@0Z/$8S<0X0 Q( 0 % 000  084pG@L0@$ЍDX810 00 S0PQ000j0&jjfZ `0`F00 0C0Ԍ 00$(0R00$8SU  $8S0 Pc34pZ ( 0 Č@G-D0p唨Z ]@` 0X0T0X? =XP  0 ( `4喌`$ Q000$ Q000$8S  3(03 0P`t 0 o$8So$(0R%)00 0 ]$Ѝ0s@-@_^4hl@0400(`p2 6/h@0d` l6/Ѝp@臉@-@4MQyp` Pt Č T .$$("(R  ʿ@R<  @RppR0 p`R  @R RW% }  RU 8UWP 40 8 p0mW $\$4Ѝ@U0 8UPLQ\ %%,%,%,%,%,% %,%,%,%,%,%,%,%T%%%$%X%0h0p2(` l6/0hd` l6/0h0p2(` l6/h0d`0h0p2(` l6/hy{G-D0P唨Z q@ 0Xp0T0X?p p@X` 0 ( 4噈`p$ Q000$ Q000$8S  3(03`0 xW-` 0 p$8Sp$(0R%)0  00^0h0 (`p2l6/h0 d`l6/z$Ѝp0O-D0MP.008S .04005 X`X00`0 0Xp0T0@ 04 00000 $8S0( p 0 00H$(0R $000$(0R $0 0 0(\0 `0.\0  $!1Q00$8S o$8S$8S0 804@``0 ( ⸇0$(<RC0 RxQA& X!0R< <(A-D0p@Po 0 RZQA% !RX0Q88(A-@D0pPo0X S8( 880 8R 0880QA% !R 08(G-AS>A0@@-S>  pBFP`%@0S@Pᾃ0T:% 01S 8(@ 880A04P库10p0DT 000? D00000 T ?A-D0`p<0P@@BT0A#6T@1@W%@V:POV  00DP帄1(0`0`F]<8 0<嘃G-0T@ 0\pP` 0 ` <$(0 R%)00 0 0$8S+0, YP /i~1P 0S0  0 0  00 RX08( 88T04( 480s00aR1 AG-@᝟ DhPV P xP10CSp1TW000$0JvL0@  GP 8!031PbL%s@-@PЍp2S PP 0h0 (`p2l6/h 1 d`l6/P  P80P8WwP P(`<0P8P r8:  y< r<0h0 (`p2l6/h0d` l6/@) |0h0 (`p2l6/h0d` l6/PT000S  R 8U{RnAnnAnAp@-@ 40414p_-dp@hA-P@0Tp0`T 0W"  0  0  0 0  00e}$8S000 00T04( 48@p@-@00PX08( 88pp@-@00P X0<( <8pp@-@00PX08(\ 88p@肄,0S0 0 00, /O-D0M@8S0`TP  0 嬄pp@$(R%)0 00 0㞟⛄ ᨠ奁p8 0`080h0p2(l;/h 0d l;/4h 0400(p2l;/h 0dp l7/~ p0S5 ᵁ$8`pSe40S* Z $8SVS 0 G  0 B$(0R%)00 0 ЍO4 60 S00$8S+ P[pꝿ hf0PP  H 0(R 004` ЍbnA$00S :A-D 0`p $ T@  0 $(0R%)0  00߃/`P$|D0S Ot$8,S$(0R%)00 0A ƒ<0S@ @ @0< PnA/uuO-@ Mb } 0 ᧃ$8S```Pp0 P㖃hp (p2l8/h0 dl8/4h 04p(pp2l7/h0dp l7/V &1?0tW  V ,p,0V <X r:0S 8808X PU䃟YdЍ4`V ~uP 0S $8S p ;p8AA3$8Sp'~) ~WZ3$p s40S) T$8S 0 h (Pp2l5/h0dP l5/ W0 W0 0$0" PDP$0U0j uPf 4c `  <`00C`00`00p$`|G|$8S< 0p 0P $$W"$ RS  $8S000 .448#8#^080P0` <0@  S@ @0<  pS@ @0< W $0S`0`0r& 0 80n$$8S`l`p 0 ( _P$8S`]` PnAO-D0,MPQ `T0RH0 0 00S00:\0s 0  2$8S21\0X@0 X00@0(0:~#:0<0p0 0`@ Qp0X  000 (008 0D00$8J S\0$8Spp$8,S$8S 04,0 #20D`&a?0R<< 1@F8@000 Ɓ\0  `0\0`00 00$00 @ 0㳁$8,S0$(0R%)0 0 0 㞁,Ѝ008$ 0 c 0P00  0q:#: 0 0 Ci0PW\$ _Z WQE 0$00J10\0 $8Sg$8Sapp$8S0,Y$8S S0 D` 004,0#20&a?0R<< 1@F @08004\0$ @ 0\~p0$P!  Z0G-D0@P.TX`P @ SpP$ 000`pX000@ 0 @P }8808x5~}8808h-~ @@-@?T08-@-708p@-@P^|PW}}2S @A3 n3pP p kO-@P,M:R } }  A>a.|0 PSP. PS|8 X73l9`00 `PP Pd1@{) (90p0 0P'":XW >:00 ,Ѝ 0 , }$0pP∂2,2 [04P  $(0R%)00P $(0R%)000  P  $(0 PR%)00 0  o PPQoV  02$(0R%)U000E0 4120$(R 0 P?UV⯄0$8S2 Z,04<P0H$ X L81S0h0 (Pp2l5/h1dP l5/0Ph0 (p2l8/h dl08/d wX\ Uh (p2l9/h1d l9/UG9h (p2l8/h dP0l5/dwPhP (p2l8/h d0l8/dwhP (Pp2l5/h0dP l5/ 84P Y9Z   `h` (p2l9/h2d l ~ 0   ;0 00 (00(p00080 @D < 4 , @  :0,0040 0<0 0D0 (!$0  8  @ $@ ",$  ,4 4< <D D  $ 0T 0 (00`00080@   (( H (,4<D  T.H (ߍO-MHb@@p L P ( 0008 00000S { (x 0u8r .@q mߍ[ 0 P0# 000R(  " ( L0 "0 G08 $0 0 ",008 40< U L O1$p!40),!- #4!'<! !@p@-@MP `   @ @@ @@ x  .   ܍p R R R @-#3 e  pAO-MH`@L @p    S 00# 000#(000# 00 00#800 <040,0$0 @Lj 0 !0(!00! 08 ! 0 6pW`@x u r o.@q mߍP0 00000 000M00# 0H00#(0C00# 00> 00#80900#$0400#,0/00#40*0 P0# <0@ @L :0 !!0(!00! 08 !0$! 0,!04!0< @!0 00 0000 0 00UpS/O-M0@P< 8 0 , $   0000 0p0` 00 0 0S  .0 ߍ  (p' p`&(` <e p (` @PS/O-MH`@L @pai e a  ] S X00# 0S00#(0N00# 00I 00#800 <040,0$0[ @L U0 !<0(!700!2 08 !- 0 pW`@!   .@ ߍP0 00000 00000# 000#(000# 00 00#8000#$000#,000#400 P0# <0 @LJ 0 !0(!00! 08 !0$!0,!04!0< @!0 00 0000 0 0P0UpS/O-MX\ P@v ~ , y0 (0t 00o0D0j 0D0e0Dp 0`0D`$0[P  _, [(0WT8 00L0D0<04008p@`HP[\0 P0U0DSy D3D/pD+`D'P00 !)08!$ 0@!H$0!@@ 0J040  >2  >2  >2     ލ0 0 000 00pG0  0000000 00@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *j%nD(hT$ *h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P%n% ! P"..@$iD$a.@$i.lD$). @$ . @$dH.(i.f..f*b. *l.*b* .. @ (@&(h.&#a. 0#i4#f.. !a'p'0iT%b.b4#b!bt'bT% "0l! `&l4#lT%l. !lt'l$",p' ".!`& @$a.fh'dH"`@ ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:aOZPa!e%a*ek!l,l., ,a, i)i!0l!b"b$. ",c$#c4.P%P%`4 bX%`$"c("  a,b$".a4#b8#j. P0~000/=c00 0/=cG-@`pP0@M 0a800,($@ @@ @倹008 <0a,($@ @@ @qT00L0000ߍ00  @:/ \\P 11P /%0  0\ 0 0 0 0 \@,0:00640280.0< )0@ $ 0\ 0D P0H L T0X tL08p4T0H00@,PP0D0(`$ 0\0  0@00<00d?h?l?p?C-@0S !&.8PP &> 0S !&> i&>ş 0S " &> ZP0 05p9/5 0S !x%`rP \5 0S !<5(( 3ş 5 0S " 5 $P0 04p9/4 0S !$<P 4 0S !h4PP 8ğL4 0S " ,4 P0 03p9/3 0S !#P 3 0S !3xx ǫ`ßx3 0S " X3D< ⸫P0 0$3?p9/?0 0S !? P ?0 0S !?0 ⑫?0 0S " ?0tl ÅP0`B&.0808/&.P &>0 n&>/iP&.0!008/!P 1 P1!KP&.0t!|008/T!8hP <1@$ 2(1 ! -P&.0!008/ JP 0 0 P&.0? 00@4/? H,P ?0P4 ?0 $Pߍ?,?uA6eqA?_uA? 0@-ALM0 P0`5/(@ @P @0 ˪@ 0P00 (p7/@ 8P @0 ⶪ@0xP0 (P0 p7/8 PP 0@, ⡪PLЍ?d?uA6?uAT?uAp@-`@pMP弲  ⼳`a R ⴳ@T h pЍp07@-7P|@~ Q@00#47 b0 P Q0 Ѝ0r00#4p@-@P`\00M 0 0 00 P  0Ѝp@-t @0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 80 p0 P@`pPtЍC-pp0MMPSvX@`P `0 (`(07 ` ``V N _7 (pWIO0"R%U` ٱ7 (ݲ5 { >7 (:h 6`0 `0²7 `⾲`p 0b"!4b4# (007  p0h 0p0`   Mߍ␱7 (┲ ( pG 0O-MpP0?0BpP 000d  07 0001 0D \n D0Qd 7`D ^R 奠TRPPPZ 0Dd0? 07 Z0 0@i$ d0  0d P0T RP0P Z0   d7 v0 $ dZ007 PV dRP PXpWZO%ЍY??s@-`@4a P0 00Z?ЍpvA 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddG-騁(M`@p%41P- P d0 @p   4 0!,4Q000 p, \aUP! `V,10,1 P   0 0  0< 0 0. ,a`(ЍG$=cDc0N @- 0p&$=c@- Ѝ@- z Ѝ@- Q@/lbh&00 R R0S//lbP P //@-<0@T00S03/P@dwA@-<@ {Y wY &㍼dMwA@-`@qY@T 03/P 4Z00, 0(0ᆼ@YdwAb& d d@-d0S XP|DL@P<@88DP@(0@\ꌟb&&dUwAd&wAbp@-X0 QPLPP 8@I@D<VD YYp茟bdP P /A-`@0S Y pPU0p $0WD0P P0D00p0H0 @0@0,YPP@ꌟb&ddbA-@XP|`tp R U \YDPU0 D00CD00S   dwA ddp@-PHXD0 @T0XpP@ 00 0dbp@-@(`PX 0 0C 0p@Xdp@-@PX 00 0p@XdG-Ѐ`  FRp@0PP03/PPV0$0pPW`堻SP p@V(0$ 00td db&p@-\@BXPU 00S  @P &pXp@dwA dLG-RP 0# RZ AAR1 R? @ 2RV _2C6CR@@U0P@  00cf 00D`P 00@W k@d*XXAW@T 000@0X> AWPU 03/@P$041d0$0@00S$0@0ꤐWXD0@0 `@|0 pD0S`d0W0T0S @`s  ]{p@@ww w ddbd@-00@T P@rdxA/@- 0p@-P@,P\᩺ጺ 0#p@ dp@-P@P0,`000<00@` h巺8@P Pa0 @\Ppp@, $ p@V4&$&&-xA&@LxA@-@ @,a0S@ s<00,@Ibp@-P<@L0,`P@00; 00V$  p@#갟bb~xAxAxA@ d@-rO- Ppp`0DM$  0<00,(Pp`@ <0400,0@0 080 000(P$p0 0P`DЍ~xAbxAxAP/P0/@ d@- 0,۹b@-0 @  00N#P ^P `PP |S#Ѝp0 P 004P0 PP$"@ dxA&xA:cbxA4/0|'R02IO 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddp@-P(0@Tp0S @bp@-@P 0T 00Q 1S 0<1e2 L.:1S!!1! dfU(0003/p@oXbyAd d.yA"e 0P 0CP@@d #/  N @@<0P 0CP,0P @#// ̇@-@Qc>0T@DD<0T T 0 +2'2 ?FyAhyA P P/  N /P PP0// p@-`+P80@T p zP @bp@-W@U" (R  BR(13/4WU PEU4WiD73/4W(8S 0CS(8 88 3/(8P80 0"pC-w~0@S!P !R 0X"0T'QQD@b原10 R U T 0 S1S 0!   RIV|DXS Q ;V6XhU} Uy?NxP qG PMN Ѝ0 S'0V| X'e "0! R U!VV0 S|Q0!V&R! 1?0|8|Q|Z?yAyA?yAyAO-p@0V2 0iP>05/cw^ 0lo00`0S P[ 0p  0벰p W` 0S2001n8^0 Sd0001c00fN8/T0S00d0Q00@Sg/1!|115#Jh01 RC 1GS  s00aR310@0/1S01 ЍO16 "6&0- R    R    R   "-" R   .R 0  S0@008Sh0 S,01 "eyA?bbd d4&"zA0.R  "-" R   wP/P/////Rꐸ&`&&&&`&&0X 4\ 18/P x7S0S/?O-`@0u_0Pw>0S4 0!0p`눐到0US|Y@TP Ѝ P @  0 0W   ApAb4zA`kA1zA@CzAp@-`@PPp@0!0/00007wnS00q 20|7S S S0< 00CS̺&ܺ&&&& &|7Sx8D!0 0<00;080p0808070B;0;?NzAO-@0`pTM0=^0 {_ Hqw>0S9+ 3 0 _p7  0 _p7  0 _p7  0 _p7 0 x_Y0ZYpHH0SZ(PD_X 20PT TЍ0 p0P5 0` K_p7  0 C_p7  0 ;_p7  0 2_p7 0 *_ 0pSP  07pB0pX 00 0 0ZSʞP  `P( 0 S0 `` ^p7  0 ^p7  0 ^p7  0 ^p7 0 ^po(?@B00 S   P 0@/?G-P@Px"x.\8 Q8 1Q Q  Q2 QwⴀXa` 0 S)200SP7 P Q%u?0X pPSZ\0Q Q 00P PP2q?0^ PP 10p |p  ppWQX 0S MP48S|74XS|wW&T&`&T&`&`&T&`&T&`Vh78h7JlK4h78?NzA0000 000/s@-@` ^1 R S00#0 0S0:1D!0CR 0 D10D1! !0 0 0' 00 0-00n\!0D1S 0S00 000 R 0D10CD1! !0@ 0 0 0  R0Ѝp̄zAzA΀\Q:  / AA////p@-@8 MQ 1P 00#!" 0 0000 `0V :3/P 1 0l t 10 18003/@ D08003/0<000 ЍpzA?zA"{A?G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::? d@&&&&0S 00H , QQ ? /?J{A dx{A0S 882 4!RR   ' !/ ?J{A dx{AP0P// dQG-@p ڐ1 0" $10$1 Ѝ``PXQ1I(10(1("1h1 0 O -X  p7岠`71 0! `W p71 |! `80S0S$ `03/P1 0$!< 베,10,1W 111h0 00 8003/ 0`R*0 9/P 120!S 0! 0\  W㲠`0`4!S 4!p 0 L j0000d'?{A d?{A|AO|A|A@{A|A|Ap@-@P:3/P:3/p@-@:3/~:@/G-8p(MW 1@P` ᴐᲠyQ0 0#!"!0 2 03/P1 000 0000 101(Ѝ \0R 1 8 @ 101 :(ЍG/zA|AT?7}An}AC-`@ 1RP~P1US^1 Q0 0t1t 000P Ѝ08 R@@  0 RppSh7p0pp 3SH0L RP00H0 00@Q%@0 00T 0 (0 0(00S*p@P  # 0 3/P up@?l?}A?}AC-Pp(0`S!R# p 0@ l0 0R@@@N@80S*fpPU@ 00 0 Ѝ (0 S*!R $ $ $03/P@?}A?/A-`P@HM p&40%V   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M 04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p $+P`Ѝ?}A@-0<S !"  0 , y Ѝ0 /~A?<@-@ P0@00?/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ0 R@-P@0  <0`101(0 0C` "&ЍpC-R@P<M0 & `p1 01(00C0C ( 0Af uP 80R %Ѝ g$"P//O-Q0 0. R XB Dd(0HL@@A0 PlQ!@DQPU)T* p1  /J0 @Y  ZIJY ^ . .,.0 , ,,̠  @P^ ΂ a\aNL^Q !^UIߍ?AA-@` 1Q @ 00 >0S TC (`PJ`F@ V `!J`V@T*Z+ P1  kI 0 ,B0 #"$!qQ PAq@QpppW0#0P` "4 0"8",  0>P1UP N@aTaE1DQU@00>01S0#0}$IߍA?p@-|7S /0 /00S /0-0@-MP@ GP HT 8($$|Ѝ0@Ѝ/vA+A@.A0-0@-MP@ GP 4b,_($fYЍ0@Ѝ/A6A@0@- R 1 0 4)R  0R @/ R0 R1 R 2 RR3 4 ЍOAaA0@-M@P JG ; Ѝ0eA@P/ 0 0 0/"ep@-@0PP`  R ;:Pp p@-@-@M0 0 y!Ѝ@ Ѝ/ḇAG-P@p  MF`  aW P0S1PfP  F0 0 0@@00@0 {1PQ ЍG7=ꌀA0@-,0@SMP:P, 18   F  ,PЍ0@@ɀAO-S@Pp`M 50SQ SN 00 1S ?/p000D@S| PSh7|7S42S3 0J S51 @?@/Gr0?!L00L0#SC S' S70CS4004000CSe 1 >.0( ,?L00L0S 40040Ѝ, T0d0252P5c $YX0Zp0S1 >.Gr0p>![D00D00J S*1 =-Gr0>!FL00L00S S&&&&&&&&2St *Sp 0S ! 0 =GP00P0S/Pk xl00phQ1 <,Gr0=!L00L0xx7S 0450!0P0C2X00Z0Q1 < ,Gr0x<!L00L0Vx7S0X0Q1 ;+Gr0<!L00L0?0`0H5Q0[0 1 T;T+H00H0Q  04 8 <,S0S P |0S! *0Gr:!H00H0l0S1 :p*Gr0:!vD00D0 R1 $*Gr4:!dH00H0X VY1  )Gr9!NT00T0YQ xQ 1  x)Gr9!9X00X0A=P:1  0)GrH9!&d10d1xU !/ 0&W101<00<0101|7hWSPm2Sj U   Pd db7![0R 1  @D[ 71@w. h7R7!66h7[071?%0#  1  @D ?pw>0S㺟)  };5?|Q 2  PT<`0S ;!0:1h7 0 000T0(08U l7 I#l78l70 000T0(5   7P! T $P 0`P00 0%P  x8Xh'* 13/?S PT04$ d|wW 7S 40040  0 RY-1 5,%05 &D00D0BP*1 4$0L5 L00L0P 2P P00S ! l$05 H00H0oZ1 4($04 D00D0^0 S ! #04 H00H0MS x RP 1 3  5`00`06h7 1 |3@#03 `00`0$x8Up W , "pPU 1  T]C :0 00 00D 1 2t"02 xW % +P   9#P0P a6/1 JR  1!0, H2RL00L0㸁qἑ  @C0 p:S  0 3/P1  101!,000|7S0 a86/h7 1A $10H1t!l00l0|7S0 a6/X 1 000  0CX ! 00 000 ekAAA,b>AHA0A!A,AYArAAAAAցAA^AAAAAAAIA[AhAA`kAFAAԃAAAAA AAA6AA4A}AjAtA@@AAoÄ́AA,A5AFANA,bAAلAA1AAAAAAAPPAOAEATAA 0 S% 0CQ  0B000 $1%000 |Qp( 0 :0S0GSX 1 10x1l!0S ! 01|7S,'x 'D&,'D&D&T'D&,'! 01!7S !R 0L2:W W㐑C  H2H"p0 00x8U,  !PP` 2 020000P ,r1"  TAV $30, a06/pb ``Bx8U d |30|#|3\,PX 3#03r P  30#3kh00h0D3   TA dd 7S/W) W7,P Z50,0Y 1P$  TfA 0 Bx8U<10<1h00h0 1 3/|P  ,0 a6/1 858%pm000Q7S 13/X 0S! 05%000|7Sp x0p |7S񟗻x 'h 'D&x 'D&D& 'D&x '! 0060&7WS 000x8U   PP 2 020a6/1&  T@  0S |2 O7WSY 1'  T@ 0 <x8 U<10<1h00h013/U 1 3/N1S 7'd00d0|7S?0 a 86/7|'R7S 40040- W0,P 0IQ*1 T8D(Gr008!L00L0xJP 1S 8(Gr08!p00p00S"0 $0000 0! 0A S*1 09 )Gr0 9!_L00L000S/ S  S   0Q 0S!1 9)Gr09! 0@>C1 4Y&!`z 0> $ ( ,R  R  p0CS #l E p1.Y ?!M 00?\0 Y1@/P?@ L/Q00Z 1x/?2 0A@0P !& ?/_0 I  00Q 0p 1p d:D<08 8 <0 pGWB#h I!   1*: 09C1 4Y&! 09 $ ( ,R  R  p0CS #l E p 1() 09((ppgYFp !чЅ$$́1(  T=0 40P0F00D0 0C00A00@0080,P 10,0(01S  T= (0LP0@80< 0, a6/#x00x0m00 /Ph72 1S  T= 7P0~0, a6/#|00|0B000040?(0?x80101x8M? M? x861610S @000D0049;$0S 45202, $0P D10004P =1$04020|7S7S 400400LS1 $6$&Gr05!nL00L0꺁xXX 1  T*=0W5 0x8U<10<1h00h0 ሕ 0\Q:1 `5H%Gr04!7D00D0LP*1 4$Gr04!"L00L02P  P P0Z   P0S! T$0GrX4!H00H0s0ḡἑ 1  T<0W 30x8 U<10<1|00|013/OX㺯ᴒK  PE202k4wh7Q / < 67Qh7 !s30Sh77!66h71  Tk<hǔ  2ŸP0W04 13/20276h77S40040 00CS 1 1!00 1fL00L00q00101 P400401  T<0 |7S S 40040 1 3/x8U "0q00101 P400401  T;0 |7S S 40040 1 3/x8U} !yAAAAAAAAAAIAyAA,bFA`kAAP,A5AÆAA`AAAA!AGAO-lM 00PR0 = @ 0`  +X0:0|[ 0S!R 0 T?[ 00 000=p 1S ?pH00000}'  h'[ #'"'"'#'"'"'#' 㠅  BP 1 4H;h> X>000V t[uf $P$] 1 =  0 =   QI SQ0=Z 00 0 0S:x8 㠃  $0P 0 P ! 4:0P H:< <P$[Jo᪢Z  P   PP` 0p000K|7S0E00S0S !R 0 <0ppW9p090!& 05"# #^#PQ\ BQʐ 0  0 |;|+p[000101u!0 R1Ł!/V@p@-2@SP 0aS 0 6/p@03A0AS@-@e /C-`p Ax8TMBRR>'4?'4?'4?'4?' ?'?' ?'4?'$@',@'<@'@'4?'4?'@'4?'C'H@'?'@'l@'x@'@'0#8S >!0R1Ɓ!!@R*T@PCQ4UB  @PP 8. 0000000Q<<0X 0 00004 P)""#"0 0S00 000T @@ T@TЍUJxS ^ 0 ""0 㓳xG 'OoP/B χ166S1 000@ T0!01R !T@'TЍC\TЍC1S S@P  PP 1ZS01Ɓ! BT@2괁X wS@P  PP 2 01 S@0} p l01 R0@TAp & P, @D("(!p7 0 0S < B )  00/ ARD'D'D'D'E'00000p N9~0p :9?o2xN8v?th728o"}0l:Su (0TЍC/?\7'7'A- MPp=&%@R`P0%`Sb BS` BSJ? S#* S~  S< `⪎0pⲐWC嶠C  @0Xp8&S BS6 BS  S7 / BS|7SU cPB 13/<%S r Sr`A0W SQ`8#=0 ᅰ  (ڰ03A0AS)7S4`%WR0SO!V&R!I 1?0|8|7S3A0AS13/4P` W53   R< # ЍR <3W"0SO'O' L'O' L' L'O'p'  |'S|7x'R p' p' W0S08 w~0S 㴀u?0XS  R0\ Y"q?0Q  \ W "= s W "= m W0S p7  h78h7|7S7S03A0AS7S4`h7|  8h7x  h7 H 3Wt0Sx( 0•nh7< 0Wg0S.0‘aW_ (W?B0CSY"= |7S$ pG  qx'/o"W1  0R P00S00 ¡VYY6Y 00 S C  R` -%EOO-?@Q`|MC p3C>6CQ m3>6Q$ ?QO 70Q8  |ЍO0`?Q0 00 0p0rPPxx0@FS,W'W'W'W'W'W'W'W'W'@X'X'X'W'X'X'Y'(Y'Z'`['\'`'W',]'T]'L_']']']'^'H^'h^'^'_' _'4_'@_'W'W'\a'W'W'b'W'\b'\b'\b'\b'\b'\b'd'd'`'`'d'W'W'W'W'W'W'W'W'W'W'W'W'W'W'W'e'$e'=Q =Q F0Q0 0CSl)4PP=Q7S|'R h7   ㎮`=Q T Qe L=H=QD=|ЍOWa0.|ЍO<9 =0SVSSle'e'4T'4T'4T'4T'4T'4T'4T'4T'4T'4T'j'j'4T'4T'j'j'1S S Sh740 03A0ASN7SK4PZh740h7h740@SPL!P 10CS X'$X'$X'4X'W'h70h701!x8 h750h7h750h75!0B8#8S"= Ñ3A0AS 13/1Sʄ7w>0S Pp7  1 CbR.0‘!1R7|Ѝ!h7R00h7!h7R44!@R8NPPH<0 SP:XJ=0S|7S<xh >hPXp:3/0= 8PP <0S00$" 0#0 㡭< XV > PP 3S>ñ:3/V 4U > 4 `PPXCs`~!R<8MPP8Q|7S xH⬧ 9P 1Ps 9 @P lhQsa!*R8MPP80SS*|7S9 iR B0<~P` P@0CS|7S < @P 80S$ < |'R R0<嶳0 S < @P 8(1#3/ ,8  |7S Pl pP P ! MPP } x!> O!h7R 331Sh75h7!R R R5q}4{5y1S p7h7:qyh7:m!h7R33g!h7R22p'P50Rӑ 10h7GPX!0B8#8S ǕPPp1S5 U0p'0 P UX㎀:P1S $ "ґ0z*!0B8#8S Ǖr"!18p7l1019q W LPP 8Ex7 ?o`2x`QQ 6\Π x@Q@A0 S |Q 0x !@ RR! 1?0|8 x0@`P|V` e 8b03A0AS7S 0 S|7S c.PPg 13/P`!R8z LPPWW pP 03/P z186S003/1zS$ 8#8SW $03/SW 0:03/W pPs 03/Pn z0W 03/!Ra8KPP  8 C 0P> "8Sp7P 1 0SN <^ 0/@ tB 0PLc'|c'(d'Xd'td'[) 0PLc'|c'(d'Xd'td'0A!1P9 919"l A!0i979!^  ̥ å 910!^  ̥ å 910iiii9ii:ii87ii8i(o?) 8='? ?0S108p'1D!S8P#8,C("(R"-0! 8KPP8` V#=0 Ừ h9m! 8Ⲫ7S (#8 9! 8KPx 8  0BS^ !R r39S0SQp0  Q ARQE0X@ 8z8 R@ X P:3/>00S J0 ᴐJP-PY@:3/Ue媞0Sn@Yp0 0CR00h'4PS4400Rh7H mJPP B 80  J  な-kP h7~N#2000@000S@@W` 0sPP0T0 TSKPP  > 0S p7  h7 ;h7h7 ; h7N50000> 0 3 <倰h7P:: x'1l%Sp58 S!V&R! 08#8108|87Sk|'R8%S x(0!S`R|88[ x(0!R7S|7S|u|ЍO0 00 0p0PP |ЍO:ꔆ$O%P   03/PW%|ЍOaԓYʀ 0! #'0    ! @aRa/#JP7PPWa/B 0!'ԓ0 !    !D0C-DM,00 `p\(00 00a00$  P<0@rP0(0`0$  0T00<0 a ,rP<  DЍ詊A:B̊AAA,?@-  0H2$,p(`0/0,2  0408 bpPv 0 00졟!18 $ 0,p(`40LpP`0 00!18 $ 0,p(`408pPL 0!X18 $ 0,p(` 40%pP9> 0 00!18 $ 0,p(`40pP$w> 00$ 0,p(`408 oP0N@$ 0,p(` @408 oP  <<TЍ8An'BbA n'>AHATA_AjAvAA\?c]r@-@FP8p@-@`PUp0S00`00C0 t `aE-@-0 0[ cЍ Ѝ/ဋAp@-PP Ul'U`A@P jB0000 ( B@P@p腋AA.A-1P@`p x8 Qᔀm% 0.x8 S Vde0 RЍ إV0 glR`kAAA@-1@P` x8 Q|pp9% 0lx8S 0 fR Ѝ@ ᩥ0 hR Ѝ`kAA͋A@-1@  0@ iqRދAAO-1  :0 0k0 `RЍ1A Vt?bAG-0`pP0S0 3SH0L RP@\ @@L 0 @DTT@0 x0p00@FT_@P0oT 1 # _0 Pp@D(`F`(`/G-@p|QQ b!] !Rf!H9`0S& R $<&C<WB,00 8 80000C0h75h7G"ꁃAAs@-`1@ $V00  0"<V2< "! R 0 0 0S  ! 8Ѝp@/᠌A?A@-@083/0P 4P @@-PM@"P_`1 #0 0C00 00S i V1Sp1 #0| r 0!翆P R 0 0 0S  ! 00ЍЍ@n?AڌAAG-`pPB!xH0S  |0 0P'C00@儐T -0S 0C8C8S0 1 b#  0#|@S!00b&A@-@M# 02 2"%|000""? 0d?-#01 H 0 00-D1 < Ѝ@YAoAAAA A5AA-@P1 0| xp`VA2S :0S 3/"<2< "!?SAA-@1 0 `  0S A 1S 0 zP0Sʍ00Pp?sAAA-0Xgn@U `, ٢P v6PUvV1PttJpppp1 S2  ?PUA,4e??AAAFgAA<0p@-RP@0fBqG p?A-P0`kVF0fT@8 "@S 0!S@|'?R h'@0 S@SĈ@Xp 0X# P @h7    P @<1S1@@X@H @=^T-+" " !  0   !  ??0!  x?ppl0!  L0HH?ƎA͎AӎAڎAA$BAAA~AAA`kAAAp@-@PPLLA000AT  
Pp@?AA-pP1@` !0  0U 0 `00! 0>020`003/0900*= 20T1*00 0 0@0 01 `a R @`PpЍAR?A?? ) @0) 8408008,08089!= 01/d'$''~'~'2 029 0/202/@-8040#Q0l78l7 .0 0 ( ( #- x YЍ1@-@ h70 0 ,00( h7=h7l78l7FAAA'?p@-@P83/p@@-P` @QmVixw w> " Q!P R 1 B0S Ѝ7SD@1  }P0D DPw<G?0L Q AA,A=?7AA-`P8p3/@P\00\0  s@-`8 P3/@P\00\0- 1 } 0 = x 00x822x80!L0003/090020T100`ЍpP?fA?A-P`8p3/@P\00\0  x8 0 0x822x822xⷠx80!x8 99p@-@P`[@pp@-P@P xG G⏠1S 3/pA-P@p`000 w s o0?0?x80101 M? 061071 N? (Q 4$Q 0} 0 1SA/@-P ` pk@P 00 0w ЍA-|7PSS` h7M @ iN@pX0 R0S P@xHA-|7`SSp@ h7] P i^P10S TAT10 R0S P@xHə0S i V1Sp1 J0D D0 0P⮙A9Ѝ⦙c?qAA-pymP|7 `S 0 xH⒙T |7SS @P ⃙P@1 0 000?AC-P@@@`pAT ݐ  P01SSP1 0, , 0 Ѝ@?AG-p@W  `R 0S R⑥PprPU }P 0R01 S  R 0S R iP0 P0X@C-p`@P= RP@Tr Ѝ0S AP֘1 b0t t 0 !   AT  &P0S P @??AA-P@U+ pdP ЍA+0S0S i V1S1 0D @ 0!(<P ЍAЍ?ЏA@-@xP 0x8i <P 0<8HP0H8p@-|7@SP yn)089,8xxXP 0 022220000990w>018|7 S13/pAA-1@` !my~a|7]S11 P8889,8PPp (#  x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGgQ ⯗AR?AωAA@-@xQЍp`P P P 1  <10<1⅗)P 1  h\ \0   D@  ,h70SU? #~Q A1 0 `~0Sp7  |7S 1 $!$n2+~Q A1 0 W0S1  Mh76h7p7  1 l |@h767h7}V @+AeA$@AՑAAAu?EAkAAAԒAO-P`|7MSS00 0 pppE1 0"p0W  ЍO/, @T %00Ѝ0W p|7S2  0S 4"|0 0P800x8S| 0 0C8C80Q Rn P1S: 00! 00 00HP 0SH1L100P10CP18H1S 0 R B0 Y 1  0 1P Q䑄13/0Sʐ1  0 c 2S 0 ᬑ9/000a)Sʐ1\  T0T E NS@]?AAb A(AhAHAAC-2@SPpM !Ⰰ8#8X 0 a6/ЍCa< `Ơ 92<2<! !000w>0S:? n0001 A0 G=P202n0001 '0 7S 1 l!lh76h7? A `!H10S hǔ00  1VQ01S 3/9-8C800ᬁ0 8/: 0S 3/ ЍCS1 T h776h7`ꘓAœA?A@A`A`kAAAFA;AAA-|W`U U) U@w xP 83/@ ? 83/P@pWU!3៟@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, ,.P"00Lp@[?sAp@-PiN@ @P`xh⸑VxHp 0^ 022220000990?p@As@-!]1 @R0Ł < >H`1 00|!|1| yG 07D180$881]PVW,884h0h  01 00 0in  F  0(' 0' 8' j^6D'@7<7Vtx8 p  p'    L ( @ ) x8 Ѝp?ωAA|'A' A-`jʀPspQ EQ00C20U U U ,U UPPH$H@m}V`h@&h@@@`p@-P@ s000 0u t      @v w 0  " @x 0S @@p?A-0 0SP@0p `.|'Rꄷ'','',','P'0 0⼖  ⸖ ⴖ003213030 0⥖  ⡖  0♖  ╖ t0/C-@`M 2PP000y Ѝp0 `ݐ0=0 H02 |7S0000(001011 `߽ X0P   D 00L7SPP7HWLW0P7\AAA@-205 2S 101 , ʠ,ʠ\ 101 S&0#*R00BS00 \   0R!  R  (R  B/o"S0|'Rt@ 60R R  R R  1 0S "N)R?O-0LM ShP@p 8ؕhg`+ |7S 80] 8R` >0 S c39Sn`$7R 1 8/>0 07000`㲢 $7Rh7 4@V80  3S'H0L0S#QH 0P H  0C IRv0@P04004LЍ>0&S c3)6R0Yڸ |e410V 0040  B    04@ 0PR 04c4P4v4@T /1U 0      $D"$ (0 00 #R,H L R(QH0 P0H0 00BX0 B 000 (00(00 0|7S"P'P''P''''''  !4@P000w 0 0 >  8ݔ0 0 00ZD 06 R0 R00R":)0R  w  #"!# #"0( R00 V 8 ⦔ > ⢔x 0 08☔  └ >321303(Z !%%*0(@00 000 0J$0(0 0C00$000 00  Z 1 Y: o(`Y  T1P`PM/0I0  L 0 101 00 00 I0, 0/, 00(0080(0`0 C0000 00000($0C00 8000000C001 !0110/1!P`23V [8000 0徠000Sl V` $0R h7 |7S8 0 R 0@0080 R (03/P1 8JL  810812@PA??}A AcAtAMA+AO- ?O-P1$M`pPT 0"0 `=d [55@P000O hL H~q[ 0  00C0(0 QHLPP  1@P H BQ B0 00 `(0 0(0@01011011 ;`B 0H00L7S@P7HG0LGP7$Ѝ?=AjAO-`Q$M 1@p 0)0 `9vPW9  W W W  1S 0 t000@0WW W1| W  0 4PP 0尐00(0202{hk"PP000 @ x8?0 00|7h'S000  0 ;0x  Gx7S00j000짟    M? 0#40券 00#300~ 00P#3@0  6! |7S   0 0Y w>0S*0 000>0h 0S0000B h7 l  g000   *0  8I#8 CR,X SXSx HoᨂZ  R㈰ 0 UPP 00 R㰀岐崠 \%0 @, k0S 1 5 0:0Z(110011|7S0 #R H L RQH0 P0H0 00BS0 B 000 `(0 0(00000=00H0 1 PW|'R  3Grpq珷 0 01 0100L7SPP7HWX0P70LW弈2_@$Ѝ d 0 D%PP 0ᰐ00(01018S>HHPP |7h'S000 (  0/  p' ; W00  . x ⥏000 G_ih7  40S  HQ 儏0 00 00C0(0*3MPP* h'00  0  ;Y00  岐0  " 101G!h7  40S0 0C0(0k 101 g.PP, R :01 P0 Le0@00|eA?=AAܖA3A,bEAA?)AA-`p*@P 00(0K0P 000p  p@-`Ps*@P 0; 0(0 `  pG-p'!=⼐`0G% -0p@ PP 1S 0`#`000Ѝ ]0/ |'hR    0  + h  Ⓨ0 Sw0S 00000   00  00|'RV00 0 ! h7   Yh72h7h7 :0S*0 000>0h 0S0000B  00@10 @( #RH LQP  P-PP#    N  00001H   CR0C00(0 0(00㲐0   붑+?aA~AO-@fMP |7h'S000 0 0  ;0h7 . 9) S!  " 90 9p9S!  ! 90 9`09h7  h72h7|7S\hw`u@ !PUPPZH(0S PU0J$Q0CS*e!0 Rp p!  0 ppp 0 Ⱑ PH!`h75h71 0l x08 S0R 0C00 S 0S   Ѝ p?A×AAA@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@X1 0 6Ѝ@5,. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 j 0 4`*V1Ѝ@/Ѝ*AZA-0 /2S/p@-@Pa0 6/p@? 06 08880 8077090(10101/* * x'&d'@-:@0S 3/ Y:S@0/p@-`@0SP0P    00T ,P1S 01Wppb d ?P0/ dP 0!/ d@-@ 0@膘Ab0 R  bAp@-<@P0S,)@T ŠP@pbȘA QA-0@P PS tm`lp0FUATe B^R0\,Y`$p0FUQV+AAјAAC-1@pg 4!1000$OxX倇X'''t''`FV''''|7S S 0 8:0S 3/ Ѝ0 a6/c  |7S S 0 a6/3V'<'''X'|'R/I032+L3Q' zh7  1   !h70d!!p740!h  i j9k9 0g901 \0 E|7S!=0S* 9'w>0 01 9i9 00\0 *|7S 93/1  |7X `S499Ѝ@x829009h72h7Ѝ ?b?A5ALAp7/p@-@f_qp@-p7/O-P`㼁qMpw>@VAM VO VQ10@|'RP 5) 6) 7) 8)0991  99 0894!4 079069059000N9 O)PQ R   0 0 `VpPx8S   19ЍO0: @h0: 0\ 00: 0590690790890Ѝ`?lb*??sAA?@?@-h7"1 @ i|Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@AAO-pM`0`  P0@0 00P 000 0_o`@eMRPPU!R:"R :"R:0ЍC-MP 0`p` @幇0 0 00  00P 0 0@-M?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0`PPJ<1$ 0<0  A,p(PP91$ 0<0  A,p(PP)0'00弐$00 00A,p( < PP0$00 0l0 0`0A00,p0(0< PP  ,,Y@Ѝ:BAeA'Ab'nAbA?G-0` 0S0@YP Yt# 00000SW }0``P 01` 0c` 0 d`Ѝ@0@T@AJ0^0\0᳀0X:0bxA@-  0 @!  Q3  4M000 P1#9P00T0scX耖C@BC-P`尀p0@ A0 .0S H?P `0` 00庽 Ѝb dAO-P@0TM00p1W:[I (PC 1 0CЍO薽0S`0 S00qp0少  A$0 ߍ[! P p PQ`1P 0 b 0pP0 0P\Ѝb dœAܠbAO-@0P00MP@pP 0S S S 0 RH*101aQ?0S  P ㊠  0 ! 0 b 0p 000! PA0 Y0S5 jP 0``0S& [P `.` ټ0崰崠0C@0 ϼGo`0!0R xļ X@Ѝp0 p 0Eb  0ᱼb d4Aܠb-AWAnAvA@@-@@?@- ,4 4 8 #8ͼ Ѝ䏝Ap@-@0M SЍp@P` 00 0ⴼЍp蘝A-$M840, (  0 $Ѝ>c@-`plM @P@ !0 0  ( 0  P0000C0 p0!0>0 0C0000 0d@S2 001 00@0A(太H0L 0 H0L 寪lЍe d>c2M0PЍ/D@P 00S H00O-0HH!DM 0 0 ԮPP@`p\0  0 0 a 0,@($  P#N0  0 0 a40@,@($  PN 4 h 0 `    a 80@,@($ PMDЍ@=cA>cAA'/BO-l`,M@p0 0 0 &0#TTX%XU * 0 0 0 ,ЍOv#0 0S 0S*#@P` 0 0 0 ,ЍO00C0E=P ֩0 0 0 00C0000PP' 0S S S/廩 0$ 0 0$ Ʃ3"0XU$S 姩(0, 0 (0, 岩#L P0iP  1,Ѝ0U 0 01P0S1300 0 `  0S 0S 04S ϣ2㪋@ : P`0SȀX3H > 0S R $R  RQ  BR(((@(( X *  0嘣s 0@!  0004 0 004 &30 R S 80< 0 80< ^ 0S_ b0P`0 0| `P^ 00@0D 0 @0D 0S 0CSL00I0 0S04Ψ004 0 004 ٨3 I20 R S 巨80< 0 80< ¨ 5 0SP`0 0 * P`P 00嗨@0D 0 @0D 墨0SS S>c@=c@>c0p@-00@4S 3P1 pR0 0S``Ң2㭊@ap0SL0P 000 010S100 p@=c@>c  BR/ $R/ #/0 0S/IA-P@1S `p 0 @1 @T Ѝ0S 0CS0@q 0S0 0S @@=ce@- 801S@ R  R 0@=c@-@ D0Q  0TS   g@ @=c03 ! "/@b03 "  /@b0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/0 @-@ኁ!.   p@-@PD`P@ p00S DP/p@-@PP 'p@-@P  'i@-b@ 0;p@-@PN'&p@OO-Q$M0T `@Ph (pP h0$ЍT@ @ ` X0B00S @T & N00S 000S00 0 0 0C0P`` @Z 000 R0 C0P0  C0P ` 0 0`G-p`P$@P[*U 4 0 S H0S 4 R 30 UP SH0Y 0S 0C @\P@P   " 0x0p0PPH03&aZv 05 0ʀ6 06!&걝A (!>00000 0/6 0@-MP@ 0Ѝ0/,0/@- 0MP3p0pp``P@Ż 03  !,0 , ? 0 Ѝ@" 0#000W1 /,0,GpL᜻ 03  !,00,0 03  !P,00,0,0 0 0"}%Ѝ0 d (A 4 #4 # /l0Sp p l p0 0S  0 00/A-@|`pP1hSl l0p  AD0P1p00`0101S0@@tbq d@-@Td$,d,lH,l $ . O-@pHRH2DM p00 @@0A10bA ᩔ屺>  ᡔ EF? ᗔ`pP%1 00a0,P($@ @@ @I000D1 0<1 00a4,P($@ @ @I1  00a40@,P($@ @@ @H0'40张0  00a80@,P($@@ @PH040p0 00a80@,P($@ @ @PHDЍ dԝAA (ܝA7AbAA@-@N0 0S P@\0X0S@_ P d0`0S  b dp@-P@"0 0DS P@ 00S \0X0S@/pDP 00Sd0`0S Db0S 00P0#///0  S /0C\ B /p@-ҹ @dPPRL0$!p@ 0S  Q@D0R0 1 dp@-P@ @~0!S <S21pp@-@Pfp@ dp@-@ PJ00p d@-@ 1@(0@s5A-CP@ `qD Gt@PTዹ00S0S 0S h0S 0S d0S `0S X0SnD&@/b80S/A-3`A0ASMCp2DP@TMЍA00S)@0 000S P 0S0000*0 0003/PD@Ѝ,cp@-M@`DPP@Ѝp@00S0S 3/0000k*¸PD@-@$1@QQop@-@P 4吅001Pp0S 0Sp d@ p@- @P8"@P@+#p@P@ dA-`dQ"pP 000#Ѝ@PA 0 000 ` P "⃪@pkP "w@q *1S0 ` "1@0D A0, (1 q0p(1" d1i d0@-@Mh"00CS0 pЍ0@"j ; L K0@PS   (10C(1"'Ѝ0 d2i dC-0`SM 3/4 0pC @ )P 00ЍC9ԷPPUTT TmY  0#   Q @SPT U d dp@-@,0P `0,0EOt x0Rx0t 1x0 0S  0 00 000p@ d dO-@,MR||`SPp踠 0S XP R R0 00R0P00080S000 X 'P 30Sڸ000ܳԓYʀ 0! ##0 ##   !  0!\#ԓ0 P#H#   !Ḑ\㸐 00踠 P 0SP00 00X00帠7 `P帐#0   R$"\ d \R \ \ d X d 0`0H0403 $d0S00 0` 00\0X 00h0` P0S ( ` 0# ' H(【0  |pP#᷶ 03   PP,00,0$ U"P  0S0S  S  0000Y% P#,0 ᅶ3S0S00hX 0 2P 03/,Ѝ ,c@bxddd d dO-D>PQtM pC(> RF 35Q X@ 0'@mW=W26W`0ST 0.=0P@ l=l-WW00W0S9 T`1P@4=Q 3C5CQX U & =W -W !BW -P9    R R  @ TW( <W% 1CW0 @Bz 0z@ z0S P z!>d600 aPtЍ0`0 0i  00R 0`ふDWP@  ᝵1P;W 0 00 RVr  00 Sl D@ yt0Qy 0Su0 @y 07z| @3z3 P ,zP (z ^0d0 X8 0  tЍO00000 .P( 6060X0\  0 *Ѐ*0S`00990 S+(*(+(*(*(*(*(,(*(*(+(*(*(&(9WW 6C 0CW 90ST `H9W ``90SS񟗁X-(-(-(,(-(,(`1( 0S 0R W0S00}0SY|00S8W0SX妲Tꀐ0Y(8((WW TD800 0 0 0p吩`P T"@P7P 0| 000?8`93 `!>8\000000j87W}1CW D70 SPWwD700 0 0R`P `O S.(,(-(,(,(,(,(.(,(,( /(,(,(p1(`| V `P}`32  `3* x ` 00 ( 0`3 P  PP `&T``V 0$c,0    `3 PVF`0 ^`P`PP0Vd0*0P DP`Z XE0t01x0@t010S ؐS{S ؀0ؐ Zc8V P`0`V `000d030 !0S`0 0 R ` ` Z00   `3 !0S P003 P R0`@ 0S  w`00`0[l2 4Ie@0S 0S000؀S 0 {Z܀{Y oVP``U 2 #P`/P `PPPb0x1|`W| w  w @\ R0@1 0@P>W0W26W> `h00 S.( 3(-( 3( 3( 3( 3(.( 3( 3(/( 3( 3(l1(W] 00SST-(-(|-( 3(-( 3(\1(T >T i ii i di@'i iAiii@c@co%iߖo?i-Aoi!i#i"i ddcM08 P R/ !  / d !  d d d dO-MP@Dp  `0@0@@P)HP@N dT100:e 0!`P H03+HDP@) FT 0Y00C?o20S4 0S1 8P@ ,T *10@0ЍL0S# D 03 @P 0  80S 3/@P  d0Q(@- 0@R0S  R P `Pر 03 0Q̱/ dp@-`㙕P 0@0L0`0D00@0 0<0(080,040D00040,000@p (X (( ($((P (` ((@-@1@o0O-,00pS@(,M@P 0 0 0"T1T00XS%X@P  00 ")a! 1 00 $a$" 1040  0`P  0 !H 0 ( ",0 $  2) .( ,( ) 0,8S(0p@-S/@ @`RP0SP@npt0P0Pd0 1@0  0R/!&   s 0R/!&   sG-(pWQ ` PH $H($$(4$4(8"(#8  0 aV 0S0 S 6S 6S0S$7/`QS/A-p`P@T0S0S6/@A-@PP2 R0`0 p0S0C0 0SP`U0F1 @-P@T Ѝ0S(.P`(`00p000W -`pV (0@@-pDMW,8`P@P& 4  s<00004 000040   000 fPUZDЍ0S/8p@-P@Tp0S 8`0P H R@O-TMx@T$0hP&h0$0&448 #8p0 0ZTr $ 0Rn  ;/ 0$Q.Rb W R&R PRU  P X  "S  R PI 0 U R U Q 0 0:/P0 QZQU ZX+ S [ Z TЍ C-P,pW$0`0$0@븒!!)4 48.#80  @T W $P p` 0 6/ R R &R & R RT Ѝ@ R !R @ AA-p `X8%Xp%DDH$H00!P0(@@!P0S6S0Q 0S6S0S 0S0S 0S0 d0S|p@- 0@SP0S   U U2 Pp&,"44 8#80  !R   01@&,"44 8#800A&,"448#800 10`&,"44,$ $8(#8"(000 01S0 001@`&,"44,$ $8(#8"(000 0A|`y&,"44,$ $8(#8"(0000p@-0P0`|1 QP@T 000S  p04!00$ S00,P(`l 0  000Sd09d0@0 ` R00@&P"44 8#8 !R   0 1 &"44 8#80 A&"44 8#80 1 0 Qp7p dbG-(0@ᾠ0SP,``M|  RTd0" 0 0  0 P"p pP f  jP`d0@0d020""448#8260S   &"44 8#8 !R   0 1 &"44 8#80 A&"44 8#80 1 0$"44 8 #8 S03 0#  0P匠P 3 0 P (00 0`ЍD0 W 10R@10S 0 6P/D00 W +0S 0 $P  (0R R  @!@1 0RD0 0  @1 H0(00 0\@-0S 6PS 0SQ@` 0S  @(000L0"P00"P00Ѝp0SC-0PSlM=0S/90S_ 0` R@( RU dr   R R S$0 0 0S0C00匀XJ2# 21 2(0 (0000p08_pP 0S100lЍs000S 0CS # 00ƪ000ꛪP d0 (h 1ꮪ( _ (0060 0,P.L0+0SQ 0006l0S (000L00 00"1UPR $P /0 d@bA-p(`@pP:0S    0R, 00! shP 8 p50SP 㖲Jɸi 0S0 A0- de0S/@-40@0006(01@ d@-0SЍS !>00 000080 Ѝ8~ @- <0b",4b4#  #$  #(  #< ЍJAp@-@0M SЍp@P` "448 #800ЍpVAR=ddQ 0S  0CS0#0/Q 0S  0CS0#0/p@-@PT # 1R !R BtPpEp@-40 R@  000 s    k Ѝ@-40@ R  000 \    T ЍX0 0&-$M840, (  0b$Ѝ dC-M 0P`` @n0tp 00P 00 0 0@3?o2P0S B~Q Ѝ萡bC-@MPp 0` m0` 00P  00 0 0P T3?o2PPPU@ @T@p@W T @<.Ѝ @T  @>cbO-@`Pp3DM ,@0P 0 0p(`$  73ᄃ 0P,@0P 0 4p(`$  6 0 0 0'!,3 4P0P,@0@ 0 8p(`$ 60 400!2 02 0P,@0@ 0 8p(`$ 60 0 0!2 0P,@0@ 0 8p4`(`$ 60400 0 0!(2 0P,@0@ 0 8p(`$ 60 0 0!1 0140P ,@0@ 0 8p(`$ 60 400!1 0x1 000P,@0 08p(`$ i60400 0 0! 1 0P,@0@ 0 8p(`$ R6 0400 0 0!00PP ,@0 0  8p(`$ 96  )1?T@T*DЍ觝AfAbkAY(tAAADZ(Ac d`g(>c >cp@-P 㞋@lh 0S Q 0P @@@040p@Pp@ ㄋ0>cbb0 * dO-PM@p00`6# 21  2 sP 0S v `6 V# 2!1 2  Ѝ 0䥟0M` 1t0100S pCWp  Y 000DpCW#  R R  H000 [ V 0$0$0> p"( (Y DIY 4  R H , , | p VY `400000S&pY  W   T0qGY`_ `P F`P= 0$00 .pCW # 0h0h0T|Sd Z  [  [ RDSS S 0 j0 00 JZ 0S0 C "44 0C(",400 0000 (0 B C( Bi"0P,0,00  q!B pP0#$$("(B %0 0C000PP0s0 cR0 R000 eW" | @:T$TTW  Tp@PW  R` 30p 200Sp 2W|YX !>000 ( h408clX(ÞAbp@-0P@寎1 01  p@踎 dC-ᶐ`<M@@P 400   0  P 0Ѝ PP XXh$ @1 1p;W ЍC)T TX%XU d"44` 8#8R#2Q1CS0RH0@0!PU:pWPX0\p JU:H @D P *0X0\T 0 @TЍC`d 000U 03S \@0D 0 @0D *`Pdp03/@괡b>c̡bX(@b d0 h\ 0SQ HP/P1 %/QS  1 //@@@- 4o萡b dO-QpP00P Bύ0 0 0 ڍ`2N"0`0S 0Xa0C?o20S  0R:!R\232 HB婍0 0 0 崍 ЍO  P "44!8 #80CS``0ST:T`1P U[èaQPU@_0 P(P2(X2 hŠ 0@P(Qa1 01  j0XP00 0 X0 XY[ 8#< 0 :0 000!"440000 0 0 000PP v dbA-$M840, (  0)$Ѝ?cC-MP@p 0` Ag0` 00 00  P 0@ 0 ,?o2P@@TPQPPUЍȡbG-M 0P` @p g`0 00  P 0 0 p@,?o2P0S  0000 0P00Ѝȡb0O-,M@c ,0 勌X0\ 0 X0\ 喌 ,ЍOPP 0Su(1,!0 (1,!倌0  ,Ѝ!>00 $02\0 00P2cN0 0 0 Y 0 0#$$ (0"(DRD pP p00C0H0S2<4 0P9[ @  !PQ0 L d` Q)P@0  1 0 S!00 P X0\ 0 X0\ W, 1@P@H0L 0 UH0L  `0d 0 `0d W  0 ڋW <7Y (Y0P H0@峋0 @0 0 彋P@?c?cȡb!>@-M00pP `00嗋p 0@P堋ЍL啋L@?cO-=Mm @P=ЍO7h^P i 1$!0 1$!t0=<@0@0@0S S S 1$!0 1$!^<PF0 0 0 Q<0 <   <<P.0 0 0 0SP@0@S 0 0 0 @AT  0$ 0 0$ 0TPP< 0S0 0 0 |;`( "$`$"",R a(!"4a4##<S3 <1, @000@S Sӊ0 0 0 ~3 :0S P!448#8T帊(0, 0 (0, c<(S嫊0 0 0 V Q0(0 C< <0;00 ,000P 0<P 0<0凊1!0 1!20SP<G <0 0001S0_0 R P0< 0T 00000Ss <0 @p0(P0$400010C00ST^ 80S@W 0|1PPQ  |B0<0Z Z@ 0S@/00 0SRQDZ Z 0 0C0PZ Z Xd!>570Sq $0S @E0S[@@D 0\0W$X0P0$0sZ-@0 00 0 0 ^ 0R*+[ 0 4$0P  d0K#10$0  00$0@K@ \dZ|XNP \P \0 0c |000@@@T@ @ Xc!>5(0S0SY[ 0R: \c|Xa0P0\|P@ K c |0000(0DYY00C $R+YYY0 #"  02R0N -0IS  S6 SMD @Da000 |%c!>70 0S,400刞ᆞ0;P ᣞ0S ឞ0 `c ᖞ000 |b!>70 0S  Kc]|0P0 z@E@L@pT \30S@CA@$@ 0<P#k0301H0H0S 0CS# 2P0P0SD0C NJ 00SJ Py嶈X0\ 0 X0\ a U T  X     [ #X0L0L0Q  R UF hUC `U@ XU= Q: H0T0T0S D0CS@p010S iX0\ 0 X0\ t< 0<S 0 0wSX0\ 0 X0\ ^hS,00 SƝ 000S < P<0S 0 00010*p0t 0 p0t 5, 0 P0L01# 0<3/|e?c debȡb d d@O- LM @P`pt8 fl8 (p000`,P$@ @@ @+'$8 (p0@04`0@,P$@ @@ @+4䗟 0 07(p008`0@,P$@@ @P+ 0 07 (p008`4P0@,P$@@ @Pv+0 0D7 4(p008`0@,P$@@ @Pa+0 064 06(p008`0@,P$@ @PK+0400 06 (p008`0@,P$@@ @P6+0400 0P6 (p008`0@,P$@@ @P!+ 040 0 06 (p008`0@,P$@@ @P + 0405 05(p008`0@,P$@ @P* 040l5` 0`5(p008`0@,P$@ @P* 0405 05(p008`0@,P$@ @P*44 04 (p008`0@,P$@ @P*0404\ 0t4(p008`0@,P$@ @P*040 0 0 4(p008`0@,P$@@ @P*0@ ;040$0 03 (p008`0@,P$@@ @Pn*040t3 0l3(p008`0@,P$@@ @PY*040(30 3 0<(p008`0@,P$@ @ @B*0402 02(p008`0@,P$@@ @P-* (p|24  0pD08`0@,P$@ @@ @*02($0$200pD ,` @ @*p1$01D 00,`(p @ @)1010D 0,`(p$@ @ @) `!``0@S50@ T0 000^2M0PЍ/D@P 00S H00p@-@`P@P pA-@ PR`   P PRՙpP1P 000\ Q ^0 0!0;0G^ 0!@-`Q00pPg8'#TgT%%<[@P VP Ѝpfl00100S 0CS W  @#R P @000 dA-@MPp  `X@P"0 R@00S'X@ ( ]G@P `P 00@ЍHP P=`XPW1@P P00IA-PS@` pPl0 A/4@媃8!< 8!<嵃?chP/A-p`0PPQPEU `f @ T T@ @U@  ]0PEpO-,0,M00@010 44`Q :$01 000 BpWSV0 0 0 a(P,Ѝ0000 000000#![@ 0Cy 0 (08#<400 00000@ -,0@0,0VP! *0C S  U R R 0 0 0 7P0 0 0 UPPP R0 0 0 V7P`T p`U@0P000010 0!00 0000S #000 0-0"> 00 000K1$ 08#80!$$ ("(Q:0ɱ pB "4400  8#< 400WP 0( 000@ `P}0 0 0 刂0002,0@ ,00,0 00800?cevO-QM00 0 p@ `G"448#80SP:0P0 P 00000XNC10@00=x0| 0 x0| HY ( %\뀐$y[ 0S 0R 9 $@Pn @Pi $5PP$c mp 0 0 0 ` x0S00  QHLQ RH0P0H0 00@V*PP k0 0C00 0000<@0\(0@ 0(0\ 00"44`8#<d`m0g0 0 0wZP10t0P@ XE`P [p垁0 0 0 婁3P p@0 000s0PT@p0qSTq 0   R  X [o0 0 0 z0 sR 0 d 0Sa P^ DGpP Z`P0 0 0 [@0X 0`P LZ>014!0 014!I1P20 sR} PPx3u`PpT @P H0S Y0 0 0 !AP @0D 0@040 D 0PW0X   p sT @P Y`0 p0 0 LP H ۀ`0 AP0 0 p@LX`0HpD S 0@04PL` 0@00 0@0D  W0P0$0  #R6  31 0SlPPZ 80S l80$3/PPO l0 0l OP/ 0S 0S)  9PP$ 00SPP ,0   ,0 0,000 g 0$ X0S 3 VK0 0 0 V PXN B0Y OW D;7Ѝ 0S80S X380$3/`P XP0 0 00S U0 0 0 U6 3 \U@1D!0 @1D!0  (U@1D!0 @1D! P @"44D 8#8Q0 %0%<#*T@1D!0 @1D!(P 0<00  0(DQ ,   40#0 @0AaV X0  "50 @000PP R c1 !0 1 !`P 0 0004X 4`P03 <30S ,0@0,0 "44 8,P#8S J04[ 0R0  X0 0 0 {1P00,0  @ 0O ,0@0,0 3  420S 20S ` ,00,0 0 $ 0  PY3  10S 10S > ,00,0 PP  Q U$~0 0 0 ~0U0 ]0 00  0$ P PW RT }N R  lMt03l l41d00l0 0~0 0 0 ~X1P?ce?cbLbؤb(c@bd@AC-Pp@p0M00S0TЍ0S  S` S0#03R0S0S 0 00000 000B00SQ QR X0 P R 000*A-PpU@(M \MwPP7@4 000030P0 0CS((԰((( $ @P0S@ `0P #Rᤓ1@0S  2R`V\Lw`(Ѝ20᎓0S0@0 @ 0 00S00 0 P@+ Q' 3S$` 0V V;@00 0 ℝ ^ R `aP 0007@1@ 0@ 0S 0 P@` 0V1@ 1 0 `aR0C000 08R ^ Q ` -@Us@-0@ SP% S( S- T 0S000  Ѝp0S`lP 0P0@000͒P00P 0  0 d0O-,M00P`Sd@ |&Sp6P*,ЍP Pb00CS񟗋(((((((( ( ( ( ( (((((d($((((((p(((hP 0h0[9  pP7`  V[`#0Z*[* `V'[%ZZV0 W `F` ,R0 W`hpd@(V W`p P00CS꘶((ȶ(ܶ((̵(̵(̵(̵(̵(̵(̵(̵(̵(̵(̵(̵((̵(̵(((̵((,(00000 CR0ŕ0S@@0S@@0S@@0S@@0SKK0 00+0 0p0㽆P20SJJR P0SJJ  ; P$0S 00 `$VPᾑ1P 00嵑opPj % P0SS' @]S @Z ! PP0 CRy((8(8(8(8(8((\(\(\(\(\(((((|(l(8(8((8(8((8(8(hP- 0 P  0CSꬹ(Ĺ(ܹ((((((((((((((((Թ(((̹((((00 0000D600D1356 R R D0$00  0np$j  0$*f p@-@PP `p0Sp@\tPp@-@0x`S   !00C000C0PUp@ R0 0  坈( dG- PFUpȀ`H@Tp@W< 00C@S@p0S00C0S0 .{@0D 0 @0D 9{ @1!  4 d( d?c( d 0O-@pDMP!0l 0 00,@(p$   0!0 0 040,@(p$  0 400!X0_ 0'> 0 080,@(p$ P @DЍ( dA7A#Ap@-@`M0P0@@ @0 $dP 3 <@@T 0200 R00C1 2"Ѝp@2A\b( dXb@- P?>@Y0dA-@40"0R S  B! "2 2R$2S0p`P"0#Q00S qPP@UP#00C?o2PA"( dXbb0dO-Mp0 # 44 8)#8!H'1  CRD4G:z0 0 0 FCY 0I0 Y V` "2000#?0AT1 0z0 4 0 4 z `P 0.z0 0 0 z8 0S:Fy0 0 0 yЍP R\ \S @ p R  崑 T !A  Y"RRx$0.@Pr       !<  0 0 1!     !0R @A4000S0`0 ``0 `Vx   Ru  !Rywy0 0 0 y20`}1p01W 0 !1Rp!AQ ڴ! Q"Ƞ,Ƞ B! R.10C100C0=y80< 0 80< Hy t $ Q   p c! B!  B W[ R ` ``! R l0!`w @R  B   B  ` B p*W,0p0 8#< Რ0 00@0h0 0100 01C0T 0V(p,@`X x0 0 0 x0  0  0p0@p00[ ᲑIY ڴ!YN   !) A!ᴑ Rm? P0`R Qa zx0 0 0 x7?c( d0d( d-//-/-/@-@-@-p00d0@ ` P d0 (00  0 ( 0 P(P  Ѝ1M  @-y;A@-uEA8p@-@P 0S 0S 0Pp0Pp* P p<d!>C-@pPM0 0@@ 0 0" A"440T1`V T+ 0p Ѝ0S0S S0S  S0S S T P 0 _@`, 0  02# |0R0@l@ wh0l 0 h0p0l t 0Sp0 t w <d d@(?c-/ 0!< 04 0 (   !/@bxdddT0M000S ~S 0S/0S001Ѝ/"e\ P/0 !8 0 0 (  , !/@bxddd0@-S@)@p0`000S ~S 0S/@P0P d0  0S ᢌ1@0ᛌ0@0 Ѝ"eA-@pP`@PoA-@P@`@pxYe<dp@-P`@Kpp@-P`v@?pp@-@`jP0001p dp@-P\@&pO-@`p\!DM 0 ( a0,$  @Pa0 00( 0 a4,$  @PN 4 p 0 h (d  00 0 a8,$ P6 DЍOE꧝A)Bu)PA<dG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 @$E(<d@-p`( PSR M $ @p PP0 aWP xUd (0F0S*0 #R7H L R3QH0 P0H0 00BS(0 B 00T7P 0(00(00 !$$    h 00` 08 WPЍ 4@S>SB 0 #RH L R    X@P P 0 (Q&(",$ !$$ 0S(0DS 00 0 0XP0 0{u0 0 0 u(PT Pe?cG-p@P`W1  @P  05W@9@00008@V U  ds@-a0SP@ 0RPd0C500 P0   0P Rd  ++d ЍpS Ѝp@P P0S0Pd Q  0Sd00 00  0`( "4`#/@- "44!0"441@- O Ѝ 0<P   /  e/bb(s)0M/ X=1M/ 7p@-@Pp`8`PPp0Sp@ 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxddd@-@0:0@@-@0 :0@@-0 00   00xЍXAhdp@-Pz@phdp@-P@ {p@hdO- MQ( @ '    PUS   RK0 00 00_ 0R010 0! R010Q0;SPU 1 R00 1`? 0`R00 0R010 00C 001 1 FiЍ HRPU  R  00 000 p0`0P R" 000 0 0 R00 0R010 Wp 00C 0 MRJC\ C^B&\\Sns! ! !$ !$ss 0 W #`^q\ R  @C   0 0 000 Sk0 000 0R00 0R010 Wp 00C 0 2Q02s81<081@1<D 0@1[D (!, (!0!,4 0!4s000SD0S0p0pp0 0P0 0  0 -0 0 H 0030CS  UWPpPPPr1 !0 1 !r (W`0000S0p0pp0|dG- P@$p`0PHAr0 0 0 r,  Q Q Q R00P Pp8 #<4 ,(8 ( #80#8S S 3 00S  0PY Y,0 Q Q 0@ (00S  0~idؤbO-@PDMppDUXDЍ`0V V X `XV0CS((<(x((((V  0 ;S0000 "440HPV 0 ;S0@000Sg1h0 0#2S S . (g. Wg!0g. Ut V0 0L L 0 ;S0<00h10l1V 0 ;S800S0 <00 jdbAlAb@-@00CS R  a``  B B4J00C0@0CT廄뙠Ap@-La@P]q80< 0 < 80hqP!R? 11c R P!T!S0cB1C0S0T100S 00S 0 P1R0`1S *01Pa0XPP!UP1H1;T1N1C1UP1U0P000p2P11T1dbbbbbO-CM0M00p0 0 0 q XJ0 <H060`0SP%0%* h0P h0 QP%* .PU p1!0 1!pCߍ  PP0P 0#2S S0 00S P0#dd0h&h`F0T00$0040 0#21V,000, R0S% p1!0 1!p0S 0S0S0S 0S 0(``F 0T00$0(0, R`F 00 RP0 , 0.P 0,  QxPPUy ,00C<0080<0 S  0SlX:P  0@0X0b\_8@`,0 @ 00$`0P00n@@$0SS S 6Y; 0S Q[:@(pT +RT  Dd!S d0`) hP s0h00 h/00u  hI I$0S S' 00SQ 0H  h[ I<0800 0000 P0xo1!0 1!o $P0 hpff0 00h00oPxt8o1!017 !o 0 tpPb0^zo1!0 1!o,70S 00SZh"    "44!$$8("( #8 㢁h6 :P   t0 0000p0 0 nP \6&o1!01@6 !0o 0 _pP0o1!0 1!o50S 00SZh . q .q "44!$$8(,"( #8 . v. r0 @ 0p @pGW4 00P @@ă "@ēpGV097St@n! ! !$ !$n0pH00`F001W00C @ģ1V, (tnX1\!0 X1\!np]~ 000p0fS  0Rj~n(!, (!0!,4 0!4n00IY-XsenH1L!0 H1L!pn[nln 0 0CS0S% 0R!In`1d!`i0 `1d!Sn0 @H0  0R6H0S 00000``0 b91 P0@0@0` `0`04 S0P 0 3SH L0SP0\ 0 ^P 40004 <  0CS00S0 0040H!>6 l 9&0009hp0060ꫠA dhd Ab bpdbAAAܤb`dbbbH?b(bb,bdl cd00S= 0: 0 h*pP2 w  @T, d13 0x00D1;Sڬ0`1%(80S#0  0$  70T00S S070 1LmP2T"0 P2T"01Vm0@ 0!0CS103/X\( `0S(0 1( 000Cp!0C(0( 1R ( ^00S\ h!\00CSz  !0QSQ@ p  Ql0Qh\ t0CS`20l1\0h1V0CQVCPS4! RO:+RL( R0C HQ L!0CS20Cq``Fl1x!0| x!!| 1!l1!0CS0X110C10    BR901!Va0 BR1011 01RhW'0S $0SX40S 0ᙽP 00      0 @ 0@oP D]l1!0 1!hl LoEJl1!0 1!UlX0000< 08P_x51lX2\"0 X2\"80'P50&Q0S~ LLR Q0L A0CS0Vk@08 !$!01k1!0 10! 00 0 00/ k?0S00 `0S !+0  @1  Y~/ ;SS SS000 10 1;0CS4 )< ) )< )< ) ))0? 0 ! CR<0!0CS67i!1 ! ! $ !!0 $!1i j 0 0000"00020  1RP<~i(!,<< (!0!,4 0!4i0:0D0K0!P0 10L0L P0CYJ;[iH1L!0H1; L!ei Veʌ;MiP1T!0P1p;/T!Wi0 ; S 0 !0CS@O  1S 1R0j00$i`1d!0 `1d!/ii_L0P `C0 00X0S  t1BQ 0C 0C  0CS\:0l1\0h10.  1RR;0CS%<))))x)x))x)ihP1T! 0/P1T!=040Y;h0 0 0 h600 !0R 0000C0000  00;S* 0C8#8Se 0BSD00#V00Sn 1 S^hhh1l!0 h1l!h#P 0Q. `k?0  BR0!0CS4wh0 0 0 hA0`0`SY/!440 0300C17 ;S;08C8S; 0  10C0CS103/Pe `;S41,041XYV  1P \1  BR103/0弖,0, 010BS hp1t!0 p1t!hs0000 ,00C0hx!| x!!| !h(0SC H!R 0L0CS5A~ 01R<"1 03/- 0XS;10C10    BR901 R010!0 CR 1 BR!0 BR1;0CS; ) )d ) )p )8"P40Q"!10C S01 10C11R0#0 500, 50C01Z 1  Q $40?0)" 0; $Z 0;31"jZ 31"V!0R1 S *@:g1!0 1!Eg 0 10101\1S01\15 0$! CR$1 0C0 !0CST01@01q`10`1!8#8R0  @0z !$10BS$!@>@70 0P00 ^0P0;Z0 [ N; S1 $0S1100S 0S$10 0;n@11n!11b!0 P 000000```WP | 0R$0S S- $4RX00<0 08000h P V. 8ddbbbbܤb`d@-0  0'S(P L@Tf1!0 1!_f$0 M;d 0`( "4`#/ 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxddd@-@0:0@p@-PAT1PD1A P \GyX1+8T@1D01@ xSx0 S 0 ; S0Ҳ;p+A@bO-0M@S0 S/`̠Z4 ?(0S S<` P`p(` (P P(p !R `0d  SP3P# RPPUOfC  &0S 0S0S HXڼ; 0CS0!0; 0CS0!WD0 0 0R0100`VʰlV 4FG00P4%41581ShPP11SHH0a8c`x80Px H0q8'ypqH0L S7D!00C Sz:47P0 R帾P 7P0STP 41R !00S01V@`@`]0x0 00$0t BRP1 P8>0;V PF03 PE UVP/0k80lPcP0<000000SQ ZPM8VPI LE0S(0 S<0080ph0 R[ YP  T 4 1`P0H7  0 ph + ip"jk   @ f1ppl40S 0   p l `0S `(VA00 00d4 pp1pGh@1S1 @qp$0S+ 1(00` R:(  (P4A`|q   $0p0C$0{x |qq$0S(04p- p)W&5`0SP@P0 0"G0 $00C$0\ K\  C p00:v80U0402 sb00S0U0S- 0 0 0 P2vb2`P 824 00S<<07aNb024"0 024"Yb" `p)W00/0CS202000000 000000 ,!0Z 00400 1S ! Z101 0弡1QQ0- 3SH L0SP0\ 0$0&PHBu0SA01`bb@(bb,bbb(s)40p0(pSV S /`p% !1N   80)80Y880lP800 0 0 R 0 40< ,0 00 Q 040<,  x'|t!x'xpW|GpGqv8BPu 00!0 CR01ůU0S 82P[(8#<t$0p(p0S(0$ 000 0!0ShR0+00P P`2 7P 2P @0@SQ;SN>`Sf$00( 00Sf(0 (0( 000 0S0P 0V1 XSq5_0 0 0 0 @0D 0 @0D _,0S, 10,! CR,1 1t1000 00e<0S !8R @0`S`(`<`)0 00400@-1D @0C100C0 0R100  gĤbdA-@0p0!R蔀0 0RP`|3eP 1T010`00 0 R 01 @ @! 1̤bĤbȤbd@-0 00   00cЍlAd0 /|10|1/O-4M I F SPPQPU>Q: Q6 @X1J0 H\-P|ap F9 B90 c(#"$ c$"a8! #4 a4#CQ 0 CQBQPE`FPVpQ[4Ѝ Q A0 B^0"Ap10GS1qSA BPP q0p CR000AS0 0PP 10CSQ0 CR00 P0CS0BS0P 0 CQ000 CR00U 0 GR HQ PHPGQPȤb̤bp@-@0P DR@ѐQp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R k1M  \0MX @Tp@-PUp@`+0P 4 <0Pp` d H Q1Q44!#010p@(bp@-PUp@`\0P 4  ]X\0Pp` d H Q1Q44!\010p@(b@-0 $6Dcpd 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxddd@-@0  :0p@-T0@00SDP@ep T$3Sp0p@ ZeewA(b?)@- @H)A-0pS@ S P0S S0S0S0s0S0S0sT( PU  0R =00PP 00(0 6 0R` R: 6P 06 00001 @  00(0p 0;00S0 000! 0 80SPTA*(X 0$ 0 0$ pd 00!/pdA-p`NPUA舰@T P P (X0 0 0 (Xg0:0JPepd@-@01S001pd0SlC-0`S,M"P00P0S@0@SLPP PR \10S UL 0 SpH ( 0R*T ,Ѝ \2 0eT0!  00WP@ 00TP00S h00@ C3SR L0Lp 00 S00/@d1)ddp*@0S,4! x!/@-@0M  2<01,0 00 0S0Ѝh2)@d@-( (0 |OЍ1)dP Q Q@\ \2SQ Q @00P1Q0 Q0(00S@080P1/(b dG-@0SPp(p0aP`2Sa 0!QQd2S01封a1S10S(pV`aP`2SP ̐ P78P>d2S01`o`?1S10;`<U p0t  0kV *FJ90 V1Gh"R l2S0mPp2S<0h2S l2S0HPp2S<0(bb@l cp@-@PPpP1S#0S X @ (`R R X!!Ff`Pa 0 0< /X1TFS!P00p@Cz@-@|M0t2p S' `0PS  T x       |   x  D t   0 02 |ЍKQ (b 3)pd@-0S6& ЍS6&j눡A0b? S /A-P(p 0X`8@@ TL3K@D0S@D0S@DV x0|  0T@ De8X0 P1XVL 0   @T8A%815A(bl c0S0 S0(0 b/ R /0SA-0`S0MVPTPR 2q0@S0@?oR20S@[ P0@S PaQUM RM0000 0 P 0 0 0UP" Q 20`0@S010@Sʲ0TpD#TT1X%XS 1P090a0Ѝ  10CSa0Tw00000090P2 W R. 0@S0$ 0p0Q0 0 P00S @0G3WS /!>20 2 0 $0*<0 $A0W/@d1)dd$E(p@-0P@(U1 01  (p@UpdA-8pP(`@U!0@@(AUpd 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B 2=0C=d@-@P 0y;@0:tP@H 0!R R  @bX)O-m0@SM S( / `P t@$00#.0#A0@.H>@$00#|5 00 PU `0S l3P  3PPd%@-0@ 0@00 00@@oW$$00S@ ЍǡAhdd%O-@R@=`SgMeMm0S SR 0(68.0#p  "`0`-5 p\a 1  QᨁCR1!0 1!R @ ^00;m1 S 0 0Q!A`000@0@00=0=R1!0 1!R ЍO(68.0#t  " "1-0R:R101R 0 SH 0 A SS0!\ 0  d%bdXdA-P`ATAAp@O-G@Y)Q2"0 2"Q R0 006h h0S h 0R 0+ ) + 0& 000d0 d099d0f0Sc006S +0SH hQw0r` 1 111101000 1,10;1(! NQ0 0 0 YQ; 10S0;0; 10S080;;w;S;4110S4P |10SLBPX;  R 1R4!41010$101 100010 X0 S,!0 CR,10t0P1!0 1!Pf@xHP000 0  0X @&00Odbbbb(bb,be@-Pp`:@ RPP Ѝ0 0CS4`P! !P1d@-@p`P -@P Ѝ0S; +R0;8`tP1!0 1!PdO-MP ` pPTX ! R@ BPQ # 0R    ,`" 0 \"Pߍ0S  PP* dC&P2 "0 2 "1PX P :븀1 d0P P0 0 00 00 PU@0_TX  )  l3* /*[Ḁ000S` Sg `20;0 Pm1 [XX0100Ch01d00= S;0;0`0`S00 1201 0 SQ?0  d10S;0; 0 D10S;0;0 0 SPP*O0 0 00 00 Ow;000 `000 00 00` WO2"0 2"Npbdhddl cbb@-@b$MȦ0  $Ѝ@p6 P  % Q" 10SJ 0CS1) wO00 00B 00 0p( 1啵զ$Ѝ0Q1;08C8 S; 0;NH0L 0 H0L O>Q<NP0T 0 P0T NP!T1 1X!C1S01S01S00000 1S ;S N0 0 0 N01;S唵P!T11T10P1000110H1;S0;0103/\eb1)dd@bp@-@Q0  p@P8 P ;` S DP T1X B R*1C1S014cR :mNx0| 0 x0| xN<b_NX0\ 0 X0\ jNX00z00eddb@-@aM˥0  Ѝ@`p9 P HQ5N`0d 0 `0d @N;S6S00 ( 1( 1S D  B0R#*Nh0l 0 h0l N0 0 B !  x01T01Mp0t 0 p0t M<eddbp@-@Pc0  p@蝥`P 01; S !R D0D00CR:001vedb@-T@5HH 04004 000h@0Webdb` dx0 R   R-  R   R   R-  R/  / b /bbgfff@- @@0 ` dq)p@-@TP0==09#9S p@SP 000ve@-@ 8 ` @0S-//A-`@Q /`pP!P+0B8#8S1; SQ0A?0R  0?!0bC-MP00`0p0 0` @<' P  0`  00 000 0@?o2P0S R0 ЍO-pM 04@34RW X` 0 000 S K@DTp0X0 00P$020@3(@T 0X2|p3\+0 S PP(0 0000VP -0w&0HL0$0S Sg 0 S030#Y0S -0P 3/ ߍ(0 H L  P d T 1X0 0\00S0+0` d0V! 0C80(0 ,`(p 008P40$@@ @ 0!>4 ,`(p 008P0$@@ @d> 00!T> 0L>4p,`(p008P0$@ @> 00!> ,`(p008P40$@@ @"040= 00!= ,`(p008P0$@@ @x= 00!d= 4,`(p008P0$@@ @(= 00!= ,`(p008P40$@@ @040< 00!< ,`(p008P0$@ @l 040< 00!t< ,`(p008P0$@@ @V 0!0< 0<4 ,`(p0@08P0$@ @@ @> 0!;0< ,`(p0L08P40$@ @@ @'; 00!x;0<0L 0,P($@@ @ 0 !(;B0 ;L$ 00,P( @ @ 040: 00l!: ,`(p008P0$@ @: 00 !:4 ,`(p008P0$@ @040@: 00!0: ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @040P9 00D!@9 ,`(p008P0$@ @v0409 00!8 ,`(p008P0$@ @_0408 00!8 ,`(p008P0$@ @H0 400!L8 0 <,`(p008P0$@ @@ @10408 00!7 ,`(p008P0$@@ @0407 00!7 ,`(p008P0$@@ @040`7 00!P7 ,`(p008P0$@@ @0407 00x!6 ,`(p008P0$@ @0 40D0!6 ,`(p$p008P0 @ @040`6 00!P6 ,`(p008P0$@@ @6 00!606 0<,`(p008P40$@ @5 00\!5 ,`(p008P40$@ @{p5 00!`5 ,`(p008P40$@@ @f$5 00!5 ,`(p008P40$@@ @Q4 00!4 ,`(p008P40$@@ @<4 00!|4 ,`(p008P40$@@ @'@4 00!04 ,`(p008P40$@@ @3 00!3 ,`(p008P40$@@ @ 0!300T 0a,P($@ @4 040 010 f1 SRBAB0 0 0 B0;0`1e 0@ Ь@P  :A@P T0Sޭ7@S=0f1l cdbG-PU@' p@`000S S@  A@P0S0S0s0 00 ᄬ@sA-PU@ `0pS 0S Q @@P Q 0@;Q Z@P p@-@T P\0`SJ:pS=pp@-@T PA0`S!0S=pp0S p@-P(@5 p/A-0`SPKI@p0S@>9@@+0S ;2XR* 0R 001000@07@A-`@pP000S S/@X> 2DN>47U 嗨@=edG-`0M0@Pp0S6@ЍZ U U @%  @  qaYPx YpGWأ))L)P)))<)8@P0S0000W*@P0S@+S; @PpW 2Wq @PpW 2Wq @PpW <2Wq @PpW 1WqpGWm꼥)ԥ)0)P)8)@)H)P)ܥ)00 0S;   ; 0= S00 000`0`S0e00d10200a0 000KD1P!@@2T!#3=P022l=T0814X0X"\T"1 l0 1p`|00t00 ` x02000020201111*@*bb@-;@SS'8#8ST? S0 T9 ;S0(P O; SQ 00?00;w@0; S0P 0PH00 B P (00 9 P @bbb;SNp@-0@(P0 Qp@r@P p0S p@-P(@ p/0S/p@-P@p@p@-0S@ `@ Pj@P @pO-QMp Ѝ 0S S1`11@11`11@1P 0` 0 0 00  00P 00 0 0X0?o2P0S0S* BR񟗽H)h)))))))))))))))))H)h))) S  S R| V`S0 0SPP/CjRP#US@@Ӗ/CjR@#Tꤥbbbbbbbb@- @ uRBAAAp@-@\41P! P301108480pp@-@\41P! 00P300x1084Q80pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:0 ԤbФb;S/0p@-HPH`0D0@Tpw 90S w 2@ dA bA-p@`{Pd0Hq < \  41+ !  41,812#4100FS`bp@-@PUp@  BR +/A-;@S0;)`@Q80;p4Q0H 0 @( PPP 00!0C,2#41000eЍA4]04Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81`R$Mz;SwPAB@s 0!qȁ?A3c 2#!0C!0#Q!40Y41:8 0%Q%Q$ UP!U03(0#02 0 \+1!ƒ  010 SP0 @PD0Q#_@Qe Gp 44!0 0 00  00P 0 0@?o2P0S 00P PSS00 ЍS~P 긤bb@-@S 101H00H0101p00p0101000 20 2000@0040@MKP !d0)bb40!( ( "P @@ /-//-/-/@-$0$@ JHF4(@b#d-$M840, (  0( C$Ѝ#d@-F뢣A@-F묣A@-@ẬḬ-W1M/ A-P0p`0@P( d0 0  0 ĭ` 0PኬP D@( 3004 0 004 (3Ѝ#d@-@(0((0M @X|@-@0S 0S <՛P0 0  0 lP #db@b-/ 0!< 04 0 (   !/@bxdddA-@,p`Pǃ10 00S S S ,00S  (0",$( "(x0P p@(20 0 0 (2ᚃ3 ,0 0S 0 DP#d@b\ P/0 !8 0 0 (  , !/@bxdddA-@P@`@pω^pe#dA-@pP` ᒜ@P[A-@`pP T@Lp@-P@0Bpp@-P`@=6pp@-P`@#*pp@-@`P101E 000Fp d1S/.@b) 0O-@P`DM!2 0 0 0`,@(P$   0p!t2 0 0 4`0p,@(P$  r40 0 00'!2 0 08`0p,@(P$ @Z0 0 0!1 0 08`4@0p,@(P$ @D0400 0 0!l1 0 08`0p,@(P$ @- 0!$1  0 08`4P0p,@(P$ @0400 00!0 00 0 08`0p,@(P$  0!x0 0p0 0 08`40p,@(P$ DЍO9꧝AA@bAաAߡAA#du)PA4)/B-^0 ^ \  H  Ez C-DlM (p00 0 0 (0 0SP * 00⯬P 00 QP%P *p'DU (00 0 0 (0lЍ  zP P 0S "dd!44h8&hV#8(00 0 0 (0 P S Aئ0S   P  !>! 12  0 $00S ( , I`PUh P 0XP  L08P L0 QP%P :U 00VS| 0E 8 Ⰳ^'0 L3; T⼄T'04p 0L 0xp 0(P\k 10(0, 0 (0, D$ P2!0$0PP4(080< 0 80< ("0"$X*PP$`0S&2R0S $ S0S  S &1R (0  (0`0u Pqt`V x00( 0 6/p` Pd 0 0R: (0 `W / 0$ 0 0$ (/ 0 P١ P#dA@-0S0SP0!0@SP R \\0 00 00וЍ 00@)#d$E(A-0`0P@ Xp X/@0S  O0S  -@ЍV0dS*@PW@P0S S @d0# 1# 0# 0 0d `X<4bbbb#dbbbbC-0PS`p,tM S+ '@!0!3 $$(000 0"(PT00d 00   0(0  0Q28PtЍ!0!0(@0 0 000#0%( "(0$p (۔PT0d0 0 0   0 Q7o o*HDdH$dG-pM000 `P%00S'0A0@@DH$H0P'}0P0P PX%XRP PЍJ *Z`C-`M00p0 PPA0@@DH'$Hz000 #P 000Ѝ' e0@DH0$HTPA-`M00p0 PPA0@@DHh'$HB000 P0 00Ѝ!@DH R Ƞ$H,ȠTPC-`M00p0 jPPA0@@DH$H ᰑ0QY!0I0 P Ѝ@DH$HT#P0@-@|M' PU U  " I  0 0   |Ѝ0     `    O-MPa0@p (0` 0 00 0000X@h0 0&0poᨂPX0 pP HŃpPЍXp@e@-0@S S 6S 0S0l00l06S   P@O-p$M000 `P2P`- ؀6S@`P_&@TA1@@D?H;$H0 & 0 Q PX %X& P 0 P$Ѝ0C8#8S`#dO-$M000 RpP$Pp A1@@DH0$H` ᰰ0 Q PXᰰ%X P0 P$Ѝ`Fh&hVp@-0$@ `TPM Q Q@x@T@l !p  7/P0 #P 00@0 P00C0Ѝ\b@0 QQ$/@-40, ($ Ѝ\b@-|Mp0@P`` wH 0H * 00X 00 0000|ЍHDd@-40, ($ Ѝ`b@-|Mp0@P`` FH 0H * 00X 00 0000|ЍH$dO-p0@P`ᤠ夰M0倐` XX `  QX 0` 1  01` 0 1 0100PЍ@AC-`@ 0R0%0 * 0 rPH Ѝ 0Q0%0 *$=S p0pQqS  0UP  0R@@T PE0S& U  R @h*0 0 0 s*ףSPEUp 0I  p7pA@edG-P@`(pT< 80PL80< < D 00C0o#00C0 0 0 0Z 0  Z$S#@ ኣHdd0 D @  ㆁHdd@?cO-PTM000 S`  * ,0ťPiz,0 Q% *;=Y 8<840000 4L&PL0 p pR 0 0  "4$("(Z B 0 W |1 000 (嵡 H)0 0 0 )W |1 x0|0x0| !44,8##8)h0l 0 h0l )W |1 000 0 D {`TЍ0,7 (7RQm*0 @@g000 06TG& QQ[ L "@PT &< @ 8 <@@@ @@00x000(00@00D00H0000S(0J@0000#dd0h(0c&h`@0S 000S߀ 0Ua Q   P ( 0P0U 8@0S $-"PDP开W |1 000E( 0$ 0 0$ (W,0 0(0$0T  @00 0S0$000 0 0 0"0 0$00 0C 000000000`P#40 000000S0 0 R0T Q    BR$!T  ` `FV 0 0  `#000D0 0D00T R~P `` T|$ 0!00 H 8#<400`(00H`Xᔂx  00000C0< 8080< L< D 0@0C0k!00C00Tw (0C; 0R0% * 00PP 0 0R):P A`(h0l 0 h0l (W |1 000 @@0P 0yQ 5 0s    R0$ ! `0i P< 80L80< < D 00C0 00C0 t @0H0 Sv Add@ed@?cbHddPddb@-) @0PЍA-`P@@Tp!p@ 0RD0S>A;00C08@<00S j'(0, 0 (0, u'<T['004 0 004 f'D eHdd@?c@edb 0 /Hddp@-`TPpT@TP`@0Sp@4~6' 0$ 0 0$ A'@@?cHdd@edp@-,@,P~0S 00p@~eHdd 0`( "4`#/P/<P/xp@-@Pj< x@P<p@-40 R@  000 ] ᐜ UЍ@-40@ R  000 F y >ЍX0 0&C-@MP`H~ 0`  p0 P 00 000P 0 ?o2PPPU@ @T@@dp`V T<Z~Ѝ@T Ý@?cbdb-$M840, (  0 b$Ѝdd1M/ A-@Qp`{PWP=0d 0T00 p` P @ #RH LQP@\@V !`VQ  h@VTI L@D .PVp.WWTpL>W AN^ pApGW0N ^  p 0A0CS00L-\ S fPALX 0 0QNV.Q TR0 B d@-`P@M 8p.W( .h`R( .N( `p0i7ЍA0@-ASS0CS$*L**Sh %B -Qp*****%A 0 0 0 B%A 0 0 0"%A 0 0 0 0w%A 0$ 0 0n%A (0, 0 (0, e%A 004 00 00 Q QW%B 0 0 0 N%B 0 0 0 @W%Q Q Q=%B :%B 7%B 4%B ddO-PM'U@50S 505%0(000m7ᑞU(UL p0( (EU0/S0㬞@PE ( pS:0(0)0p`\(0(K1P440P,0( HDP PPPH0 `,(PHU d40S .pc'L$TPp070/S0f@PЍ1PPO 0`00:0p0PP|13p000 0( :,PR0 <030S00P00PIP0 S |!  S |!  X "X H|!X,*$*D*2xtPp0P9psPP 0`PP 9U`ꀀH  R X񟗉d******<*`***   Ru|1 000l 000d 000\ 000T|1 000K|1 000B|1 0009|11!0 1!0|10!  ! '|1 000|1 000|1 000 |1 000|1 000b;A@AYAbdbO-M @0(PPupPQ ,60S  60S 0E00U  5T30S 0  4#0D ဘ@0S  30S 0  "0|00@` S1 Ko0^P [(20S|  00 t"0^0 ((CQT`TP820S 0  "044P> R 50 00Sၡ  10SF  .%0  5Jx!0430+000 0$VPS[<\\yL10SS0zɛ dA| < 80086lBύ00d0 pP ʗtyD0Bύ1bbAddb@AͤAAcAAA0AvAAdb?cإb *O-(PWMPEsP |1܏ 00U0! 8$(0 8$(!|1 0 00  0'S (tP 0 00400S0% p *  D0┝P D0 Qp%p * 5W  iP00 p 0 : 0P(0 >0S 0@. P'$(00L.0H@3!(8,(0 (8,(@!0mB?! !!0S0: 0C R-=0S 0@. #0J. #200\-`30SZ00C S񟗞'*'*'*0(*T5*t5*5*L6*6*7*|(*'*S$*`%*%*%*0800S 0p004 R   0P 0 Q`:X |<0f@P8<P |1 000T67*0%*7*$*X%*/U  8$(0 8$(  ]|1 000 |1 0040004|1 0$0T 0$[ T[ 8(0 8( |1 (0,0T(0, |1 80<0T80< YPP P 0 R 0 3SH0L0S 0 R@P @P0 R0 0  H0GP H 0Q:00S U  b 88<(0 88 4<($$0 4 $$g  Zr|1 @0D0@0DT U' |1R0p t p t @P   MPx | x | M|1 000U 084(0 084(V\80S UA U ÜP 0@`S 0 * L0͛P L0 Q:: 000S 7000D5@nPP40S00S- [5@JpFU B0STᒕPP 0 @@ 3S H0L RP@\0@0@D4@DTʖw-50 "44(8"(C80(0 0C$0pC0SS `A00CS00S S@ @ 00SW0WS@@ W 0ubPP  d`P PPM P`0S 00CSd5@@ 0Sh-*D1*D1*/***<5PPk @Th0Sf  0R0% * P0PY P0 Qo``VO 000W 0 P3 0SW@$00C ,0R:0   RR4 0$ p0C000 B$ , CR7 G0 R# \?R?^R$\ ^ 00CSZo R\,\0P< 80kP< 80 0p0pG00S` 3@@@S 0000<$0 0 ?o2R0S $P@'`31,0T0T@Tp 000~OD900T,3@P2X00PXp 0WDpGW 0SL Js,3p8p W{`00S$0`S 8P 008 0bP P P 0  0 00S PH0\0\pW DpG0 0 ddAb@צAA db"ecddDed|@@ed0001`0`@T ~OD@@`&`SWnpP XXo*ῌ@n ͎pnWT 40 Xpp`d 000U 03S H0$U0*`B 004 0 004 `Pdp03/@db?c *ddO-`pDM%40SE PH4,$0$(PYP0P P@  R x@P $Ѝ0 RQ $Ѝ0@蜢*@@p@-0P@e1 01  p@ndd03 ! "/@b03 "  /@b0M0P@Ѝ/0M0P@Ѝ/L@o/P/ob0 @-@!00/up@-@P ɔp@!u@-@, , , , p@-P` @<040 0 00 0EZ@P  ,'p@Ap@-P 0#$#"$#"4#  B0 ATp6 _P @@-@P ctp@-@PP SpO-P`4Mp@PFZ 40H0X ) \d@P  *|t@P&) .  &4Ѝ0x0p0PH0Yf 05 0606u걝AA8T*p@- MP`00 @@0 0s Ѝp 0!< 04 0 (   !/@bxdddA 4 #4 # /\ P/0 !8 0 0 (  , !/@bxddd@-@ @kk@Bddp@-P@P PP 03  uPp@ښp@訏@A-Mp*)Ax`@PTUV@@`<)V VT `Ѝ `AP 0`RPV UAP@ddQ@- 0AS Q0B \ R@ P0Q 0R P R  p@-@P0S pP HP\ ӎP,00,0pPPp,0/A-M@(A`PᘀU( ᳎,0 , O 0 8ЍA蝏0S 0S  P AP` `00# d d00# h h00# l l00# , p*`z( p,00,0,0 0  嘏ЍddS*A-@,0 p`0,0uPQjQU 0S   jaAdjPT=j1S! 1! 01_oj01D_ApddO-R @@QPEMPp 0`Eߍ调 -0SS/`H0STS S6 HP`P\;(, )0S00 WP@ 0R R(6WP-0S3:0S *$ `@0V x:0S l*px0| RSD:0S . |$*,|0x$T`[T T 0SX0S `PH0S 0S P`PԀ `q_@P7`b 01X00X95P9` /3 P00000C^9 /H0S 0S  PtP H)0S  0cP x(h0s0  L(0 00 s0  (0 0d0 8Q00 00 hP 70S000d0 007 .[ Z 0SR V ^dh&D  P&XX H0V40bD00S  ~hP V 366(0RP V g^`h`\0S AoS=SB/1Ao `] h3S  P810 y 5S0 ?`P'50S . 0%0000C#`V U`1S A?SB?11ASB/1 ^h1ടS 0 ahğh``L` dxDH\VPDWP  LP- M4 D00X00084`  1P0 ?P30S  .0000#0H0U  ᗅHP dg1XS 0 .hX <3@# 8D0P0 >P20S  .0000"0" 20L00 M0[0UP>DхP  Pg Dž4 D00X000 2`  1~P0 >Py g1S 0 gDP 1(0,0<,0=gP d` `0 81  pQ>W* PQ>1pU D G`LY  @\Mg1S 0 g{H0U ׄHPX<P $0S(PVx4kg[ԥbb@(AlAAcbdd;{+ddb @èA8@dd@-p@`v0P p@L Ѝ@-@fx @8gp@-dP@f0SA?C p@@+g!R1S A?CSP dddd@-@D P0QQ  00S 0R  4Q DA-@p`$P@P Y\$A-Pp~$A``P@  `P U[$p0S Addp@-`DP@Tp0S  PUP $4RPD@A-@p`;$P@P \V$p@-0PS0S0S 0S, 0S00S% $A gP@5$p`00#d00#h00# l 00#$pAIddp@-P#A`h8@PT$p `P0 #pA(@dd 0 S 0#/00P/Qp@-@p@ H P @0!S p00k01pA@SRG-M!p4PQ@ $Q !BQ -P,    R: R7 RR3 RR/`V,Yd @4Ya 1CY0`9  $ P1PЍ@X$ (0S,0S0 $Pp H 8)H %Y0X0 0\00S d Y 0t0 0x0 $Yh00^00008 900P 09*  `F $$0 0$0 (0$0(0 ,00,0 000 00&P"D3P`1P#!Y  $0S D!Z  S0 $00 000 000 00 0P1XY p H3 8 X H/ d ~d z00"08 t0 X m'RPP#0  bRP P u00 dAiikii O-pP9PQ@`M #49Q 6C0CQ 5CojuPiku( iJi(i? i i Ni0Kiǯ> ~$niji ߖ>> i i %i ix@ccdcQi Ti >!i O-O낏D pP@`dUT D @QP6W@R@ Ѝ0S0 0SpDPN PT v0 `0 00`S`$4R@@00S0 0S@DR  4Q b80S/G-3`A0ASHMpaDP@$$$TzHЍ00S/Wm0 000S''aP# 0000S .` c  00 002 F!PVDt@0㺐bbb`@EA@-@@@G-HM`CpDPM@耟萟蠟T ;|1S  00 0HЍ00S!V G00S .`  00000pPVD@bo@^A@-@|1@RjQAp@-P` @P@ P @pp@-`VPVV:M i0@0L0`0D00@0 0<0(080,040D00040,000i@pV*8V*U*W*`X*S*0T*`T*p@-P@"j0@`0`A;`VV Mp@Ve0008C00 0/p@- P@!>00000p0 @-@     @-@ M Ѝp@-@)VP@VPp@-@0Q$MG 'R`l P'RX("($( t  0Sp*00S-0000010S00S"!10!0!0!0!0 0$Ѝ@S000CS0pS000CS1vAAA-`@P200SD0CSpW"Op/o"\ R\ Q  ^ SPR `P H000S D0C40GS SV`##S@ &S0F0 P  P V =0 #   o`ЍGS S %SV000 00 00 00 00 00000V0S  0000ꄥbbQRI p@-`@M 0 C^.^ P?R1  000 C0PU'X X  X XX9 u`0 0<000 LP`ЍpA ER PPC/C-40@SOM p S|1 0 0 0|1 00 0Oߍ R@D  Q *40S $0OߍCS S #3R t40S h$l0|1 0 0; HT, `P2   W4Bύa`a`001411 0``1gP t30S 0t#t;|10 0(0 ST# 21 2L PP ` 2P<2034P09zP 20S 0"WT iPOX20S p0h"lp,20S 0008"@000000 00000000 KP1B110 0141P /P d10S 0!# 2) p\10$0$PU!X `C`Ǽ(1(` Ҽ`<<0@ 0000 0S 0 1(0(P~_EU T P0 <00S P0L xPluLQSb @̩AA@@@+A@b/@jAA(A@8@_AA"eddAªA@-@ QQ4 @.8\]*0O-,00(p S@(M @P 0<S{@P 0R 0 04a(!#2"$a$"1  0~`P 0 K8p#<40h8( #T0hT%S@ 00S 0 0000000 0S/00S 1 10<000 p0%X00#8S 0T00S OPd01@ R S 0S0S0S d0OP 00aT  @P 0P0Ѝ b@p@-0 MS P Ѝp@8`<P 0S$ 0R xxPPxPP0S0S0s!.0P,xPxP .PS0S 0 @@8xO-pPMHhᰤX$ &h*D $ 0 0 H+0!  D! # " H0,&$$$H( "( 0 ATX $ R  0 8/Ѝ R5&R2& R/ R R R R#  P R R R R  P 0 Sr 0[sd   @0O-M0 00S PЍ0`S0S/P0S' 0@S(00S 00x4pDPP 0S 0S0sd0 0S0S0S0S090s 0S0S0s X3# 21 208S" 00$`0D `0 0 X0Pp`0Q0W0S `DP P 0S0s`V tf!>7l0吠 x0(0t 000fbpP 0S10 0 P`0 @4`8`c3 L4`Qz ZDMP 0,%S 0S0S0S0 0`pPe0b0S0S 0sS0SQH 56l0S (0t00L0|0 t7P -Pg 00000SP R46c(#"c 0 V O 5 0S10 0q rP P1P0P b@bbO-hp&h &TT$M 0X ' "%X " A  T0zS) PAQTI$Ѝ R R d  &R&R Rzd   0P 0C @ a018E 0AT 0S0S d0 6S 6Sd0  P @0S0S d0 6S 6S Z d0  P @0S 0S   0S0@@P@0S/ 0@-S0S   Q Q> (0# ,0# 0#.$$ ("(0  !R   0 1(0# ,0# 0#.$$("(0 0 (0# ,0# 0#.$$("(0 0 10)0# F0# ,0#.$$$("(. 0  " " "0  !R   0 1)0# F0# ,0#.$$$("(. 0  " " "0 0 )0# F0# ,0#.$$$("(. 0  " " "C-0@SPM0S0s  0 0h!0 Ѝ0:0haPP U,\PMQPJHU"PPpW\PQÅUp50\S0CT* S 5 A%CQÅQpÅpRQP'rpÅ0W0pRSpp5U0Y0pRS'p5U0Y0pRSpp5U0Y0SP:0īAф@p@-@08M S8Ѝp@yP`.t "448 #8008ЍpΫA 0 /ᨥbUx@@- @(㬟TH)R(ED%>A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00ddG-PQ Mp@( Z% 0S B/`w`0d 0 `0d @@ ЍP 0t@P; 4``( H.P# P0S 0S0s  g 0 t@P.UA`/00AVX H0S |1 X0\0X0\.t>t@PA`0 0 0 *U` `0S  TR H0R SX |1 X0\0X0\s@edO-7M #p 21, 20P@00Lt@S0 0 0[`S$ 0S! P MPPP Pt0L 6@P t0 H0 GMt P40@B A@3@Lts0\00C?o20S MPP@ 0S 0P 0SZ 0`VV 0S0S0S 0SJ  tw<6|pU7t)JP*1@L0 U RGP qLt0 L0 P?P @@P 0S ^Lx5,# 2!1 2Ѝ@@0`SPW 0S0S0S 0S @U 8 @@P80(04$0H00pH` 00VAoFVWD$ D P i@PcD0( R_t`03| 000SQ @ tQ@PK < tK@PE@ <0RA0>30S q 3 #0 0 BQ/:` PhPp`p$W 0SPW? T?00CS0  0CS Y00@S 00@S1L0L`V AoF 0  0ZSq t2 #0 0 BQ :p H2 #0 0 BP:q  #0 0 BQ *q #0 0 BQ* 0R-S0S0<0s0 X 0<< R<R R | rP! Q RSSR R QR  #  R} P00P00uY 0> 0S 0XG X Pp_R 00S@X\@bddbcbP P/Q|1 00/bp@-@PL0@ 8Pq P H@qpp@bp@-d0,`P( 0 0@M 0  0"` `P P"(PP d03d010!"446Ѝp(0 @-HL H  < ddC-騁M@s`W0ʀ 0! #t!0 l!d!  , !Q#PTPV  R0S  R0T@ @ @H@T0 SPPPPPU 0 0! s0 |  , !ЍQ H0R:H ttP0H000H00@@bxddddd10SR@-LMPH `<0sLЍ$vP0 p R0 $1aUH@T P ,$P" @TPUFPH )@L00PLP nPP ,$gP @-/0U0L0 ꔊmuHdd0-A-@q`_M@P@0D 0 T@0D  0 0 0 T |1 80<080<0p @0/S0! x f?!0Hp .  U. XPPT0D@@004 @p _ߍAЍ/@edbȥbcĎAA0O-,00\M` p"0S( 0S  0S0S0S5 0S0 z@5 00!5 008P40,`(p$@@ @'l5 00!\5 008P40,`(p$@@ @0 400!505 0<008P0,`(p$@ @ @'0404 00!4 008P0,`(p$@@ @l4 00!\4 008P40,`(p$@@ @˗ 0!40<D 008P40,`(p$@ @@ @峗 0!30300 0 0 I*0#X A/0 0 0 :k"X R `q0 0 0 $+0 0CM 0   !$$("( HX@000P @ 0b"!b! R 0 0 0 ,0Q*P 000,0 0CꫠA@edO-?MBI?;^`P?ЍOxI0CPPhO <,0 <,k|10 0 0B( `elP h 0 H R> 9)0 9)|1 000p0 0 0 { 0N H>(   k RJX0 0 0 c|1 0 00 0PBC9)0 9)R @ 7=02F?! !2S'2$8(0 8(8(0 8(0'S(j0`Q 0 0 0 |1 0 00 1Q QP P$P P \| Q\ |0 0 0 |1 0$0 0$  G 0S70S .p`G .C'p`0<,0 <,\P70S C` P 0P0 0P0%  WjP  _fP  if h0  4P \g0 0 0 rW0`0000 p0S"`[J0 0 0 U|1 80<0<80|1 0 000  oA0)S(0 (0jP+ 0Q*Pr00" @,0s (50S `0(( AR *D0 0 0 |1 0040004 D0 0 0 (0Q Q0(0 C%e0S%44 0S   P f@0D 0 @0D +Y@0D 0 @0D Y  f0 S M_ 0Ps0 R R r  R R 0s0 0 0 |1 0$0 0$>~P0T 0 P0T  0S |1 @0D0@0DV nf`vhh0S   S V9)0 9)L 0( (0RG0 0 0 R|1 0040004p+TX |1 0 00 (0 0 0 ,TV`, 00@ ! 0(3/ P@P  PP(QQ Q$`00  XP P!<,0 <,PQ e?c@ede"e?cbb@fAbAb|@O-p(0P` @M w}@00`Sd0  m32. 0)0@P@d0 0/ 0)03P@d0 0 1b"!4b4##:0= )0 P@d0& 0 R"(`P Aq0 0 0 ЍOz00Q f)01 P@fd0? (0Z +0JS7 33 `P 3Z0 S3Z Z +Z ЍOf<Zd0)02   fd0 )03 ᴁP@Ѝ@edR/A- M 0(P`0 2pP)0,  ᔁ@P 0 ~P}bf Ѝ1M  q}@-(Q0 'QPtt,p`0(@TD Ѝ0 b,W0 03W0011p@@A@-`P,Mp05(0PS3R!(RR S: 0 bW0000;) B R* *<** * * * * * *4*<RQ'S 0( |b(W00,Ѝ@S: 0 ob0<SW00 S: 0 _bW0000(0S@As@-PS0`@0P00PT @ @Ѝpp@-0P@31 01  p@<@ed-$M840, (  0 Z$ЍHfdO- CQ| p0S Y0 0S0Aᩦ ЍOC @T `V x0S 0CSx00`0[e0s9V80< 0800U < 0C0E00d9ꔰeLfdbp*kdp@-@PP `0 Q}P Mp F|pv|(ep 0!< 04 0 (   !/@bxddd\ P/0 !8 0 0 (  , !/@bxdddO-pP#`PlM73Q 85<085p0<t0p0Pt@lЍp7#0S 5S @@@0(  gPPH 0'S 0 3SH0L0S(dPP6 0dS lS3 d@0p00&+ \Q% L0 t&0$ dR lR! 5%0 %L 59Ph5l%0 h5l%7@<p00@ 0T결pT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  0@P 0@Pd@C T0 0 0 I $Ϡ  0 $4 0 4: 1<02 0L8#8CQ ##,3)$ ,/P Dv0 0 0 0@`0008#Q#(( </P $0R (0R(0, 0(080 , 0< 800 < c 0(@@004 0 004 K`P "0 00(00fP c0  Q:HLQ6RH0P0H0 0AaT cP (@(@@<2P@TL00 0R 600@@@ Ѝ8 #8pW  0 x0 ?@pWp5`a5 pꨦb2iHfd(ndLgdld@O-0`lSPM 8x Rd0CS+ + + +8 +d++`+|u@P'0S00:S|0S*@7 R WDA+,WEjt7t'W0S0AuЍЍOU Lu@P?Y c0SP@8PP N0" 6RP  0303420K9N0 30P""##4 R00Ǒ3SvL6|0@6@4| @? X @ |]u@P@\ |Su@P 0e0# 0# 0# 0# 0# 0# 0#015 %0 5 %[5%T0 5%0@@$0@$0@$0@$0@$0@$0@$@1Qq\ P $@P0S  PD $P>0S; [( . L. 0 0;00>|;<3 0&&'0 x000C0吰[PU[g0Q@U/4P< 7@0Q0  2!` :4 @P" $:P|;<3x0S00C0xP |@@;<@30 &&'xPP`10 @\ |Ht@P|L$@(0@$,0@$00@$T0@$X0@$@$@$`1@A1QqU}1@c $P $T@P0S! pP|t@PL|0St 5G@E @C-@A0@?o;<3K2003ꨦbHfdbp*(ndldíA@1iЭAAA-`0S@Pp唀0 S 0x̀ R 0 S030SVPQ R PU ꨦb(ndLfdO-` MR0Ѝ0@S000CS0 B S7 0S40S10S.U@0D 0 @0D x5xşxU @0/S0 .   .P@P$ 6@P0 p0 T0# 0# 0# 0# 0# 0#$ 0#015 %0 5 %X5%|0 50%$%0 0$%2PK a`P 2C P $P0S 0'S 0 3SH0L0S(^`P 00# 0# 0# 0# 0# 0#$ 0#0010 0X c2P |2_^6705 ~P $x0P R0( `P \2?^ 2XTP00ph0dS lS5 H2+^ D2000 002 08#8Q XdQ  lQ0 P Ph5l%0 h5l%<0 0 @0 0HQ5% 0 % 5a 0@$0x00 000030Q10吠@0@`0Q0 D   00 D1] 0 P ЍO@edbȥbcĎA AHfdXkdb(nd@AO-B0`00 0 0 (ppGW 0 0 0 s]"/W0 0RPP 0_P 0 RPP80 0 0  ЍU 0  R 0 0 0 0S00 gP 0 0 0  [@ 0$ 0 0$  0R*`-/W0 0 0 (0, 0 (0, 00`S 0S 00 B_@P{ Y0<< 0qF@  #HfdAb(nd@03 "  /@bA-0@(S`p!YPP\7Y(Y( 0(0C00(00@ 刽@@A-0@0t0Pt00`0x0x0|0|00S 0PN 000S 0P@  [80S ppqy0P81  8L<0S ppqj0P<"  <=p0S ppq[0Pp  p.@PppqL0P@  @P ]0P Y08P U0<P Q0pP M0@P I07A-`pPcX@P UX0Y7VP  @-l 0/G- @XPp ^`P @{<,0 <,[|10 0 [2`3 0  G@ed7@-0@ Q)R*SP SKpP 0sS :R0S Ѝ000:Sxo@- @00t0x0|0qp@-``.Q00S@P P /00/U00S00=U00S0t00U00S ZP /001U00S 8P /080#U00S <P w/0<03U00S @P l/0H@0Y2U`VppP `/0p0pA-p@`0 ,0P(4# G Rğ)R&X%+&+&+&+&+&+&+ &+&+&+&+`"+#+#+$+X%+%+&+&+&+&+&+&+#+&+&+#+8&+h&+T @Ѝ R  R  R  R R @T. Q00S 0S0S0S 0S0S @2P@0S  娻.P7@ST  Q @T0t0@T0  R0 000 0 00P@T0x T0T R/@S0S 0S0S0S{ 0Sx 2%@Ps0y.P  Lf0 000 0 00UpPT1= TU 00TQ1X.P8  +@D0 000 0 0030PT T3 T၁.#W<@ 2W@p@/.Pc  XT3T0@ST@@x0 T Q0 R000TT0 R|0L*@ b@-@0PS`pM-P7 J0ES* ,0 00000(000Ѝp@-P`-@P / $P -@p@-@P+@-G-hMP pሠ6n@P0S( 0$0 @@@0 0P @ P 2P@9hЍRsZ c0S @( @0 ,0" r!.$  ,00( $@XP@@W`P H0 1@W@XZ 0(<$0G-pH pMS@P  )S *@ `FVP P @pMb@pЍpgaP[ P @00F<S<++)+)+)+)+.+.+.+.+.+2+)+)+<3+)+)+)+)+)+)+)+)+)+<++)+<++)+)+)+)+)+@.+<++<++<++ ++ ++ ++.+<++)+)+@.+<++@.+@.+@.+@.+)+)+)+)+)+<++-+)+)+.+.+.+<++0 000 0 00@P_m@P9V,VV0  R0`FV񟗙h-+)+(-+)+)+)+)+)+)+X,+,+ -+,+,+,+)+D-+)+)+)+x,+)+)+)+)+)+)+)+)+)+-+@Vx+0 @@0 0@Pa d0R55 d0R88 d0S /0J d0R88d0O d0R77  d0R77  d0R66  d0R66  d0R33 Y  d0R11 6S0S 0S0S0S d0R99  d0R55  Pl@P/ 0:Pl@P# 0 ,P l@P %,  0@`@`T +@P 0:@`0`0000 0CS/+/+(0+X0+1+ P]lP`PP  y/P 0)3S10" 0S200S@T9 0R;0S8@T5+@1P6lPP0  R00s800 lP0S0ĕ8# 21 20 000P $0 P @E$ (00 ,0s p_ P/ Q 3S100 $L#P` pV0 $e P 0S 0 000S $hP `4` kPr4 800<0spb_fDP  .P O Q #PNp WJ X 0X 1P pD\8l6XpTP0X6Ph\"P2-0Jvk@P0S S Sd04Td044Pd044L_k@P 0F<S񟗆d4+)+)+)+)+t8+t8+t8+t8+t8+d4+)+)+8+)+)+)+)+)+)+)+)+)+d4+)+d4+)+)+)+)+)+6+d4+d4+d4+d4+d4+d4+6+d4+5+)+6+)+6+6+6+6+)+)+)+)+)+d4+6+)+)+6+6+6+d4++V* VV0@ TjL`FV5+4+4+4+4+4+4+4+4+4+4+4+4+5+4+5+4+4+4+4+4+4+\5+d5+p5+85+D5+P5+4+|5+9V( @Vd0;0d0C9d09d0:6d08d0C:d0?0d0=d07d000d0C;19@ 388`40! A0y>O-UM 0?@< D# 210 2@ 3 700 UX.0S000S 0000S0 000S@0@@TI @`P0@0A 9`0d 0 `0d D0@08Q<Q@Q#pQ   !i`P   !a`P TTTT  !P`P   !H`P @(pPp( GR(p:Z`P0@0 `0d 0 `0d @`@0VP&PP> 00`=0 0 0G<}c# !tct' q (0@0(0000@SR ZF 0$ 3SH L0SP0\ 0<[ TPP P0 T`0d 7`0 `0d t< 0CS00S 0000 0008#<40 0@ 00 <000S0  Z  0 000 00Q Z < 0Q Z +  @ (@{3TH0@@0T !`0d 0 `0d +` P @0S 0S0S 0 000 P0 0 -`@qS0S P0 0 0 X0\ 0 X0\ <Q0( γ<<0X0 @0SH0<0t0S)0s0Sx1S09000@09000S" 00< D0!`PP:D0H0+!(     R  b> h8 4b:#00X 0Sx1S s+P DP@U<Q`P u`0d 0 `0d p 0`000T00S |1 P0T0P0TD0S @ DL Q@ D P1%P pgE`0d 0 `0d `O?.dp H Pa60.PV H0RRtp H {PHp60pP= H0R93_V]h d00l 0p 0U  5Jύ.0O'PC Ԑ@  Jύt0'oᩒ]Y1 x50S .d _<53P%P41d00>Tu`0d 0 `0d U |1 X0\0X0\Y1`PoPlD0 `S 4 R000<0R00o @ 0<01 S@<0SD 04Jύ$ 1T0 P08PP T`H00Y@  Yp33:$ R*X `d0D0S cP Y 0X x0S 0SX x0S 0S (0@ 1P>LPpm0 @dB`P@0S~s*<,0 <,5pU@ T0<<0 |1 0003Sb 0 0 0 T |1 X0\0X0\3`@P x1S 0S  @T0S 30SR00SN 1 0R00S  @ P @CQD<O<0PO([ (0VUߍT@Vfd X ( ,0 < `` W` `0 0 0 (`S  R$  / P *$ PxP0<10.xJ@bmAbb @ADfdbLbؤbe@edV W? R  S RF 0`0P @ $(  $@1,``0 3  00S 00S w@ ,000,0 $00 p\S $a 0 0 0 +` Y*`a0 0 0 Tq |1 h0l0h0lh00S p0(00c0,pG1Y pppW@00(00S1 0  , @,00 #  `" R t20S @ ,000,0@8#8 0 0C40 0XT, |1 `0d0`0d#0S ,0R  0    0pLP@#Dc`0d 0 `0d 7`0 @0pP@PWcp0t 0 p0t 0 0048900(0@0 ( $   $ (@0S0  RP 0Y    @P 80KP  80  0 0H8#<48Q#80¡0<pC0±00,000 040 8#<4$ 00 QPs @0 0S @唕  ( 0x0| 0 x0| T |1 p0t0p0t*W`Ipl0P @ $(  $^D000@ Cp@`CDOf0 0 0 U |1 X0\0X0\A`00 #O ,P/80< S001R  ! @0pS001P0/03 "  /@bQ/C-@M 0(pP }`Po T0P4`00 <08PP= @` @0P4`8@Ѝb@B(0s/@-@$RU@! T0(0@cO-2LV $T"( @0(0 K0( ` :      X V1`00PSV $#" W ( :0/0W 002Q100000S001 01  W |1 000Y|1 0!  ! hT0 0?oP  2)4LTj1!0 1!@b@ddb@c(~d0@-M@ P0 P0 (0$0P 00(00$0Ѝ0 & $00శ0($0H@b@-@HT(0s 0(0$0S@OT @cO-QDM0t@4pS(2# 21 2!&`P .T0DЍWp2 0 0S$% T0$ D0CS "RH0,0,0f20@T D@DTP00S H00@P,"! r`00YG i0$000$ R0 pp0P0  ip0P P,0!$ 4DS0P 0 0 0 Qp0P PP$p@c@bL0 8(M | ЍBS(~d@cp@-PBTp )P @@-`@4MP 0S   1pP P0 P$0S  P 0   pp0p0 X,p*0@P(0@CS R4ЍH@@2i@c@-@ 00CS 0@p@-@PRp@S@cO-TMp@<%PP<  0R%* ,0NP , 0R@%*LQ@TP0S S HLUTЍ3 00$ 0( 0 0SX2,  P0#dd$]RhB&hT{ 0   0>P0' $ $ R!   $ (   )PV 00 0* 70$0 00CS 0@(0s ᶴ0*#30(0{ 0 4Q0 ^R80SQ0SZ=9Q = ?B3c/2"V:`@`o0Sl\Q@P 00 0 0$`0CS 0,RUꫠAddH@@cMbbC-0P`0D$MpQ~@P 00 06h@P700/ 0 00@(0 `喌 2S0@0B00 @ )P ፌ0S   l@8Q$ЍX(0$0K:@cHW+1ip@-@P(mQ%P p@Q@cp@-@P,`\Q@QTp@c@-@<MQP @T00 =@Q@c:Q@cQ@cP@- P $CS0 %2000#5T0?0000 P!10@T ~ODTebde+~d"eb@-4 R0R 0 0U1 Ѝܥbf+0S!p@-P%0@6S P `P6S0066\P00C0p/@-0@0,M`S6S 6Q0C?o20S 6,Ѝ@0@ Ѝ0@7Ħb@@c~d~d8@|i+A~d @Abde+Pe+p@-P@0@0d000?00:<0?00 0400S 40S3 !0 0p0ub0p@-P P@CU0 @@@D@H @Pp@0S/G-@`Qqԁ@ R HQD0PP !DY>Q%C 0 0 0 /P 01 0S@00@H00C Q6p+p+q+p+p+|q+|q+|q+|q+|q+|q+|q+|q+p+Q! D R  A 0L S H0`S@A 0 0 0 D0S < H%D R  H0S 꼦b$ @BAddA{AQ|Q/P/.p@-@P p@ \]*0@-@PX0$M @JM|1U0 3/PM$Ѝ0p@-0 M @`"CP*M|1 0@4/@tMU CT06 Ѝpp@-0@SP M 00S]P  P0@o Ѝp`5P 0U P .MB0P 4   H RBB0P/@- Hh@5C-|1@`d2pPMm 0CPI 0PO 7C0CPVP P0PPЍ2P$ 7C 0CP# 0PQ P1P 0P,0S0PU 0U PC0%U?0040 0S0$p8 ⹦0-00,0000 0 0$0000000 000S0PU 0U P0%U?0040PUP `0 PP PP 6(06 06$0X0\  0 , Ѐ( 0S`0,0uLysi WiHliHc@cC-@P0,M 00px0嬀P`0PPTPx0P$PYLVLx00Cx0,Ѝ PP 0 `O-Ѝt3 04 0 0$00 $0 Pc Ho?@34`,0  `H0,0DKPU 20S  .p"p0 `@(0 0(0000@0@00 A0Be U0X 0 0S0W<002101@0` 0(00XPP00 YSV P n`0,`20 Y3P 5`(0  ``0(00 00@⼠0a@0A` 5 B `(44( :00b000Y0``H 2W |1 000|1 000H@P4T$0 P4T$H>ebW @YAddA-0 p003A0AS@`{}PE%DP 0  P` Ѝ@-P8eddbs @YAO-`OM p0007`00@P pt`&S>$ 0R 0@P  0RXV 8$(0 8$(`Oߍ@0   PP0S |& R p. ⸀0-. )  00&0pq"0( 0, 0 6R40S80S<0S$ 50S %5P0QPt50S  .00L%\0@0S(50S %0 JP40SX $S쀝0XSF 0SCpW@0X?o20S9 p40S `$|lPT0S . 0,$L_0S .0 0# S0S .@ #0GSC 0 0 0 00@ t 0pP"t3p0pw9P 40P 000St ⓴pP 0P00 a9W 0԰P0X 50 00 S 20S @ .J6500h"0 5P 820S ."H0 0$(0,000 QX 40" A  Q- 00C?ot20 p$0( pp,p.1帀 0P2 PRP  0 R 0@ NV Q 00 0S Dp0 0  0p0S0 000 S00 00 @0 @ GbAddb @AA$ANAAmAAAAAҳAH@d  jdG-0P8M ` .t 0 0-8Ѝ` R008ЍGI 03 X˻xq@F `P ~T X8ЍGT s.` < 00 9}P90`` 00``0@0@0S `p.` `0 pY 0h |1` 000H @a}<10 $ AbdMAb @AbMb<+dp@-@D 6PPp@ p@dO-@Mp`,'PP- 0S # Ro @` .pp0.   0"m[X XC P~20S "\,};/ 00$ 0( 0  0R p0=P pp 0R>P FLA 8$(0 8$(,Ѝ0S00S x10S .@VX!h@0XaT!XP10    0R  0v=P p 0RP F =| R 50 00Sa  l00S .@pXl005 `FLX, @0W`0 00*`b @AAAddAAkAA-/1 -$01019/@/-/-/-$M840, (  0%/$Ѝd@-@::-@-p0`0d 0@0S P(00   0NU7( 0RP(Q|:P x:L@(0, 0 (0,  Ѝ1M  }Qd@-v@-兼@-80@0SmP 600@+갦b@-@Q@-Q-/p@-@8P8`?B8|upe d@-0SP0`000S1P Ѝ~S 0@S0mPP0S 0S0s 0pS 0S 0S 0S@!0P 0 1P"e b-/ 0!< 04 0 (   !/@bxddd0O-LM0\1`0 0 0SO ~SM 0PS/@>0S@:00 1  @P0# 21 2$0 040p0p 80#@P0P 0Q0[0S$0`P  # 2!1 2LЍ YP @1@"e b@b 0O-`@p\DM!t! 0  0,p(`$  @Pc 0!(! 0  40,p(`$  @Pc 04 0! 0   8 0,p(`$ Plc 0!| 0 t   8 4@0,p(`$ PUc  8b DЍ莣AAdu)PA+/BO-Ls`4Mp0 0 0 z30,hPP0 @ 0M 84Ѝ0SD0S S?0S0S0S0S  ۟P-0S0S0S0S  ɟP0s. "0 0 0 - (0Q0 0 0 @TU 0` 0CCP LPU ;P 0 P0 0 0 0  ׾ 0$ 0 0$ ;Y D8@ȾP0T 0S P0T Ӿh!P@P?Tp |1" 0"10 d@ed0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0P Q Ao `0 0 0H Ѝ@0(p0p/@ dp*@O-M0(000406#@ 21, 20PS`  0 P  VPP00 Tr"`10`6 p`P000$000:S0` 0#0S7@P70S Py74< 5,  2 "1 2Ѝ00`0 00 #R3H L R/QH0 P0H0 00B'S$0( B (00T 0p(0(0(080(00 0<0040000 80P -7 (/7@4$0Q00S000`00040<404000:Sp P pw 0SC0CS@:0(p3 80"7@Pg ( 0´ 807@PZ 08 80 P  ( 00:S80S% |VV F|P"ꔴ++Դ+ Q ++<+`+++̵+++8+F QB`'1011 R|1000000000000|1000|1000|1000|1101|10  |1000|1000|1000~|1000u|1000l8@啼0040004mT@b bdddp@-`1@P M R8@  0 0 @ ЍpR 0S 0S @9@U 5/@7@-Q@T0 QP   lI Ѝ0P 7JP0S)T   Ѝ0@M@iTdTT Ѝ0@k@DT\ Ѝ0@\ Ѝ0@- A-PpP00 00000\@P& cVʀ0!ԃ 0     !0 0sO@Ph$@P lЍh0Pp0 ' 巕@bxdddbb ds@-@P` 0R0%0 * 0}7P  0Q0%0 *S @噻0 0 0 夻x R  ! Ѝp@`偻0 0 0 医 0ⶢꫠA@ed@ bHd@-@@" " @-0@S00S SS000C0S@  0P0S @@0S0S0S R @-01/Hdp@-@PTQp@P 0S 00S pS 000CSh` Pp D@pp@-0PS8M  .~00 060S 00S S 000CS DDH$HT -` PK8ЍpG@ @A@-@,P P @0S00S 8#<S000CS/@-|1`SA5,IAMArqO- lؽ@`pXQ40PU O;v(:40}00000Y40  000C00k Y0  R 刷Y8P B;0 40U { v 0S Z00 u Pw 0SY ^40;40UA$cp@- 0@S 0@008`D0VP 0S 'p PP`p@- 0@S 8PU 0Spp@ Pp@- 0@S 0@008PD0U 0Spp@  }Pp@- 0@S 8PU 0Spp@  hP!p@-!YP!UDRHps@-PQ@ `F"P 0? @=Ѝp}AAA-0P@P0`3/㏽ p03/ㇽ03/ぽpWA-`P0@p3/s0F`c0PP03/f03/_03/Y`A-@Pp`0 0  0 003/6 03/.03/(03/ 0p03/03/`hW&h03/ 0` 03/03/X03/Wp0`A-@Pp`L0 c0 ^ 0Y 0T0 O!0J03/üp@-頇@(0D$003/$0 (03/P(0vop00S/LbA@-@lP,00,0$0( @0/@-@\P(0(0@KA-`P`pH@P   03/@P0 @cAG-hP`p@P*@P L@0 4/@@10 @cAA-PMp@P`0X  D P00@PЍ O XO0 D P   O0 p͹@LbA˸AA-0@(P 40,0Lp( #3R` ` @`Qm0 7/(0L`嫆< 6/,0: 0,0 1 0 ?<<#QB#/ ` @k 3 k0  R= 080#8S>n|0 7/,0@ 3jl (0lLpl0 0,00 <0UbbAp,A-@( 0  R    RA~ ` p  ۺP ,]@[  [Li+0 8/,0@ (0LP 0 5/(0LP0 A/p"@A7@-@(0HP  05/0<0(0LP0 5/040 Ѝ07@-(0$ -  @ Q 4 Ѝ0HP݅ 05/(0HPՅ0 5/04 0R408 Sps@-,0@9!;0(0LP岅 05/}_(0H`婅0 6/0SPU 0S , P(0L`唅0 ;6/Ѝpp@-,0@9,8,8,9,S8  0"S4 ЍpS  0"S (0HPz 05/(0LPz0 ;5/$03 (0H`z 06/0V>00(0L`z 06/!S  0"Sxp@-PP h&@G-Pzp@`@嘯  0<0

, 0"S 0"S (0HPy 05/(0LP|y0 ;5/ Ѝ0$03  0"Ssp@-KP &@A- 0pP(@@pD0(0 `HOy 08/(0HGy 08/0@00@0(0Hp:y0 7/0  D00D00@0Ѝ D #D  0+ 0 D0 (0H`y 06/(0H`y 06/ D0 R60 R R6 0R R6060D06G-Pyp@`-  Ů<0p 00$pp0(`0,0$003/(00Hx0 8/3 03Go&@AAp@-@(0LPx0p@ /7@-P B@ 0RA,8A,A,A, 0"S)) 0"S (0HPx 05/(0LPx0 ;5/ Ѝ0$03 " 0"Sp@-YP &@G-Pxp@`I塭  9<0Hp 000 0C2?000$pp00(`0,0 $003/(00H6x0 8/3 03:G&@AAA- 0pP(@@pD0(0 `Hx 08/(0Hx 08/0@00@0(0Hpx0 7/0  D00D00@0Ѝ D #D  & 0 D00 (0H`w 06/ D00Q00D0D066D0 D00D007@-P B@ 0RPE,D,D,pE, 0"SAA 0"S (0HPw 05/(0LPw0 ;5/ Ѝ0$03 : 0"Sp@-qP ('@A- 0pP(@@pD0(0 `Huw 08/0@00@0(0Hphw0 7/0  D00D00@0Ѝ D #D  0 0 D00 (0H`Jw 06/ D0  0  0D066D00D0G-PSwp@`j  <0$p 00$pp0(`0,0$003/(00H w0 8/3 03G('@AA7@-P B@ 0RH,H,G,H, 0"Sss 0"S (0HPv 05/(0LPv0 ;5/ Ѝ0$03 l 0"Sp/A-Ppv@`唬p<0 00(`00$00,0< R AtDp0,0i$003/(00Hv0 8/3 03A5ꕹAAX'@Ap@-@(0LP{v1SB@-P@i0`(0PS 0S00ppi 0 0000 R0S @k`di0@DJ_i 00 @$ Ѝ贀d)@cs@-@`yiP@Ei0 0000 'Ѝpp@-P@D`0SpQYP@XiP pH8cQ @- /AC-@ 0P`p0 ?(000 9/HPH`0S,0,0S  R 2/0`0 Ѝ贀dcbC-@ 0P`p0 (000 9/HPH`0S,0,0S  R 2/0`0 Ѝ贀dcb0 , /ᴀdcs@-@Ph40 000`0 6/ЍpG-PMpPt `p0P@ 04/p@2VY ('17V1 7C0CV7 0( 0@@ @0000 @PЍ2V 0tp 0PЍG/1Vk 0CV1V 70V@0S R  0CPS 00 0@+*R T R 0(0Ѝp@/0 R ` 6/@TЍp0@D( 02/A-P`pfu@ UF01SD  |40S 00Su0 00P4P00 0000S  R h R  A@@ 04/#P  관dt,@-@]f4QT T@0 R@ /P/p@-0@SP` 0P`4 R   p03/P p 0R  4Q000//?o2\0S//Q1S ///40S0/qA-P,@`p400S0T0S0 @QpW 40`S@ 0< 0 000@S @  @A@-@e40ST   @@A,A- @!PU`e0S8 S 0AT 0S 0S p`003/s0S 03/0 R   2/8000S 0  2/ 00 0H8cdp@-8P@0S0T0pP00관d0 0$/ᘩbd0 0 0$0/ᘩbdp@-PEePR`Pp9VP@0P9V p@#p#A 0     R [$X(\,Y0]4Z< @ 8D 0/0 0 /  $ p@-p0`P@ P p@^P000PU P@T ^P$b,0 0S/ R  B /0$b@-@`0, @0 0 S0  0 0$b0bX0 0S/ R P  R   00/0/$b8- 0000 0dp@-@PH P` 0H0 00P0000000pdC-0`pP 0@5/pV 0 0 ЍC/0 CR3,,$,,,p,,<0S0C 0 P0PEPE0cUP!009/000P 05/0S0C0 P 5/0 0S0: 0 0CR 2 5: P 5/0  P0A5/ P/d; S 0 0//dQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0`(0, 06/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q" 0Q0 .0 /<AQꬖ,T,,T,T,,,0 .0!0 .00 .00 .0/5Q0 .0!//A-3A@Q꬗,,(,,4,,d0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0V:P 0Up%p%*`Pp@-0@000\P 0\0`P 0`0P }00P w00P q00P k00P e000T@] d\Q@- /6Q@-/%QJ 4A0&S2&Q/ꠚ,̚,,,Ě,Ě,Ě,Ě,Ě, ,Ě,Ě,Ě,,Ě,̚,Ě,,Ě,Ě,,Ě,Ě,,Ě,Ě,Ě,Ě,Ě,ܚ,Ԛ,Ě,Ě,Ě,Ě,Ě,Ě,,,@-0 .0!/   /9Q/Q$Q !0AS h00 S 0;Qh0 @-1&Q>0AS/h0 S l00AҒ!lTX 0 AQ   R 5` R  R  d    BQ / d /O-p<0@@`PM  d03 8/,,0 0 0S<0@  d03 ЍO/P`]PEUP,x,,X,X,X,,, ,,,,,,,,,,,,(,0 S묀80S0C0 <00<0\ d0P22,c R0 A S:0Q0a BQ0000가W  0 S 000V ?o2W0SE <0!0!SH<00<00P0S.01؀0.01SXEXQ<0 d 1`Q A02 ";/0 Wd0#0@000;/0 d2!cR0<00~!03/8Ѝ|)@-A0S 0S Ҡ /0 A Rh0 S l0Ց#"l /0 S 0;Qh0 $Q  /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 [0 R\ 0Q Q Q/ @-@'0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@O6Q 0A R4p7A,Qꀣ,,,,,,l,|,,,,,,,,,,,,,,,ܤ,Ȥ,Ԥ,L,,,,,,,,,,,\,,,,,,,,h, pS,,,,,,,,,,,,,,,,p|Qg nQ` oQ00}Q[ ~Q00P( hPlH[Yp<0<<00000@00D00H00L00P0001010 1010001}<0 z 00000@00D00H00L00P01010 1010001<00<0\<0000T\ 0O00000F00T  CR` 0C0R 0S 0d00 00CR0.dp(( hlZ pp(Ap,App@-PP@ p`E1(0 0 000@$080 #\ P`dP     y Ѝ d@-P@0 080\0`0d000000`Ѝ dp@-Q@<0 Q Q <0pQ *Q!R0 ,R0!R0 ,R0!R0 ,R0!R 0 ,R 0!R@P ,RP @PS 0 `@06/0Q/!R<00 ,R/<00<0/A-XP@Q`1`!PEU0T p07/`0S T X0Tp D07/`P T0 PY`0S  0S 0d00 00CR00d0A-X`@QP1P!`FV0Tp 07/`0S T X0 `TD06/`0S T Y`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00|Y R 0PD05/`P  lYD0d 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M:?SF@0C4SB|,,x,,,|,|,,@,|,,,Ա,Ա,|,|,8,|,|,,в,|,|,|,,|,4,|,|,|,|,|,|,|,|,,,|,@,ܳ,t,|,|,|,H,,ض,|,|,|,d,|,,t*SS h*S \*SU  SW $Ѝ@*S 88$ЍC$*S ! BS;  SPl`h0S! AP)S7 l$ЍC7Pl`h0S, .PPl`h0S, ]PPl`h0S! RPl$ЍCl$ЍC37 l$ЍCAl0S 8M0 hx؈Q \PQ S00 P   820 tl0d S031R`SP101cQ2 `"6/Dd 0`2"6/]l 0TR 3CQ0C` 0C0R 0S 0d00 00CRE0C0d0@XT0 0l0C0CQ3S  `0 S d031bl0CQ3S   #l 0R 3R0C0C0<00<0l0 S0C BR 0l0<S03 T X BS `0 S 00S0 d023p <R 3S0!0C0 S0! Cl R 3T`XP00CS10@!0EL\TX0T`XPwd 0l1RcP3PP11`Q2 `"6/d D02!e`!1NlQ3$ЍCPlQ3$ЍCld 0Q3D32`S0!2P"5/0S \0Q0C0 S S0 l0 S03S{P0Cl0S @qwl0 S0C BR 0gl0S Sb \$ЍC#W\ 0X HPLPphl@P@0 0`` 09/P@ `` 0` `  0` 00 ``009/P0@0 070S)S),4,,,<,D,,L,QT,,\,d,,l,,,t,t,t,t,t,t,t,t,,,,,,,,,,,,,CQ P^40@0D0HPLPpPPPPPPPPPC$P(pC pl0S0D!0 0 4  8Vl0S S S< 0T 0C 0 S S     l0 p S03S0!R 0CQccPv< T0X000(J?u&p$c>UAl?p$?aA0B`kAgAsAlAvAAAAAAAp@-PUpU- @\V0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0K AA-@P` 0!0`3/Vp4`e%n 0!0p3/ W)@p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@@+@@,@; S 20/ <8#8SA3=8#8SA@At210/>08#8SH2AAP00/<1 >8#8 S2A0A`01Q%0CQ 0CQ 0Q1 /A+AQꄻ,,,,,1111111 t1Q 0CQAA Q괼,,ļ,,Լ,,,,D,,,>08#8 SAA Q괼,,,ļ,Լ,,,,,l,t,|,,0000/000000000}00y|0|0ut0t0q d@-@/AAAAAAAAAAAA AAAAA#A(A,A0A4A8A0@0000@X Q@ T`` 0 @)`@X J#@0 800/@P <AA-@PpMA@` 0 R@'A-PU 80P`H0@4p-@ @-@80S 080<0S4@d A-P0 @R <"p0CS3 : `#pWЍ0@ 0p000000P QD RD//0 000/ 0p P/P //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@WT00G-P`WP0@x000000{W0Sp 0pW]0S1h0$0h00h뜐 J3 \3h0  @0l0 0p000000t0h0P h0|0000(00,000000S 0$@倌TP 0WsW P hČ0\ LPL 6P8G贌8b(A$d,0APbCAA@VA,@gA@-'W00 3A-`MpP0WD4@V A44V (4V 4V@ 4V l00 03V 3VX 3V|@0000 0 000`Ѝ3V P< S0< S< 0ShPL3V\ 0@3V~ $43V pW 0V  `P   Rh \2Vk 0V`2V@ 2Vm x2V |@000000000 0 0 000r l00| 0pЍA/e 0     0 0 000l000Ad0 0000 0߁`P\A `? @000000000A00000H0 0000 0弁`P@ =0 R 00ЍA0-h0 00P0`P8 #PЍA ``W W @W@W @W W@W @W@WWW W W W WWPb`b@-@p`U0P000T! 0CT 0T 00 0@0TP0S# 001@P R 00S0<0@ P0S 00! rd@ @T@00CS0 Ѝ@~fvtp@- MP@h T`P  R V  (T Ѝp0RVRW SW lp@- \`PE0S@0 00P00CS0pp(8cA-@aP( SE0 pAc(8c@p@- 0@PYEPP  p@p(8c8@- (@FEPP @(8c40( R/$ R R/  /$d-4( \0^/$d 0Q00 0/T0Sp@- @RP 00l0p0p@//@- @ P@A- `DPP@ @T@`V X0S wPpW@0`4P`p@P Pp(8cD@- 4DP@T  P (8cC-QP pM 0q<0 0W`@ 䀗XT Ѝ0 8/P 0S 00崐 Y@6 5Y? 5YC 0Y)@ 0CY*; V h5Y0 0YV h0 0J: S TP 5Y$= Y: =I@0 Q Q @ . @@a0D8#8S @DH$H 0D8#8S00T0S; S Q< S 0T0+ 0}@0S0+ 0Ap Tn 0S c0C S@0@ 0; 0c; S( 0 @0D8#8 T:S00@2T@ 30D8#8S@DH$H8T@ /T@ 0@H$H 01AyAv01 $'*@-@(0S2 $0S 0S, P`p40 CS4 ,0 0, !; S  Ѝ0 0 3/Q Q 0 0 %04,0 $d8b 0!< 04 0 (   !/@bxddd RP RP //A-PRx0UTPS@UTp W `W` 0 `U`RT0 0k.l00p3/`PTPTpU@ NR ^FR AnA\ P/0 !8 00 (  , !/@bxdddp@-@0Sp@{0PS 0p Sd :!.T0S` 0Sh0T0=`!bMb@-MPRX0@S ` .-x0S 0$ P`V% 00S" 0p0CS00 00P < p00` P QHU<;:S0P0S/ 00S/0.@@-Q ,,,,$,<00000000000000000C-0S@P`p 0 RB"@TP`p000P@/ "`Vp`WS0CUEFQ 0C2? 200 蜪b 0NoX9 X6^3 AoP ` V >  P = P Q ΁ Ƞ,Ƞ\ @@dPTlLoV  \Qڰ 8墄A; @ T P Ap@-0@SP S`ž `壾 < Rp؜0000 0O-,M @p P@DQa|ܡt%,Ѝ0PU Th PUa 00@  0^LAoY YPQ, ` 00V@D"* + R,= R Q . ("(R  \ `* Bo[  RQڰ  #" T ?AAp@-Pl@PTp003/\@@-p@-Pl@Tp003/PP\@@-@P@G-(`p:OPl@TUЍ0Z 0 :/PP\@p@-<0@0QP`?o2CP@Dpܯb (00 1PP D/ܯbH,  ,001PP //ܯb<0 60$ 0 1PP /ܯb/@-P`xh@fdp0lpp000 P$☁0@@0 P0tp0 ЍgAbp@-PP@0S `h`0Pp0pܯbdA@-PP 0XP\0p0@`0\0p0T0SPQ 003/P 0\ X0`0R`0p0`0\ Ѝ00S 3/`t0S 0` p0t 7/Wp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@H9N3PV *>C 0CV #PV V >C 0CV t300 P0ST0S g lpWX` 03V0t0 3VV3V! 6C0CVP 0VlPUe 0 0RnM0Pi2V`lPpU``PP xrxxRctVʀ 0! # 0   , !0 00 0 0!c!0   , !$Ѝ0S S S$ЍOvPU X0SP0S0 QX0S$ЍO$ЍO\P Vp 0`00RM\PP $ЍOtP R 00S0<0_P 0 0qW dPP0S 0010S0  0;/P\p2vt|fW~fdWcW@bxddd$ 0ܯbp@-@` F@sPP@ @ @@p`V X0S P0S@0`4$G-`QT@T` PL PlpWXPVL@ L 8ˁ00S 3/PP\pAjA@-@LTT0 TQ S S @Q @-/Ap@-@PX=PpLP <P X0SP0Sp@pA 0`( "4`#/R/`0  B"11P/  R  ,(0 0//C-Pp@(`V Ѝ 0䐕9/@C-P@pW Ѝ 0䐕9/`p0S@`A-pl `R$:Pp@Q:AQ  A8/ 0| 00CS%p0 C0 BR%0P&<019P*Ѝ0 PA-`l PR :pp@Q: BR B8/ 0 l00C0C%\c&PQ9`P*Ѝ0 `RQ\ Q @-:#:^:\:0/l/@A-Pp`@@0@Dp@0@L$<#@`W E0pG`@A-PlL0pLALA$ `@`W vE0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh !$ X F!Y P0!`pW:X  QY Q  F 0Pl/@S/G-`@ P p #$Y@PW D0S  vF00pG@PR/G-PQ`0Fh pY@p`V8h QF0S h JF@pG-Pl @R`T  V Pp`#801U !0S  &F0`0PEp pV h p`G-@ `p,Ƞ 0P !VP`W 0S  E0`0pGPp@-@P,P"$R@0S000SR@0S000R0@@ R@@ S0 00p 0A-`T0@Pp 13/UT0LpP` 0T01A/0T0A-@p`0S  dPf p A d Q0000000PbQO-P`p@@DT 0 8p0 SX Ѝ0 #p0XC-RP`p(@@DT00  0 00 0 X ЍQO-P`p@@DT 0 p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/@bxdddO-`T)@sWʀ0!()0 ))   !0@S0VP`P0 040$c0@04 00$00 , 0 4 00CS||~` ЍTc40, PR@0 0  ˰P  Z N \  @ ^0STPX0 000V`0 S ``00ZddS`0``` `uK 0dr l0Kp1˱hPL|00 10000000 P 0 T 000! PYhPQePP KPEd 00C0S% 0R0P0PC 0B*0 0RS0C2x05A05t0x50t50p50l50h51101YL%0 Y1* Y  $TR?  =BGSA S S @<Π` P" AP QY  0S,0a#0A13!8#<4("(R 8L $(!#8"(PE  ᾐḐ ḐP \ [꾐 ᾐḐ Ḑ吒01 `@3 90  BQ RZ    0S{ aLx@1|m( bBh@`p0>Jl8!0 IYR TP    Bτ000000000000PTP  Bτ00|00x00`00\00d0@bxddd/@A@,@,,,,,,(,AA,,(,h,,,,,,O-@pP(  R0T0: @($ ,0S XYZ0H00h j0ha0I0 0i 0$ 0Jp EX[\ΠY\\ˠˠZ ]`\ˠàU U RT  U $PȠ,̠ TȠ T , (0[, (02@AA)ARAUUUU/@ ̠ S /0QT0   R: ,0 30,#1 #2 R0/ R,#@-/A//@O-@P L0`!P!U1 P Q0"0!`V800#0Q00P0qpP b0C  2 `V8 0x  "  Sw  " 0S  @0P0   2@B@DC@S/O-`4M@AX0 RP0_! @ S 0P p j@p4Ѝ W LD  @ @J$̠̌$DL ^@ @$$DL0 DH @ @,  ,Ġ 0 @ Ġ  , @$@P@0 P( !   (! k   R  D   R W@TqȁSp p p@PH0@T @BpGBQ  !$ !(   d   Br r  R5 ""$, $""$,  Q Q ! ̀!1! ̀!    "  " ( E\e  RQ  RH N ,, ,,Ġ  ̠$̌(    PZ j ,  ,Ġ 0)̠  ̌) "Ġ "$ ,< $(, ))$ , H,X ? "   R $ w? 0 pPU>T $(  $"  "$,  $(  2 ""$,,m[  |$ k    , $ (,Ġ,  @ğ A@@S0Q  ! !  @P B  Br m  Rp M " "$, *"̠ Ġ "$, Q Z pj ,  ,Ġ 0w'̠̌'t| "Ġ "$ ,<{Y'$,' ^ "Ÿ  Qpp A   a$  Rc P 5 p' Ġ 't |,|  |,Ġ  \Q a !|$|(!pp7̠, $ (,Ġ x   "  R  r> 0 @PUp[  ! ! k   , $ (,Ġ,   Q, $ (,Ġ !"̠̌"$,   ,, , $( ,Ġ$ 2 "̠ Ġ "$,     i2@B@DC@O-P`pVA101!00 `#8010 S$1@"pW* Ѝ 0"00#0 R00`00Y b@D Z Y B? !1pW:Y  ! !QZ ! !Q  = `A2@B@DC@O-@P,M@PpWwC^s*P`! !"PV`PP "( !P ", ! S Z $p0~' 0p RhʈS:0 02 $0Y4:0!448#844p R20!!Ġ000 0S0`0P 0"00#0 R00`0PY*P0 0t 0c PRx `R ,Ѝ裯( 0:0 B0c 0!00#0Qa0 !    R h@P"    S0 "q!d0p0cR2 $00 1 0YX:0!448#844pq Ϡ( 0<P!̠ !P_q w0s00 #!0SJq   !0S  <0 `0PY*P0\ 0txp0cPQ`0WO 0PE0s00 #!0SQq   !0S 0`F _< pG 壯(  0: \ !Ġ ! Ϡ( 0< P! ̀0048!0000S  %<0 `0P32@DC@B@00 00000100/--T -$-O-@MP8@PpW2C\.*P`!"PV`P)( !p), ! S( p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  ;0 `0P[:00!448#844pQ 0S  ;0 `0Pό\00PE0 S 0S 0 `F};pGO-@P,M@PY C\*P`!"PV`PP p S"!  P )", * 0$ )(2 *    0  0 XS:0 0>R0S  %;0`0PX=:0 ^0$ ^0!  n0##C$Y00cR#\0$00;+Z0K0c[3];$; [ "BX  bQ;0@ 0P0S  :0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `F:H/@T00  ,0X00500\00/!-$-O-@PM@PpWeC\a*P`!"PV`P8  S"( !y8 0p", !)$p (|'"ኰ0X0:0 pS0S  g:0`0P0 !448#844p Q0S  I:0`0PX*80 0txp0cPQ`WЍ P00PE0S 0S 0 `F:pG O-@P4M@PY C^*P`!"PV`PX p S"!)ᇨ X *ᇐ", + 0$ )(2     0  00 $0XT:$00 (0>S0S  90`0PX=:0 ^0$ ^0!  n0##C$Y0 0cR#\0,00;+Z0K0c[3];,; [ "BX  bQ;0@(0P0S  90`0PX0 0t x0c PpR`X4Ѝ0PE0 R 0S 0 `F]9H/@X0S  0R   Y  Z0X0[ 50 0\00/\'-)-,00S/  R 0TdA-`POV0@P0# (F( 9 ` :p $90$p5/P`5 D0`000  @@Td"/p@-P$0@Tp5/@Td\0P/ L  \/-  , "  TdbA-p`^@ PP@@@ @S PU$R : ^V WQ 7P@^T0  NR@D@D\'LD@D BR@D@D\ @!N N'O-`pP`08@T U00400 Ѝ 0 VP`@Tdp@-P` 0@Tp 5/@Td@-P0P0P`@P , 0< 0 00 20ЍpTdO-  eAL@R  Q 4 R  Ă\?   //bO-pP`088UV@6 0 .Rv ;RP@*YC0S@ 21S@@S@TS S# S@0pPEV  0`;P?T ;T@ '  Ѝ QCM? @ R \?@F? @H$H@pPE00C Q@4$0@DWP pV@D  0p` 0P@P A0@S 0S a0DS @DH$H@DX W@;@T@bL@O-8P@Up=0`P40a040,($@@ @<ЍlAbsA@-  / Ѝ@-0 R  @ @b `@ .ЍЀp@-P@000 0(0/0 0 !""##$$o(0/0 pG-@ MP .`ЁNZ@ g.P0 0$(` b3r~ B1|(Q [eFp Ѝ$0 QL[L! B"0?pP [e0 000S [E0 ebH _L0H 0P0001@00RjX0S= 07  R4 0# b00p?   P   8 #61S0SS$ 0S 0<P0H @R000@0@y00  WSX000L000)}t0L <hdAAAA`dM@@Xd\dP P /#Eb'p@- P@P`0S uDI HT@kD000:0pp@-` MR@@P-0  `$!1/@P00 08SCD@F@ Ѝp7@-P 0 F@PRI@P CD00 Ѝ0s@-P@,`1` 0ЍpA-0p0000,C R#C` @0PPj" (,t-cP` T`$ ` 0RW00Ѝ0 0`O-@0qM@ 0 @00@ `PDH@@0" #@KVT`0`( TP? 1-20 0p`0000; 0 !?b@P0 0@0d3P 0R R 0S00V h&h , 0$ kp (00(01 10 10:0 0= 0;(0 0$0P p``P $ 0C` #0000? @Ps0 0B\p0P00ãp000p /000LI Xp 00p0 0SEWH 0`0AX  2 @ 2POo t@B2P) T+  p@$@`-0(` SP @HV``dWpp`P 500d[:^0X0@W %s@qߍ@P V W  [ ၟ00@edA@lAAA"AcC-`RM sR P Y@ p t @@ p Pf 1  1@P0S B@Ѝ02PB@<G< 00P 0&000[@P0& 7R@PT0 y@GT 5RTlBT 0000 %0S 0 0R\TPB@@@b@0@-0|MS0/P@ ||@Pt 5B|Ѝ0 0t@+@P @b$d&AlAd0 R< r9 rq4 $ rq/0 r, rq' r$x r!| r r r8< rqHL rq r "sr 00 CSR-/-//O-@4M0S 0S-p圀L Q00 000S("P a 0SL RS R H0A0 0=P 4Ѝ  `1 .$P 0P`E\#Q\0V`!L^QƯQ ` @, `<P(%  $(P$P#P 0 00PEU` - xZ0SV  A-0Mp(`X0S @ЍP 0 $ `30 @<121 @)@)`"30@P$ 00$ 0/0 ϠQ01!:0 00R0  Rp%*0 ]@p0 P T 0 ;] T  H-L0@ (]0 0C0000 00C0Z>peC-@`P800CSʺ0 V0  =# C!( R3/P 0S = C!P0S c> Pc>O-P04M,P000QP4(`$00כ?P0P,TR PH6p@W\vp 00#20›p0\`60X60 @&D6 , *PP  ƛ4ЍL0]$00$ $/ S X0S+B.0]% 0 ,P .,0000 P, 00Z 0  00/ 0  Z _R Qsရ,P e> 0X& 0 00 P 0B0 0 S0  0 0 0 X0B S 0  `* S*0S0 (<80 40 4$ 0C  ?o  20  *0 ! ;-4S S *00X0SP .0-400, (0`60A00ph@P0P 00\/@-01"\A@P bV@0@-PQ0SU L0R @@T00APES Q T 3=?000QS^T ?6?0000-A\\^CQ Ӂ0ѳ 0ҁQ/0G-@0P00pU5` o 0R  (: {>C 0C"4 W0  !1 /@+b! T l0<#\0r#/u/ppЍ0T00W0;k_kų@-P @ 0 Ѝp`00 0020050 0{2?0   P 0 nPd.0ꀖ0@-0S00R0100 P PP0 S .0t@00 S 0R010\0000S*@R@@A@Q@ G-P`0A S0 00.SR0 .QR 0@0S Z@00V@@Ѝ \.\ 0Bp@ X .X2Q^ZR@\0= QLB@0 A SR!R@L0 㸑L\  S Rp*\@S_0 0S00TQ VQpX T@^0C@ 0 \0C R.R @ X R "  pW T@R0C@0 -)0g W1 `V00C R 0H aSc~00Wm*00p  V[Q@C-@PM0Q s.R R 0E $2S ZA p a0 0 2`P 0P 庁%  %  %Y@PPĥߍC-PM@@B `ZSX `ߍ p /W0@ pG W % ~% 0y% 0PTpEP0 @P T@o P XU RQ@AOoB$RQ !QU@ 0?PPET Q@O-`@?00CSLMpLЍ@0 pP0R % % % 0 /Q 0S*p0 PS 0 C  '?0 \QX A \B 0  ("(R ! @ BV# $ \Q,? Q, ? 0S @\0 S/  @-0Qs.\ \ R 0 #@aAON/000S/ 00/0M000Ѝ/ 0P @/0P0 @-@tPt`t0 0x0 @`@wNP0 00 @`@mN( Ѝp@股hdccAmAT@/@-@cRaR@whd@-Q|L <ЍA-@ MP .$0`S rBL S?xO@x # !08` 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0S\  0Pld 02\0N00$  0 pP tQ Ѝp @#0 H0 0I0 0J0 0L0 0M062.*&"pX#0\0800sX08X0 fL000 P:X0@0000H0H @0p0Pu_< 0H280@Zhd!!ЅdT@wA 0Q0lA-` @ P80 rGLppF\\:a\pd LE01p `0S7:0 00P 0 \-Ѝ\` 0\P320 00H0 C2 000\0 >0>00C000\ 1ЍAAO-@L8`P04Mp ( 0s $ @)ZP4Ѝ0 1\0S* Pp0G0d0W80H0\X0Xp(00$0h $ [p[ $ld0 LT0C)@Ì @)0`,$"<3 PP,0p 0 B a"0, 8 E[0 000H 0\p1P9$ r 00(0Pd0 23h0$0l0(Q 00#0  $0H;PP  AH0 C2 000 0Ap@-@PuK P 90 0`X^唟`џOphd@-P`ᅟ@P⾟M@x0 000 001 0! 00姟ЍphdXd@-P^L@P4嗟Ѝ 叟UOXdHdXdp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0z@0 0C?o20p@@-D@<mP$PFЍ0 0IXdHdA-0Px0 0lh@\`FT 0S <0Ѝ pN@XdHdG-P|@xp()D0"HC \ ! `.V x)x 0 `d-   1 `00C`0`0  0`0 1 /@- j! Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0Ts,M 00P 8@0000,ЍXPQ'L00 d0\PV l 0CP 230X l0CL30V00R d0\Ap0Y0VRp0 00 00 0IS0'0 00h00 r 0 R:0#0n P X0 ld C@T   V0&q000 0SPP\0S* P 0@(00$0 0 S P t0 l $0 B$"Pd0$  S:P [W00sQ "" 000000 V P ;0l0Ch0b`d h00\ %S/G-@PP`M/ `0S 0"!030\.000pl 02 B"0$0Ppp`0 00z1 0 {0+ 0 080:q>r0"\!o0C00aD0l $`$0 B"00$ 000 0P   Wp.0S>p((r P  WЍT@AAC-R,MHPy\0@Sps: S'000 0 l 0 B$"`P= 0000s7;0@S  R # ! 0Q( q. *BQ00* 00 0 !Ġ !0 00t0 P C,Ѝ 0 0%RP00 200$ $[`@-M`pP0 0 0o@P ЍU 00@-@  11 c0?o0cCQ1! aQ\51:  P0#03Q0#S 1S c0?oAO-@P`4M0pQU4Ѝ{\ 0F0Spἱ弡X 0t0X0SP\0S\` p& 00$0 7(    $ l0$  0C#0P0Xp P( $ p* P0X   0 (0 0 0 R 000 0"R*X (D0)Ġἒ 00' 0),0( 0# 0 ,0 00O-PQ@p`$M @R H0`00>0CU\  9b&0[*0 [3:X& H0Y 0 0`  " B r  /oA  W0 H0`00 $ЍX11   " B r  /oK W0H0 0`0X1 1 mNA0A-P@aq(M00T\0S *Q  (Ѝ r%00 0 90S Q  z    l0$  0C#0PK0S s& S000R0 @ 0:0 20#400@000<@00 0000%@0 02$00$0C-@$M0\ S:0`,q`0\0PS *U? <: 0 $x_%UQ 000s(0S `U P 0 P   l0$  0CP#0zP $ЍO-X M@Rp@8`L0P1 R hhhq Rh0p0l0t0WP l  l  0PP ЍX00Ql 0jPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#0NP$ 0RXP`dM!Ѝ/O-0lM `00L0p P地$  8@0 C@P )0(    CR@lЍ     P 00S@EPM@0  / 0.S,R R(0.S%0D00R0 $0ZrLS(0S) u  B@PX  0B?oQ20S 20p0\P P8 P000 @  j0000($00 C/oQ" R0 00000,0 004 00 <0\0SBH00 ,D0P P P7 @p  80l0TP C)CL@H)0c"$<3PP<0L00H0S,00,0000QQ% S000 0Qr40SJ 40SG  >B@P.0J@S00 0000 S 0J2 0 0,0 S00 0S 0 00 0  P>  8P 00S5  \!P/ d!P)08 ,0$0SR0J000 B00 qC0岤 BCL QR ZRPDL00D 0RP( $0 R S R  u  A@PX  0B?oQ20S@ 0D)X  0B?oQ20S 10p000 ` 0DP @|O-8@LM00 \0R`p:,p Ad01000 0PP 0 \LЍd \002\0d800000@ PP0l@000)ASh0   )0a AD48"03$PPhp4 0@00p pH0 0I0 0J0 0L0 0M0 0L0<0\0<0x800s@0 00S 0 $00(00 J0,0, 0[%:04S 0S{ L0 X0r00L S0002 S200<0 0PP0<0 00]h m04S3 d8000@ :P+l@ A)A)0aD48"03$UPhp4 0 0pp80 0($ 00 0 J0 0 P P pd8P0@ 7Pl@4 A)A)0aD8"03$Ph0  04 0 0 pG [ 04S:  pGOPh h+04S# d0@ 7fPl@ A)A)0aD8"03$Ph0 40000P 0CO-`p844,M000 4@P @DOoB,Ѝl A)A)0a$"03$P00P000S !pQ @@Q @ P P   P(A4AA-@pld0Qp CT0AP(`P 2#53Qh50L L)L)0l13p$"SPV 0h  0PPPЍ@- 0$ 8 ЍO-8@Ѝ1P + =PP+wAd-C-` MR@pP2  0E@P  0RF@0 @P 00Ѝ0@P +@-P0MS@P0`pP@   $  0P @P ЍP P /4tb'p@- P`P@$0S \\$00 S$4;$X+000:0pp@-0`P"n@P]0@P N+00p7@-@t0P0p00x  0 000 0|0?000000 r 0000 0 1 Ѝ0 P0QP  000*O-@`p04MP 0 0 0@@0" `^=V0$ ( `0"`P |0< $00"$0 S:@@|A  0u`P 00`P@P ݀qn0.0ifcD`]0403S]< Z@k 0Hh2Se  CbS_@0S\ |03?SV3S$04SP*2 (/QHDRQD" $(0D00020|0 0s- 2 S*:@ 4(Q,":@ < h< "b"#b#D D D R 2qH0/$04S,. DH0L02#T0T0@@D0b X\ | P!$0S3<@0k.`6&0AL``PT`Q8R 儐0 0  F0S:2YP#|x0f0?o0cl00Fh00f0?o0cd03VSp``` 눀 `X< l @ B 0 [`Pm 0 0`^P` yXPZ RPT LPN{M 0 0R r \R0\  0 0$pR`P20(010000t010@`1100 0 10:0 00 0l0(0d0$0Y4Ѝx6|j00`@ P mT P ߅݅00`AAU@A@-0Ms0P@ u@PP )0 00 |00 0t@x@`@P rЍ@P sc@b$d&AAdC-PRM@Ѝ R `  R@ ptx| @2s|000x00000S0  R0i -@   @P 0P(@0LM-0 @`0&00 0A@:T z(0&|- !8@:T0 U@P@P s`- 8:M($ 0R b000 0d y0S 0 $?-= 00` 0&000`A@:T?0100S8 80 @P20Sw (@+@b@G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0P08< rqHL rq0 000 N@ 0nAP00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0 N,0@;AP L000L00000| r 0 0 N,0@AP~| L00 0L0000ЍG20Sk iC-0@p0S M  RP- 0G0P S 80`\pH @X!V0 /P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-@$M0S $Ѝ 0SPp`\ Q00S8. 䑟 P \  0 R0P0 R H0C200 00 0^P 000 0 = S[ 0d hpP R b0S"   PESQUP!\ P R0R00P00 Pl A)A)0a"03$ P p00 0CSP1  [0SUO-`$M0S S@ pH pP 8  \000 0 P0S@$Ѝ00S\0S0000@00\00 0?R  -pd0P0 l0  \SQ00C01@ 0<@PW 0 \ ^\ >0>00S H0A0 0 00 0H0C20000 0@P0S; 0S0\ T [ 労0 00L0 0>000  . 08@0T003 0 - 0  H00S 0 f@Pn a0I(# 0 C8RP Ot000 #8 800#( 0(8P @ [>$ЍOa@8@6AM!Ѝ/A-0 @p0`SP , PW[%C%G-` P@UM%@P pp, @P 0v -0z0@ k%B@s@-@0P000CSG#SR`88 d0l 0C S c10PQ0`P 0##sr$ 0 00#sr  Ѝp@78l A)A0<)a21 #ZЍpA@-0P@"X_E @804"60(0"$0SEQEЍAA@00\ <(00C S----------- 0 ! /+ 0 0 0ALG- 0 SS   ЍS @ 8pL x @S  @#>0S I`  "` !I 0 &>mO-0dM0$0L0P 0<00S40@ P$08p40!0Ȁ0`0S0000 0#200Ẁ 0022 0$0X0S rsL Sp@T0w0 夂0X@0g0s L0ld0S A A! a,3 1T 0 0 #0X 0000 0,, 0h00SB: RPPB0 @S  @   0 R30d l1 \SQ0h p0D0@P80010!@0$0\0HXL00$P0X PP3l\X0 A)A T L)a"31$DPPLT L00CS0@08 S  8 T8 000X :0PTD00UQ0(0< 0,0 0004 0C0$0 \0@T 0S S0 00 00S U   000 00  0dЍQ 0S0  0 0H0fp40 @ J 0J00|K0$00J00K048 ,L0d 0Sl B B b32T 0 0## 0 0 P'   0400S*Tsld 0S B B b3?00 2="0 0 00 AP T PO 0(00,00S ( ,     0 R TP70w0000?(@,D000@0(@,0@0(@,0PH@@A-@pM0@P`00 R@@g00V T0L0 0L0800"0 VTP@`00R l0 W@T>@M00N0P Z000Ѝ@-0`P pMX0S, \0R@#8*x < P @P.00h@l@ 0!0\0!" 0080H00 080 000  0p 0, u@P  0 000 Ѝ7@-@P合P ʄʈ Ѝ080 000 W0C-0@P8`rrd!!L dl Td X0S  0SL L l3<'0#"L0!10P  000 00HpX0000(0""p 0 8080C  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL  0SL L, l.3 < 2#$ " 0mG-0p` M8P0X0S, \0R@#* 0@Px 7 0PP(0 000 ( l0Bd BT 0C!#p00$?@ p 0 @ 0k 00e   XrL R:!{0x.ue 2- p8m6j 40r&c`@" X @P0d00t@p0!# 0, $00@P  0 Ѝ<@P 4U@C-`0MPP@ PU80 000pH L0C40S@ PP: @ H0 0I00@J00@L00@M00@L0P\pp 800sP  /PЍ@- `P@P 0   0L 0 0<032000 0wP Ѝpvd@b 0`( "4`#/p@-@(0Sp0PS㲨P 0S0SpO- <Ѝ(`ᑤ< `0P00 x$ $ # P R!$0(@ 0 001 00p @P  `0@T aPI@ PH@P@U 0@0 0P M0@SI@H@ R Bᨤ 0` 0d0S $0d 00$0&AbH-G-M8P Qo<@0, @p0`0 0o, 0 < 00 0 0 %@P0S000ᖧЍ㻧P7@꠆A-PPP Up㾣U@0`@P` BA-0Sp@㊧@P 0`PP`P0 Pۣ00`p@-@っ004P0 pp@-0`S@Q@P P0S00 } zwݣpG-0`@ `Pps@lT Ѝ 4 P0@ 000`]@`W@bO-0M`@0@PS%  0 1PP刱ل008p,080 p^[6ÄW88p08[8088 ( 08^P0 SC&P02#` 05:#0P 0 @ 00 000 00$0000 0`pC@ 0Sb$0@&S@@T ש`㨄0S|$`#p!t$$(00Dp0(0#00$ 0iA@P $`?0V000!"$ $0( ,Ϡ RQ #Q#0 g@P0  #"0 00w"ᝁة#0Sz |!w0 ! U8 0(< , P\j 00$0 `000t0`$0  0`0 0;vV8p<$w 000$ 0  !P!$ 0  !P` p($,0X 1# 0  ng@PV ^!0,gT!@@ 0 RZ P0R 0" 0! 0  1T 8@@8080T#pV@Tڨ0S) 0}`꤀00!v!܀¨0\ R3 0  8@@808&d@b=A d1uO-DM(0h04 800S0`Sp 0S DЍ0地00H83 000  01 0( $Q  0 0\0:Q P @$,0 Q( DЍO:=0 (P Q QN QD'00040000P# 0 P*0S S 1H0C200<0000P  0P0*U00 Q QP QX oZn0SU^&00000 0 0;00@PYP\ 0606P LLP0[eUP!00 00:0 @P P\060 %P  6'Z&;00 0( $ R 8S  0Q\ 00P$ B0 Z  Y #ROY*  R$ QKڸ \RA  00 0( O#80080000070 P 00  !8Sr0RPl #000 PQY I 0 $@R$$ 5 3, 5$  000800<000Y*00 0Rm* $0  $00CR\0X$0000$0)! $0 00 0 0 0$0 e% 00 %$S R0 $0 0 P000PE`10S0|0S8S 00 wP 0 + %0600wP ! "<0S )!  Ap000  P  0 PmLR8F$0 0,0SPv$H8sQ,@bdtb\AO-P $@p 0 P0@@`{<04 @ 04/@P ~6 wAi cA@- 0 0000 0Ѝ @-0 000 00 0Ѝ@-!>000!44 0˯ЍO-@Pp`LM$@@T`Wpx86X vP0 7 |8/P $P ! LЍ  4 ``:/P 6 $P $` P  `880080`` 0( $;/#PZP|p0 3/Pt0 Sx0S $0x 00$0 03c@P@P] 00#P P R R 00U>000 C3@0000 08A4/P#P00p  0@P R 0R  CU80000008Aᜐ0 4/@P ɚ#0D?oU20S 0 #T T0S0S0T2T0S @0 0C0m$Y @ 1 8儀00008A ᜠ0 4/#P@H  P#P@ 0 T0C0d0S @T \ @ZP q0 00 S00  P  [~60Q &(10(1PWx6@Tz 0S0Y @0 00000x60S: 8h&,061*"S80 < LS0C1001008  0`000d0嘚*0<00L 0  ! f 0005 000 s 00bR0d`0Y +  P:dd0 00 0`0V@< @:@8,0< 8R, 9981!p`00h0 !0+@1`10ST0  @U. "0 0`( "4`#/O-p{;0028 #80 0Z0[ (%" 48<8<@|@ 0)0(, 0>0P03/: R Q# Q3#8#(, PU0 :830 00 >! _31 &0S#<Ѝ8,( ?0(? $0,<80p 0@|0@x f8    08 08  0`Hli@di@@d@c0@-@ P0 M0   0CT D P  0 xЍ00@-PM8  @:8F30 00  Ѝ0@A3Ѝ0O-PS,MP 1pЀP0THL R PFP` V``Ӕ VPPxaR X\ R P8 `QH!P`ш U@3 $0t!$0 ! HR  U P  H    ` X0 -1811t,Ѝ\ ``\ Pd`1 1HL0XPs1 ,U-181@cAAQAGAC-DMP` p i <  0$ 00 0@ "400 00 0 0|0 0 P0 S 0 i P iDЍ0L\ \0? 0 0 90)0 0 0i 08p@-D0 @T0jP3<P<#p/@cG-@P&q000`P0Y0000Pp"SR \ R3#. 2 2 8   088 H@d@c 0`( "4`#/O-$@ r (0q00r0a@S 0F  `(s0F0r0S  0 0@0srPU, 00sr0,00000(q,0!↲눐!0!  *P!X& g! -++:10 0 ֱ4 6P !*!0 0 ű4 %( 00 40  ++!BbqAzAG- MPp  @` i!?F@T Ѝ^! [!Z @0(020 Q0 R00 00@@JgTP0J00PP $ P0Q\(0 R @0 000@cO-@,MP0 T0P`pX ` 0 T00Cx S 00   @P` q? 01  BR bKRDʤ!0 SA080@``  T1 ,   00400`5000@@ ?0S0  ?0  ?@ ?{-Q P@@0S   0R00   R``  @P 0P 00T 0,Ѝ@cbp@-@Pp0 &Gp@pO-2MsypQa0S 00&pЍ@āT0S_@p] PD 00 0p0  $" " S R- [03 H0 $0X\ RP(0` R  X000 R 000p 040 0&@0HL RP0P R 00 !/ %@bdbdbQp@-@ @QF<0@$0@0$0pPPo$@!pTp<0$0$$@p@-Q@PP @QF@poD 0$ 0S (0, 0@@oD 0$ 0S (00, @@A-P`P o@T 0S p4` 00S0C04?%0S00  0S00@bAo,%@bd@-@ lo@%dA@-T@0S go00%, %0So Uo@%ddA-p1MC0S S@"L1H1H0 4Q4 " 5o R100 0<\@P foЍ̀PU!@0@0` PX0 h00|400$0@0P`TT%4?o@0SP000@bd@d@dAD.bAd- $\/p@-@R PP00SL0 D(U#6 p@$x3A e@A-@P`pܖW,0 A&㽷p0@-@P0M 0 @0P@ph0 `0 @0P@f0D 0@0<@@:;P (O*Ѝ0cAdAd`K.A؇dA@-@SQ@:dA-P`p @@V0L03L000唀@0 0L 0h,hd`dPTP,33 0&L 0 ddd@be@7@-P0G @P  @P000  Ѝ0@-@p0PS` H`HV 00|03 8 6008o<080S 0S  V 0 : Ѝ@bdp@-P@0S  0S  0 @QL\PP P 0S0mw,pxddd 0`( "4`#/7@-@00Pm000U  Ѝ0@軪 Ѝ0mA-$PU0@$01  ~m` pv1SmAb###@-P 0`S4 Rt13U @ K@Ѝp $`V@ 0@ = ! 00\4A4/@P& U& 7T 0S 0 0 0U>0' T 0@(T @0 0 DR23200   (T @7T0S   '@bAAO-@MpA,4@P0S0M0@0\<`3IW00 Q, 3Q00 3`0 0'00C0@@0SPD0@H0`2 |#101Ѝd#0 00P30 04008300P0@0 00  ftZ @G|y[ @ R 0 P 20 030000 3SH0L RP \0 㞊0@`0 ,00 B R  R@0 00 9 `H0GS4pV.xV.U.U.hV.40u400 3SH L0SP0\ 0 c0`@0<  0CS0$000 $ `L430W0D 0 3SH L0SP0\ 0 40`@0<  0CS0W00p + ? `eddddeddd@-8@gP(0, 0(00 , @dd7@-@ Hk d/ \P\00P0 D00(0 ,00p0 Ѝ0di.7BA AA@-4@HkP(p@d0/dp@-PH@k00p@kd@-Q0   0P0"3 ` 0ЍA0C-P4 $0# @ 0圞@P {0  000000) 0㕢@P 2"1}@P 00' n9@  ᙨ1 4W?o20S 4 k@P 1011 Q 0@4Qq 0A  101(0S+p@x tT@1eeO∀@ ֦@P1@010@00&@1:\@LHD@X@T@P@d0`@h@<ЍS p@x tT@1@eKN∀ @(0S a&  000000t 0 R00tp@ሀ@M@bbd AO-@PM1 pЍa封少 ᬡ  pP4aSUʀ 0! #l!0 d!\!   !@1j0S6(kj 0!!S0    !wW' 00p 00P 0018. 0/P 00 \y R (@- 0pꀂcbbd@bxddddtd.AG-`@Pg0S 3/PPdvgU X3<ЍOd 0S  0 P4 P 00 0P@0[00 - 8`h0S" 0!X Œ"4< P[ 0S0h0 0  l (0R U4 0 0 0(0$ S 10 1, 2!R <0L`R0Ca0`a``( R 0dSd0(0$`V  0000S8 R40C BS0( R)0  0&R 0 P 00@1004 0  0;/P Pp00#P00S 0004i0 0 0 0(00dSd0(0d0 S C22 0<0:t0p0x0000|0 08l0@00X 00PPl4 0 (00,0'S0 c0?o0c$0 0(0(0SP :000 0!PPK0T`2M"p0  0Sy  " !  0 WE (M `0S00000\0 `p0p 6 sB PP g V  o v zx(bDAKARAYAdbb`AG-PR M 0GS `2 V Q 40p z@P00  Ѝ00(0@ 0,0000t0 0p0$0x0(080,0<000040|0<80l0D@0H000SK@0LJ@pt〃 VT  7<$(, 0 00@SE@kL !y@P6ZaLY `0J~@P)Z `ZQLY p0D:~@PZ `000<@P 0 00 pp@LLJL HLv@t@r@b@-1Mc1TPf1 <R00< !0 0RBP@P BЍ@( <(04!    5t@P   0`0X0 0(0@P (( (pl0 @ pM"(@@T D`@@b$d@c0B7BbfAAAdA 0`( "4`#/@-0$ (0S\ 0 B @B2 b41>" 0S& p@-`0 CSR!0@P P  e0 P  [0 0# Pp 0&p p@bG-p0M0`0@8 ;8PPh "\D00D0D  0?U@ (v 8PPP# #RH LQ\P AQL0S0P0\ 0  0CS?QsU3, BU1L (PP00 00 0$01  3PP Q 0 0 0,,oPPJ v0Ѝ(0000(0( 00000#0 EQ QE!(L #RH L0SP0\ 0 r(0000(0 <  0CS00S( 0 00 0 L0,00S00  R,0 UdA@bO-00)@P|0\0|0 D lM00圀 p ,0@@mU`< 8  " QRHLP\P@@ @D[L0S0P0\00C Sr[ A[L ,<1@P /vP<0000<,0<,0 00 0,0r0K! !B(L< 8@@@ QHL\ࠃP\ NTzHL0S0P0\0  0CS &rT<0000<,0< ,0000,00DA AD)0 !(LQ0 3SH L0SP0\ 0 q<0000<,0 <  0CS00S< ,0 00L 0 ,0t< 0C 3SHL0SP0\0:q<0000<,08   ATL ,<w@PEY4Pru?@ X808 00U0@00S0T0S@lЍ<  0CS00S< ,0 00 0,00 Lt0<0 m #R'HL R \P   B[cL R0P \ 000B S Xq[<0000<,0< , 0 00 0,0^0 K K !  @004000080 0 @P AU 080 X0000CS000 (  PP(  4t@P[,000B[ 0 ,<@P P 0 0 X>PPX0 080 P000CS (  U`P(  4t@00002 0R$78 00 00CS000 (   0`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  `P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X HP 4tP0%'[FT[dAdO-0pdM00 ,0`0SrPdЍlVH$@&圀t00t0 $0   V@ 8t 8PPP# #RtHL R \P   BUL0S0\ P00  0CSoU\ , BUL $8PP s` 800008$08 $0000$00 EQ QE!(L^0SGs`?P V8080 0+,00S0U0SPq #RH L0SP0\ 0 o800008$0 <  0CS00S8 $0 00 0 L$08 ? PHLPP\ 6 $8%PP,00(004 00 023PP nQV 4( `000CS0(0%  @P  0rPQ  @Q0$P000$0< A A! 2 0R54 (0 00CS0(0   w@P P TX @@D' SR0 000HS# SR8Io4( @P A@-@8 0 ,o@PAG-`08MP0@0CL S  ... ... . ...p., 0 @ 0T@ #圐0 00D (0Y8 P@@$@# #RH LQ\P AQL0S0P0\ 0  0CSmiT , BTL ($@P mF$0000$(0$ (0000(0a0 DA AD!(L d2, p3  p "  @P A , 4000CS0,0 0  PP0  l@8Ѝ%P 0 04RPPT  , 000CS0,0 0  dPP0 00CS$...8...@.d. 0  0 0C?o20 0T  0  1 0 c># C,0!0 0 0 80 3" @P8ЍG TAdA@bd0 XE7@-P@0LP! "V0S, ,00 13/J Ѝ0Aȓ@4 e@@-@0S @C-`M @P* 00 0SS S ?0pS0 IP  "P  0    0@?ЍO-p0PDM,sr`l90V06 %P00P0H $08 `@@8@= #R2H LQ\P AT3L0S0P0\ 0  0CSNgTBTPРZ@PX0 @T@ T0Q' 0R, BT&L $8@P3 k TT0S ,sr 0S 0T0  0DЍ800008$08 $0000$00 DA AD!(L58 0 3SHL0SP0\0 g800008$0 <  0CS00S8 $0000 $00R# @04 R S |00000 0(401  3@P A4( <000CS0(0 ,  `P,  0j@fRSFP 0 0<s`P<T 0jTN0K 00G 0S S@A4( 000CS0(0 ,  u`P, 0 @DЍO|S@ 00 , 0@0+T dAc@bp@-`P@M8  ;8P00   08 H@   0 013/ЍpH@@!eA-p`@M8 ' PȚ번   P00{  0H X@  0 013/ЍH@4 ep@-@ `(MP0/ 0 0$00 000 P@P A j(ЍpO-0dM 0/@H0p0H0 <D ` $0XP 4q 8# #RkHL R \P   BYL0S0\ P00  0C SfY, BYL $4P iZ400004$04 $0 00 0$00 I I !(L~408 pZQ #RHL RP \ e400004$0 #RH L0SP0\ 0 e400004$0 <  0CS00S4 $0 00L 0 $054 0 3SHL0SP0\0e400004$0Q #RHL RP \ te400004$0 ,000BS00S4 $0000$0,<00n40  p^ Q( #RHL RP \ @e400004$0,000BS00S[4$ 0000$000,000BS00S4 $0000$0 ;00 &40 pw Q? #RHL RP \ 6d400004$04Q #RHL RP \ d400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0900(,40p|  Q? #RHL RP \ 6d400004$04Q #RHL RP \ d400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0 800,f(c8<40~{  ^[{ \< #RHL RP \ 3.d400004$01Q #RHL RP \ d400004$0,000BS4$ 0000$000,000B S00S4 $0 00 0$0408@HL4 ~{0 $^[ \i 3SHL0SP0\0`c400004$0^\ #RHL RP \ c400004$0 ,000BS00S4$ 0000$040\ #RHL RP \ c400004$0 ,000BS00S4$ 0000$00<  0C S00S4 $0 00 0$040HoPl4 0i 3SHL0SP0\0`Bc400004$0^\ 3SHL0SP0\0 +c400004$0 <  0CS00S4$ 0000$040\ 3SHL0SP0\0 c400004$0 <  0CS00S4$ 0000$00<  0CS00S4$ 0000$00000,000(0@0 0 @QP X 0( 圀000CS0(0b 8  !PP8 Y ,gf dЍ<  0CS00S4 $0 00 0$0p.000 p0 p0 ( 8@0s ?@c00HP0s0 L ?@cx 00R01odAd@cdMb@d 0 0Rp40 (0 00CS0(0 8   PP8FpPTp AX>P@Dp9'SR0SH#SR8ppGor0( <`000CS0(0 8  tPP8 RP 0 00<<PPE<0X@ ZW P00@X00P @cP ,P0%'00 0PP`@P ,eYG-@|0s-P pr`0s 8<0sqHL0sq0s 00|(,圠p|\ 0>0 ^0P3j:0S!S"Pc PPcE""؀ 0h13 ZPP!  09E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 PPЍP@bO-0DM 0x$`pT0|0T0D  $0WP 8 8@@@# #RH LQ\P AQL0S0P0\ 0  0CSM`TAڌ, BT?L $8@P000000(4003  3P@P WA 4( <000CS0(0T ,  PP, K 0fd@DЍ800008$08 $0000$00 DA AD!(L #RH L0SP0\ 0 v`800008$0 <  0CS00S8 $0 00 0 L$0pP 0 0<PPT 0 d4( 000CS0(0 ,  @P, J P0c?@P@ 0  |@PT4( 000CS0(0 ,  @P, ! P0cH@_WDT#dA@bO-0`TM0 0/P0:00p[P0,0,00P$0 0VK%X00X0p0, V0(040[@Ht 8 PPP$ #R^HL R P \  BUH L0S0P0\ 0  0CS#_U>, BUL 4HSPP" Qc $TЍH0000H40H 40000400 EQ QE!(LH0 @ #RHL RP \ 7]_H0000H4020 3SH L0SP0\ 0 E_H0000H40 <  0CS00SH 40 00 0 L40,000B SH 4P(0 00 0401[5 ,)00D008@0 00 023PP mQ0[L0e D8 000CS080 <  D]@P @bPP< P 0 0D0L@PL00U@8D8 000CS080 < 8 D.@P<  D8 000CS080 < 8 D@P< p0@P@VbHP0 0D 0L@PL00P 80DP @=b P@9b$0[`F0$0 Oo 0BS@T0` 0(0S`ÅPUdA@bO-M<00pD p H `0 @0/P0:0 <,000@00,0PSX040(pH00L00$P80 ` 0SPUژ+t`H\00\0 0S`1<00`S   T0 ,0pSd 0 8PPP$ #RHL R P \  BUH L0S0P0\ 0  0CS;]U/ڌ }, BU- TdL PP< a 8<0S ?00C00Sxʐ??4D0$ U 00Ѝd0000dT0d T0000T00EQ QE0 ! (L+d 0Z 3SHL0SP0\0Q]d0000dT0O0 3SH L0SP0\ 0 i]d0000dT0 <  0CS00Sd T0 00 0T00 Ld 0 3SHL0SP0\0;]d0000dT0<  0CS00Sd T000 0T0852D0P-P <0S P ] HL 4PP   T\`$ A# d XP`0 0C0000 00C00 0 0>000>  d B00X0 0`00\000 00P63XPP Q,0Sl `X 圀000CS0X0. h X `'pP% \n`P<  0CS00Sad T0000T0 | T0d_PP h 85 0RK` Xp0 00CS0X0 h X `pPhp4 }(ypttx |x\ R00 @040R0 4\ R8Ioᩒh lPR0p(00@?o2(0040@(4`X l000CS0X0 h X `pPnh 2P! 0X 0`0l^pP`40lS㜀 @0S0Y P00X0?o2 pP(p UP` X0 00CS0X0 h X `XpP0hP\_PP0%'V0`F 00000C0 0000 0So0 `$0p4S SP040 =a圀A `@a =40$0(0S P0hH0\Y_U 00 Y0C 080080d 0 L`0$00 ?oV20SX 0 F000 0C0000000 0S 0 : MP Yia0X 0`,0‰`P \ _Pzꀰ,PUe(A@AdA.@bdO-dM000&@`p0pl0p0H $ 00圐 $08@VP4m 8  p" QHLP\P@@ @DWL0S0P0\00CSZW AWL $4@P ^`400004$04$0000$00G! !B(LZZB^`?@ V8080800S0T0S@dЍ QH L0SP0\ 0 Z400004$0 <  0CS00S4 $0 00 0 L$00p40 j #RHL R \P   BW`L R0P \ 000BS VZWe400004$04 $ 0000$0\0 Gq qG!  Ӿ800,000(00  0 @P JAV 0( `000CS0(0  PP  ,]@-,000BW 0 $4@P 2 0R p50 (0 00CS0(0   YPP pP TpXP@Dp'SR0000HS#SR8ppGor0( <000CS0(0  "PP `P 0 0<PP<YP 0SW P00PX0?o2P @P ,E]P0%'WvWdAd0@-00 8 ЍO-lM00p08-@0唀`x00x0 H 0 000$0 0$  ,0@@ [P< 8  # Q#HLPP@\@@DZHL0S0P0\00C SYZ  AZL ,<@P \ ` <0000<,0<,0 00 0,00J! !B(L刽WR\ `?@0[ 8080 80800V00@00S0T0S@lЍ0 3SH L0SP0\ 0 X<0000<,0 <  0CS00S< ,0 00 0 L,0 0<0  #RvHL R P \  BZHL R0P \ 000B S sXZS<0000<,0< ,0 00 0,0y0 J J !  < [ 0P8@@@P Q*HLQP\ATFHL0S0P0\0  0CS )XT <0000<,0< ,0000,00DA AD0+0 ! (L墼,000BZ0 ,<@P    ATL ,<@PX$0@<0  #RHL R \P   BTL R0P \ 000BS WT<0000<,0< ,0000,00 DA AD! A@004000080 0 '@P A[r 080 p000CS000J (  PP( A `4;[@P 3SHL0SP0\0 gW<0000<,0 <  0CS00S< ,0 00 0,00 0L>,000BT0 ,<@P +ꐤ 0Rp` p68 00 00CS000 (   PP(3`X\` .`+L`HP&P'SR00 000S#SR8``Foobp080 D0000CS000 (  ^PP( gP 0 0D'PP[D0WP0  0S'V P00PX0?o2X HKP 080 `000CS(  'PP(  4mZ@`P0%'0000 R p 68 00 00CS000 (   PP(pX\p `LpHPP'SR00 000S#SR8ppGor080 D0000CS000 (  PP( a`P 0 0DPPD0ZP0  0SW P00PX0?o2X HP 4Y;P0%' `TT&ZZdAd@-4 0Ü   Ѝ@bO-0\M0 0 0 0@0 <S0  D0 00,00㜐$0+0 00<0, 0`SPw 8 PPP- #RHL R P \  BU#H L0S0P0\ 0  0CS&UU4 P 0 x0?R*00h, BUL <P\PP ZYP0000P<0P <0000<00 EQ QE!(LP 0Y 3SHL0SP0\0PlUP0000P<0N0 3SH L0SP0\ 0 TUP0000P<0 <  0CS00SP <0 00L 0 <0ѹP 0p 3SHL0SP0\0g'UP0000P<0e<  0CS00SP<0    < !              0x00@0 0L00H0000 07 3tPP Q0S[ L@ 00$0CST0@0# D @ LB`P HXP\Ѝ<  0CS00SP <0000<0D P 0@ 0LT`PT0$0UHL@ 000CS0@0 D @ L`PD 0000L@ 000CS0@0 D @ L`PD 0`pSpP00SIPL@ 000CS0@0 D @ LPD 0 S*_oobVppHXW[ 0k u0 08#800C0 0C00 000 B 0SY !8888RL @0 0 0CR S 0@0 D @ L{`P8D(0@S`HWHP*S0@0 D @ L\`PD(ppp,kW04 04 0000C00000 C   A0Wa0 [(00`p 00 L 0C00 00 0 0C0 @0P H]W P0pG pG ѷ0 0C00000``F`L @0 0 0CR> S 0@0 D @ L`PD0S 0!  0   0 @0S- L @0 0 0C R0 @ 0@L0P0 HWPxS0@0 D @ L`PgD0SA0UdA@bO-0M`000Pp$ h,`` 0 ,000\ 008 @@D@+ #RH LQP\ AT!L0S0P0\ 0  0CS.RT"@ |0 x0?R: @, BTL 0D@P% V,P Y ЍD0000D00D 00000000 DA AD!(L:D 0 3SHL0SP0\0 RD0000D00 <  0CS00SD 040@0000001 000 0 000 000000 00xx0pt00<00$0 09 3۸@P @4 L000CS040 8  @P <k8 EP 0 0@Lr@PLX <U@V@4 000C S 040 8  @@P8 0000 @TX00 SJX@4 000CS040 8 4 @[P8 0 S*oᨂX <UZ0S c0  008#800C0 0C00000  B T !8@888@4 000C S 040 8 4 @Px8 0 00@S<OUH@0,cX0 徵0 0000C00000 C   A000X0 `{ x0 000 S0Ḁ00  0C00@ 00 0 0C0 40P <U @y0 H H w0 0C00000J 0000@4 000C S 040 8 4 @P8 T 0 0 0 @ 4P0 00C SST040 8 4T @fP8T ₵@4 000CS040 8 4 @NP8 Ph @4 000CS040 8 4 @5P8 0@?S%@ 40 0 0C R 4  8@4P <`T @@ 40 0  0CR @4 e4@@P` T88S? LjP9 ,Hp0 ,YT H0!,P001x C60 0hd,P YL 0,0@4 000CS040 8 4 @P)8 _E<0 H0PH0T0,0S040 8 4 @P 8?@ 40 0  0CR 4 ճ4@`P =@=9PT>dA@b@O-DM000'pL00L0<H $ 0P$0 0`S8^ 8 @@@# #RH LQP\ ATL0S0P0\ 0  0CSOTڤ`, BTL $8u@P sS800008$08 $0000$00 DA AD!(L/Y3TS?@Pl0S0 3SH L0SP0\ 0 |O800008$0 <  0CS00S8 $0 00 0 L$080 p #R;HL R P\   B[fL R0P \ 000B S ;O[v800008$08 $ 0 00 0$0A0 K K !  ḳ0000(40 h0 垵@P Al00S0T0S 0S> 4( 000CS0(0 ,  g@P,  0R,000B[ 0 $8@P '0@?S`0RH@Pl00S=T 0l 08 U6 3 `4 (0 0 0C R (  , &@P,l00SR TP 0Mp  L6`0 @P >0QRDЍ @QL3 L  L h`L 0  0 -@lЍ, BTL 0@j@P hQ@0000@00@ 00000000 DA AD!(L$0S0HQ?@00 #RH L0SP0\ 0 sM@0000@00 <  0CS00S@ 00 00 0 L00@ , PHLPP\# 0@@P@0 P Q- #RHL RP \ $+M@0000@00"  @Q00@00000,0A A1 失,000BS00S@ 0(K0000 00; 0s@0 F  #RHL RP \ L@0000@00 ,000BS00S@ 0000000h:00@ 0? 3SHL0SP0\06L@0000@004 #RHL RP \ L@0000@00 ,000BS00S@0 00000000<  0CS00S@0 00000000@ 0 3SHL0SP0\0 XL@0000@00 <  0CS00S@0 00000000@ 0 3SHL0SP0\0 ,L@0000@00 <  0CS00S@0 000000008@<@0~t d'^T P \ #RHL RP \ K@0000@00,000B S@ 00 00 000408@H@L@0~t  t^T \j #RHL RP \ aK@0000@00_\ #RHL RP \ K@0000@00 ,000BS00S@0 00000040  #RHL RP \ xK@0000@00 ,000BS00S@0 0000000,000B S00S@ 00 00 00040H`P]00CS@ 0f 3SHL0SP0\0]/K@0000@00[\ #RHL RP \ K@0000@00,000BS@0 00000040\ #RHL RP \ J@0000@00 ,000BS00S@0 0000000<  0CS00S@ 0000000H2 08#0`80004<02`   36@P AP0S <4 000CS040i ,  @P, ` 8JNQ #RHL RP \ xJ@0000@00 ,000BS00S@ 00 00 0000R01o0 0008g@0s0H`P0s0 T ?@cV8 ?@cO0dAdde@@c@Mb@bd?<4 P0 P00CQ S040 ,  @P, %0@?SP`8MH@P00U ' 8080S>09 P `< 40 0 0C R 4  , S@P,N00 H0{@PFH0TP0S< <4 000CS040 ,  1@P,  8wM[`P <4 000CSST 4 T  @P(00H23 00@P(0TP V@ 0 0XXPҶ@PXP0S <4 地000CS040 ,  `P,  8)M@`3 0R :< 40 00CS040 ,   `P,^`X\` Y`VL`HQP| x0RQ   R=04 RQ8800C?o20<4 Dp000CS040 ,  `P, "0P0" 0 0<DN`PDp[` 0S 0S P00`X0 `?o2X HoP 8LT E$0P~P0%'T!p@- P`0 PP@0 <p0O-M @0  ( , R 0 @Ѝ    0RL ( 8 <  4 H/p`00`0408   D0K0PSXr 8 @@@) #RVHL R P \  BTH L0S0P0\ 0  0CS"[HTP000, BTL DX@P LX0000XD0X D0000D0J0 DA AD!(L0S@K?@00S0VT0S 0S S XV@ :0 3SH L0SP0\ 0 HX0000XD0 <  0CS00SX D0 00 0 LD0X , PHLPP\# DX@PX0 P Q- #RHL RP \ $GX0000XD0"  @Q0D@000D00A A1 1,000BS00SX D0000D00S_40X 0 3SHL0SP0\0 pGX0000XD0 <  0CS00SX D@0000D0 00T00H`P0 `00 0(:3ѭ@P Q0S TH 000CS0H0s L  TPPL j PJ90sX0 F  #RHL RP \  GX0000XD0 ,000BS00SX D0000D0800X 0@ 3SHL0SP0\07FX0000XD05 #RHL RP \ FX0000XD0 ,000BS00SXD 0000D0700<  0CS00SXD 0000D0L700X 0 3SHL0SP0\0 FX0000XD0 <  0CS00SXD 0000D0600X 0 3SHL0SP0\0 VFX0000XD0 <  0CS00SXD 0000D05008@w<  0CS00S}< (0 00t! 0(00\1000 08@0s 0!?@c00HP0s0 ?@c@004000,8 0 003@PK UJ [`8, 000CS0,0 0  ṻ@P0  4B`+dA@bd@c@dMbdHPPD 8, 000CS0,0 0  ᓻ@P0 /0@?Sp4B`H@P{8 ,0 0 0C R ,  0 q@P0``H0 嘲@PH0T` 4B`8, 000CS0,0 0  M@P0 U P08, P000CS0,0 0  /@P0 2 0R p$68 ,0 00CS0,0 0   @P0pX\p `LpH@P'SR00$000S#SR8ppGor08, D0000CS0,0 0  ٺ@P0 ruPP= 0 0D⢫@PfD0Z@0($0S1W+ P00@X0%Ps 8, 000CSST , iT  {@Pc C0 0XX`v@PX`X 8?o2X H⨫P 4A @P0%' 00`U`[ZGO-@ 0tM/00p0 `0,@l0V<0d0 0d0H $ 0<@  00 㦹VPH_ 8 " #RH LQ\P@@@DZL0S0P0\ 0  0CZ=ZhU, BZL 0Hj@P hA`p!H0000H00H 00 00 0000 J J !(L"0S2`EAp?@Pd0 3SH L0SP0\ 0 o=H0000H00 <  0CS00SH 00 00 0 L00H0 \ #RIHL R P\   BXRL R0P \ 000BS .=XtH0000H00H 000000040 H H! 媡H0V y KpV Q$ #RHL RP \ <H0000H00,000BX 00 H⤺@P 8,000BS00SH 0000000:00H 0? 3SHL0SP0\06<H0000H004Q #RHL RP \ <H0000H00 ,000BS00SH0 00000000<  0CS00SH0 00000000H 0 3SHL0SP0\0 b<H0000H00 <  0CS00SH0 00000000H 0 3SHL0SP0\0 6<H0000H00 <  0CS00SH0 000000008@pP` V8080<00S0T0S0U ,,003 3 00 0@P,0TP0S@[[@ &\ #RHL RP \ :H0000H00 ,000BS00SH0 00000040m\ #RHL RP \ :H0000H00 ,000BS00SH0 0000000Q #RHL RP \ :H0000H00 ,000BS00SH 00 00L! 0000}41000 08u@0s !?@cl00HhP0s0 ?@c^ZD4 pP0P00CJ S040 8  ᤶ@P8  @= =0@?SP@=H@dAd@c@b@dMbdp PD 40 0 0C R 4  8 t@P800 P0✭@PP0VTPK D4 000CS040 8  S@P8  @=W.P D4 000CSST 4 T  @P@V D4 `000CS040 8  P8  @f= @Z 0 0``P@P`P 2 0R $5D 40 00CS040 8   P8`d hTPX'S R00$00S#S R8HoD4 L000CS040 8 4 D⻵P8 W`P 04 0DLΩPLY㜠 $0SX P00X0?o 2` P⩦P @<P0%'T   z 00@PU U -tЍXZMO-p M0`ox0 00S$㔼@5hA83 41 HdPs 0 081   E"   E$EVP  0P 03P 00 P" [ 3 000 0VPP PU 003 00 0H@Ѝ000zS0Pϳ$9HA@b]Aф@G-P `Mp唱PL0S@& ኱P 0w003 FP@ 300 $H0S0 TP@ 0U&Ѝ P0SH0S Ⱖ@P @0 CS 8:8QjA@bG-`@0 S_Tp  SX)Pڜ0H0S0S 0 PPl'@1 3 00000 00 0 P WTUU0S 00   VwT 0S 0LwT T  Ѝ0 P@bO-0pdM}@dЍ%`000D $0]8 P@@8@# #RQH LQ\P AQL0S0P0\ 0  0CSq7T , BTL $8"@P ;800008$08 $0000$0e0 DA AD!(Lܛ80  #RHL RP \ 27800008$0,000B S8 $ 0( 00 0$01 .+04000 00 00咝@P XA4( 地000CS0(0 ,  dPP,  0:@=2 0R `54 (0 00CS0(0 ,   CPP,`P T`XP@D`'SR0000HS#SR8``Foob4( Z00S>>0 30 00C 040S4L3,0A`0 : S 0003#0 #L#32024P j0j<Ѝf 00 00j0P j4P ihTU @cTVn@AA@-0034!z?d 0 Ѝ@b0S100! 0 $ =$S 000W0 00p50 00Tp4$04L3 $2   0: S 00C03#0S #L#320C2T3S! !,ЍO.@cTU Afn@AO-4M 0`0 d0h0 @0l00 ?ߔXPL4\<$Q-R (  ?̔0( p$T S`00 Sl` Wb |%P0S 4ЍO0  0@@l %0 %000303L3 2   \% 3R0=S-T @rp0"PSX0b```X ڨ r0  0 r|0l"000ST0TPP101T3S!  !80` cpW!$ w bR0cQ4 0P`, $ T0R3, 00SG$00$04  04L3  2 ` `$080aP0\00$``Wf $P $08 0C$08 4 0S4L3  0  A 0 *%000303L3 000V(00Ss 00lRPà 0@ 0oH( 0(@&31`@cTU zn@ AGAO-p` P,M?@ᔠᷓ0؀ 1\ P$0 0 T0 C)C$)0c<3"jP $ 00\ Ó\ g,Ѝ00?0 0 ZP  0 0p `x${gTU s@-`@MPUЍp80 C0ST1UP! 0PT 0 U"000/ 0C0O-@P ` Tp Gg 0ga2cwʿឰ 0( 0 0C R S R0  ЍOFO-0@4M 02$0L3P2`VX\00 S" T .0\%t4Rk5Ϡ," T0/ C,    )`C)0c <3.i0P0,00p4 R Q\0 Q \PQ0 Q? `0, 00 0T3`S !!! [ Y 0 I00 T [  , ˿ 0 0 ,f4Ѝ00ł." 0 RT0`Y `80 4 S5F\ a`0, 00 0a `?] 80S# C$0 0$04 $ 0/4 $L3$ 0 40040T3S! J qQ`0Ss00nR31  0`0 S, $0 0C$04 $ 0S/4 $L3$ V0 B 0!0400C40 `Fq400400e!T3`ȏS !!!00S  s00`R31000,P fe `KTU @cTO-0M Є00T0@H 00p SP; 0T !_"e``0 Cc ca5bS4D $P<0`@$!0c P`U08$<4X000 0S  ?ᆑ0 0000 0P 0 k0 0L0000 0P0 0 Rh  h    ʯ L 0 000T0ЍL0 AAľ/O-`LM4000p@ T000-$40 00: S(P,@ 0'0@0,[ $ 0E? 00 00D0R ,ɚP 0 X*Q6@ ,0U0P#@!0H#0  PS03 00000%0 40LЍL P* [Y0 LԜ\*[X 0 P%Q!$+KQ3((HQ34,R8< 080 !<SD00S015 8:#Q< 0*0 0 ~0S əX! X03o Y P  Y1 Pf L320[a L$2\ (\0,QH30XM L$2\ (\0,QH30X9 L320[2 SD 0C0Af @F(/AAO-,0`@p(00P  `p L 0l7t0̠\ nQ 1K^Mt0 0/W0 0 0#Ϡ80![ K P0 ڏ @?ݏ,`ᔙ@0A ӏ0V 0SL#" R: Ϡ!800L#" R*08G-p$0P` (0@  `p L 0l6t0̠\  nQ 2I!0Qt0 0/V0 0 t0#Ϡ80!Y I100 ` P?c,`P0A Y0V 0S ?BL#" R: Ϡ!800L#" R*080O-p@4M`Pş 0%0Ł#\%4XR 0  0 0 T 0 N)N,)n"3>f0P0 ,刓0P [ 3 S ~b004ЍP3T` ( ? [`p 00 ST0Z0D` Wr iP ,Sb0 0 0 0C030S3L32  B T3S    ,b Q  q!`RR 0 S8 ` bpW 0P" $08 0$08 4 04L3  0  0 00C030S3L3 0  B W00!8 w ppbRPa4 \0$ $ Y$0ʯ 0C$04  0S4L3  0 C 0 80aSw0P00y00Ss00`R31TU @c@-M@0pp04`PP 00pЍ@Ѝn@@-(MpǮ`0@t t```PP (㹮@Ѝ     w:p0/AAA-@P 0 S 00e p  `V00 V KႮO  (A(vO-`0$MЅpP H@! 0 @Pm!   0@I PbX 0 H@$ЍO  h Y T0 T3?Q\ 00S P `0S@ $ЍO 00 Y  B 0 00}  #T" pP `@0S * 0 Sd Y @ 000Z  $ЍO$Ѝn@O-dM00@ 00sc@00PD0`0到 Cs cq6rc4D $`<0p@$!0c `pV00 00000ゾP T @)8 J0 00 0 00 00 0"T080 0S  ?ῌ8 0` 2P0)0C$0L3T $ 2 0QS8$@<4QD 00@0D00S S<0`SD@$! 0 $ 4P0 80S  I00p7`  000@ D0pP0`00<0S 00S" 0 0 0 $0 0Rh  h    $  0 0000S! T0X C)C) c1<62 8<0aX00) C0X0% X0 , _ X0 00S@^X00000 00c0P(0O (dЍ0S28 0B 0L00 ?T0 000/0S 0/LS0H0T0,0* \%5R:Ϡ*" T0/ C\    )pC)0c <3.b0P(0\0,0pY 3S5%\Q-R ( ?ịYH0`0?< 0T 400S2000 <0H00 SfL08< N0T0H Qq00 A!400C400S A40040, 0TS̠<0 H0? QmT3S !  , \_$000S h00h0 0 0000S T X N)@N)n;̠#S Rs  00ʂ*" 0 T0 4 X00S 00Q3= ~ 0 4 Y00S>>0P3w s4SP$A$ Q LP 0 @ j\P s^, 4 00$0t +`X000$ 7X0 X0 , X0 00S0(00  <0D@$0C!d 0 ஊ$ 40`R0#l00S x c0@"0X_8 0S X^AAn@AxbcAľ/TU @cTDAAAO-pἠ0P4M 0 ?s0@00 !0\%0$01R 00@o&!! X0 00 `P ? j2*!, ZS QS:FaP ,l 00\ Ó\ ]4Ѝ $0 R  X   !4,7^Tn@U O-P0@Ḡ $M 0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@P`P l 00Q Q `] $ЍH  0 0 PX]Tn@AU O-PḰ@ 0$M⩉0\Ŕ00`0!\    ?  ?` a2! Q,S QS1, X:@ 0@PO `P l 00Q Q \ $ЍH  0 0 Pw]Tn@AU C-`PḀ@p 0MJ 0\Žß0.SX! 0 Q   ` ?0W0M85p@5pL0p00W00W0S? (0T001<0&$00 `001`00p0$0d0 01010000p$  0bpPUP08 c00\`dT80< L31)l< QR>QR!<`0d 0001 O \00P 1`80d0 L pl<000\0<827,< P0 `6:d000000 0 00A_pPd0.T0<d Cb0)C)0cl1c"8 <`_d0!0?o!2R0S țpP 1[ЍY8u@%@4L0pp p0W403d000p0 0 ^pP@d00T0<d C`0)C)0cl1c8<`dT80< @31)`0 QR>QR!8`0d 0001p(0T80&"00 `0010 0p0$0d0 0101040p0"  0pPP0405@50%0L050(0T00 `0010 0p00101 0 0pPad001p 0 0T0 C)C)ct00<21 0P0 c0c Cl1n1s V  V  Rh  8 #.38,P0^*85 @5 L00000 00R  Q RM (0T8 )\5S0 1<0 1<00@00 p0010`0{p0$01 01010000000<00@000pPP 80 B2 b081") !᎗0a''0001S 1$ E[ Z0P 0 `B2 b6<>"p0X Q0 :1S 1000000X8e@4 L0```V 1S 00`0 0 ]p(0T\5&S0! qq p0@01 0 0@p0$01 01 010 0`p@upPh''000Q0405@50%0L050(0Tr0 p0010 0p00101 0 0pP=1S 01p 0 0T0 C)C)ct00<21 0l0000 0 +0P40l00Cl00 0!00n(0T)1 `40H0 0{p001 `@000 0 0HHpPx0"d000 000tp`0T0x`| C)C)c2160" * EpP dLZpP0 0a0T000000`Y_1 1L00\̘Pc(0T80 010l02H0 0 0_p001 01 0000 0.0P(0 dX(pAT3AT00p`t@1S 010 0000T0 C)C)c2160" 0pP 00(000l0 82H08 a!1dpT YNX1S 1h 0  000 0 0[pPSh0!0 0000T0 C)C)cL021800 0 d 000 "00  PFd0p ἐ?(0T0 `C0)0c VQQ? Qt.. \5 ,S 0?!>  F 0f Ϭ2fXd000 00 00  0Pd0+ XJ?o< 2 R0S R&0 T 000<0嘠`l0Vd  0  2 `PdW`W< 0 bd0000000%F[P ƾd H00 1dEX000" 000 G4 00040S 1S0!0Y@ P0 c0c Cl1n1s V  V  Rk  8 #.38,P0a*85 @5 L00000 00R  Q RP (0T\50%S0 1<00@00 (0010`0sp0$01 01010000000<00@000gpPZP 80 ` B2 b081 0嘀 00 0p !0001S P 1T W Z0P 0 `B2 b60>" pPB Q0k*8e@4 L0```Vw(0T1\5&S0 @qq(0@01 0 0p0$01 01 010 0`p@pP0p  1<00gTQ0405@50%0L050(0T0 (0010 0p00101 0 0pP1S 01p 0 0T0 C)C)ct00<21 0l0000 0 '0P40(l00Cl00 01Sg(0T1 `40H0 0p001 `<000 0 0@pPx0d000 000p`0T0x` C)C)ct02160" * pPdVpP0 0a0T00|0000`8pL0d000000 0!mYpPxd00H0H 0l0L R 0P00 U0P0`040pT0x00040<0@0P dUR(0T41P pl0R 0 H0p 000 0<@<0@ 00 0 0<@p001 p 0000<00@00 0;pPp0h0000 0000T0 C)C)ct0201<" "8pP0 dzU080Slx`00V;:40S 04 h@hh0(VpP080L S0H 8001d VrUp10QlPx(0TH0 010l02H0 0 0p001 01 0000 0`P d'Up0 pt0!R  !  0  T B)B1) b082 0 pP 000004l0 2H0H UIT1S 1h 0  000 0 0bXpP l 0000T )B 0B) b830 0 d 000"00  }PFd0n ἠ?(0T0 `C0)0c VQQ? Q$?1.*\Ŕ0d\ !Ί  0 F f ? 2fSUd000 00 00  0;Pd0) ?UH?o8 2R0S R$T0 00080嘠`l0Vd  0  2 PdUT`QT 8 0 bd0000000%FWPd0H 00dT|000 000?4 00040ps4pqO-@P]~(,`PT:ppW0 S0S ⊈PZ@V 0000000@@000@@O-pTM`@ @0SG TЍ@T@Y@T  r"" ( 0  (04 0D \ 0S,0@0H*0 0:00@0圠<0 08000  R0Ȱ%d*}P# l2L \NS@QS 80 P@UP!PŸI͠ӈ$ P 1/PD$0   0 U$ 0 S$080\< 0/Q \00 T0 P@ \0 A!. a4,AS ?0$0 00AQP0 _oRYP$ TU000@Q9  @ PQ;Ã9ʁ0ˁY @0 R 0@@DT@@@@ွ88@5L0b@bAO-需|M00-P p_0S0 000bP|Ѝ0 00\@000S/0P35:080EP0X00 \00&2T$00PT@p00h@l0 000<00@0h0S < d\`/ ` V[4 P@P RU $1PP e2Š U^Q^ L E @e 18E \H(@@EVO@%0@( , ,0 BZ!0 4 ? [0 [ƿ 0:@@UPU@7 xR0@0(@@@ @L @ Q  E e<Š V0`H@ @ DHLD`U(`@`L`0@D TTx 0,0 X xPPp@0R@P[P$0080\0P0000i@b0   R  R *4 R@-E]A000S -/0   R Q   -//@-P`00S-@! < @P@P 00@ 0 P]@ 0S R @ ЍpO-P$M`00S 00CS 00S  R 000@Z0   P @L4 l2>, R0:0 奡@P 0S 0S@$Ѝq@P {0pJHp p G pp 뼀00 0  @<p00 @W  A H0H0P L" l1.Q0*  M0 S 0 S@ 0p@ 0 l{ ph{ W b{  ~  V@P  {     ~开帐t -@l@jA-P@00S> 00CS:< PP0Sk@p?oV20#S 00W: 0R R 0000@ R@ @0`@-A-P`00S-@ 00S@ 00@ 0 娠@P 0S 0S@Ѝt@Pp ~뼀 00 0 @Pp |]@ @ A H~Hp k@O-lM0P80000000<0H0000 00Q.80S0008 080|<Pd00`00 00p  0` PEd0 75#l20l20$ ;60 0ROt ?0 0 0 0 080<000P0)#00idAN@Pd@P dOlЍd0000S0$000$0?L0H0SP0(,0 0d00 ,0~<00t RWdP0, (0S,0$00$0t 4pLT0?X00## `0`V(@1@pD40<0@ SP0D 05L0 R00S 00S$01pp0 0 80000C0 0{ T0 C)Crq)0c9s 0 p@h  R$ !00 R4 $  * 0<0S04 S400S @" 00 0000S $0! 04 A0T 0 0X 0 0pG` 0@00S@0D00D0400C40}Sڤ0 00\0C00 T0 C)C) c0<;2  0@P\ ( 0T0R0S,0S @0,=o00? dN(@(@H0S dOT@@S@brAA-`P!0[ @pWw0 Wp0 P  $0 Q D 0! 0V`0 P ( ,0 Q @ @0D 0 @0D 0  UP0 P 0 40 Q$ H 0< 000000:00Ѝ    G-`0M0@pP 0 v00Sn p0@ 00@ppp\%1R,5S0 0 0 z0 o."p1`\%R  0 ? Ϡ ,2 `x 0z`0 C c00T0 ` C)Cba0)0c03"Q0P   \Ŕ P\x 0@cz '|W N0Ѝ0  Oz,eN0 TTO-]M 0 0$0@ C0CSRP]ߍ0S1  ;100`pS00|h$0\5SB\\?@5D0L 04;$Z$SØ,.1  0 Su0R:$SZk00S(pZ{ 0)QY 0000 P0  DbP<,\(Q?00 \P0,Q&/ 0$Q & 0 000PPr  P(P(8Ŗ0 @L ,QYP! 0PS 0 )R 0Z:0 0 (00$01 (0S$0 0kP0( $ c2# S,P!Q$ RQI P S1Q\Q\3PR= (08<$ $0 H0ï (0ZX/  010(0  X$00 ( $0O PP 10( $0Y F #H0d( $ . ?z 0̉ 0 S100 0 PP 0v0S ߶ 000000S0    0s0 0PP 0 a? R02! Q., S,Q, US180,08 0S40800<0,0 0St P0T 0SX0 0S`04@00/\d ` X  !!@   L/ X  !P0Cs@0  ^  !4!¯Y<  Y ^P Q  !P0 C 0U00 0|P 0Qq1(( R@ 0 Pe1XXϠQ(0 0$00 0PR(   $ $   0, 0080p0P0U0 S0&t P0 00Sp00S/0S tx0| \%0R  ! 1( H  0 T0D C)C)0c:"@h0 0P00DQ" 00 0 0800S00 0@ 0/0  X* 40S<0 0"40< rs \%5R400 0!! 0 40 S<00 P80, @0ᜠ `9;8^0D:0 000000S 00000 0040 S<00 P08, Cᜠ c3;P0):00S1=8% ("6600Q$00Sh 0_P 0 b R320 QP1Q SQ ☀ PBᜠ b<  XS:0 BZ%Z b^3P2Z0U P11(0 堃S$0  0H0(P5$5C2000 0 0E00d= 0P0^PX 0/Y'0%0 0 0kPP  0 S100 0PP 8@L0    1ptpt1Ԁ 01Q00#S $0U( #PR(0 0$00 0 H000 0R     L   0 Rh  Bh    R  ᔴ000b\%L0R !0 !07 P L l0 ^85L50% 0@50 0<Q Q0000 0S 0 01H0L 0ɟH0LX8L0@85@50L0TAAHXp<Q Q000 آTS0 ?H0L 0ȏH0LTPP 0 R !/P !!0/00S1/P11/A-PI0pMT@@P ` B2>0@@ b@ "<1@P 000 w9S$J@ЍGG-p0 `$PH@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000倀tGPKC-0P0`pd@T 0 Kp P ЍT80< @31)` Q0R<4Q0]@ 5  a3SxlØ|h3 N,t3 p9#$+ 00Q000Q 00SQ  B2C 3R0  sP% 300W0 0$ 00Rp00p0 $0Z @o0?@0\^ ^ CP00 S 0 V0   02#2L0R W00` 0@Pt 2뜰40 00800 0(f@P#1(#1L0R5z40 2&C:FP0& 0 # 40 02 X c ( T( 5 ]0S 00W 000S X  @40 @20  0 &CIK@P4 00"X 0 ,0,,0(G( ( &$ 0S( r K p  0(@P 9S 0<0S }@ T0$ S12 @@bdcp@-PՔ0P@ P0  PPPp0@-@0@㹔-/p@-P̼0@ `V  V 700(,PE ` \V0E/ !SCE?000V `S000p@\ 0O-DM( 0勼`(0 h1xP 0Xr QRsQ0 S0,04300000 `$0V@Y W0?R0 r00h S W0( 0Mh0 00Sh00h0 00h00009S@ 0<@T @;00wOo,tBDЍnP  B20< 0 b71" 5@P 00V,TZ t W?s<00 40$0 0R40 <F|0C0'0S 忭 W0 0000`j <00 9<S-G0$ S SF W0<[F(000 0<009<SGYFW W0<CFZ 0 @P  ~ 0  @P 9S 0<0S @Tj0$ S00@bAO-P,M0` k3300@ lj pW U0 p00 l݅` @ `Ό4\P0P  004Qh0Ah0 0c?0P B20$  b41"0 1P 84t<$0S Z  X$Ct0@|00 0P^00*`0 C# c.4,3RS" 00 00CP  004Qh0Ah0 0c?0 0 $0 0 S  0 0Q]  0 h 0 hP 0h0@p P0PL* 0@p 0D00 B?q0T 0Y0 60Qd0X0000,Ѝ@b50O-P0 0008<Ĕ? qP0 C c00 0 ֑P d 0#0X  0 h 0S000 0p,pp000忛 08 2B00I> 0008<Ĕ?pP0勱 C c0 0, ᔑP d帩W 00 0$ <0h00000S"@bAA>AdA50AG-p0`@ PU 000W Gh R 00 0h Rh9S000w50O-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MR Pk p$`W0@*F,Ѝ ,0W0*\0Q.0i T0 C)C)0c03"@Pd 00\ Ó\ s=xo=0吸(X0: 0 TU p0Sp/0@-@0M 0@0@ @@@㙜|P|0 0@0@ @@@㋜L0 00@@ @@@ ~Ѝ0@|bAdAA8 p00CSp0/@- @@|bd-M zPioЍA@-0 R  @ @0b ` 0%kЍЀO-0,M H Pņ0 `pW XX @?n /h+p+ 0 $+49@0P0 0  0j %0 ! %<4\%R0 004\5 P  0|t4RR  ډ0h0Z 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3j  ᷉000T0P0,(5 0S 0 @0@0 0T`0$S> ) %> 1S 0LLH30V)0P$T40X4S E>0X440`APLY$5S0P>$X| $Y`P FPP0 800pH0Y40LpIT0 C)C)0c 03"k?0Pb  00j0 ;80`$%!0, R0 _0PTp 8h0 _."~\5P S 0 0/ Ϡ , pPx 0h`0 C c00T0pP C)CRQ 0)0c73"?PP UP$|X0,Ѝ"   ;Ccq@ A8 TT`kAAA6A0O-PRp@;040x 4  X?0 0* $?>Pz40l0?\%R*   L&\%\%DR) hP)H  VK0P N@4 07i  P0 @R   %Rh?SX@ %  ' C  S> ) %> 1S0P$0T40X4S E>0X4h04 S:0400P008T0<P C)C44)0c"03>P440$ R::4 5Ҡ  0Z0S000004圀AO$%,0R0 0帇L0Yh$5S0Pŕ, H=h4lS944S@040T3$0P1Y1,10 1(5 0S 0@0@0 0P :> 0$ (  * PP$0`p0,0 0t D t a /o bH T  BL 8 48P 兯ZO   <Ѝ000,20V0800P00 0800S40 B  HLT0 C)C4)0c"03^=P+4 0h0 49804d$%0 , Re\4S  5  0 000V0 0 L T h4P 9U P (00:0@q@8 TT 8TA`kAAAAA@-0S0 lP@ W@P G~ Ѝ 070@P UU070Y`0u/Pp+g0Y Vo5C^ Ub@b$d&AAdA-P00`SP paV@P YV@PH 0   `[@Ѝ cG-Pp3 M/`++  h0$+4P5 5h 1 500"g00@\%R=S04, 030304040 50 g0" " 200 004 \% 5W 9 Ѝ6T8 O-,M@40AFMp PL30Uo[P ,Ѝ800`H0S40L`GT0 C)C$)0c"03 `9P$ 0f0$000S598 P6G-` MR  RPpJoA(RP@  XPU!@4 T@P0 R@j0mP  Ue 0S 0 0R\}}UU 0UL0 @p0&00 0!@OT:040000 0_PU3PTPPځ @0T0v o0@vT`P 廁 q|RP 0M|`P=S 0 @P=04=S:0 0S#0SM@(0 ^@PP 0 0S 50ó 5v=S  0  @P Ѝ 0 5< 04!4000V 1 J00S00000\4S Mu/V~1 5 0 5=S U⦜=S 0 0C>00}0SUT␜010@W@U@S@b@`kAAAAcA@cAA-@`81pP〃P 00 pP==S GP0 <=0S WӀ= S冋{$%0,RL1&h#P T;T000:0@bO-p@P=MS =S  STxT`@` SP5ST 0 0T RdX@X Tq uP`=S 000C^  P`Ѝ R P C{T0P`#{ 0   Fq@A^0@cp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0ᮔP 9 ;909  000&00P囔P 9 ;90[ 0 }00p!1/0  J00S 0 Ѝ0Z } W0 0 00ЍM/O-0\M0,0 0 0) 0% 0 000 ) S RP0Sc0$0$ 00 0 ^0W:$0S$= 00嘠 =<000H p  (00Z08@0 @0<5  L8 $  P ࠱DZHDP `l:l \kWhQ VW08 l \0  Q^̠^Q0 ^V-  0`X V%  0xr(0 V 0,000 0P(0S #H0 .`n`@ ?0:P00S"<0S #H08<ř  ß   . ?ٌP0S 0)㛙08%0`00`F0 <V`!V 80DSL000 SH00Q0 "66 00>00S`00000040"R4 0 40TqTQR(0@ 0,00 ;P< H0C200000 0'"0R4 0 40q[ @0Sg0H(# 0C8RP\ 000 #8 800#(0(IPI $00,0 p-\ЍḞ0, 0 ( @  1/ᶞ[ !p@- @P剤 Pp0p@0@-@Ppx9S ʰ;S  0"`PQ 0 SL0L0DF0P0 0 6 Ѝ d$ddO-需LMP4  P3t:Pq R0030`5805N:dP `< . PS!QS0 D p@ @`>8E R@(@@@Z@@O:0@(p ,,p0pL W p!$Y0$p Y$p B:8 @17P80% @DWT $@0,0 $dP 838Y 0嘠0 0 Z$   0 $ R0 8P 3 45LЍ(@@u@ @Lp@  ^ @ `Z>*(@ L 8 <@ @<6O-@P `R0 pM0 ЍO= 0 P0?:P= 0 6S ЍO&0\0'*㸰: 0 0S  ŗ) R 0P0 1R H0 C200 000% P0S  ЍOЍO-需,0 0/\*0 ,\0 0 ) o,0 V00P `0 B2>@ b6<bP0:0`40 `FV`00c@P 4v2" 0 @P6<Ѝ8e`@`L`(04S "3oTQ 00 0S}02@-P`Y@P0 0@P    0 P嚎0 ⳇЍpvdG-!0P`XM!0 0S  XЍG0 ?^0p p 0 00000.0>000 Ӊ@P: W000 09@P-$T 0S) 0 H@@T0S3 00S00[@P  0  0@3 200>XЍ2 /pP 0   00U/@Ẓc@bvdA-@P0@P l20 p\4SQ^Sl4̠  ^P @Dő L0 ? 8<őH 0 ?00@-~ 0`  p  t 0 @  y[ i@P u0` 000 0X@P|u/V*Bv@t@b8db@dAgAP P /@7@b$ 0R0/@- @F8d@- @00CS0v@8dp@-`PY@P0 *@pO-pL@P"0D@0}tPY 0@V0,cL@bAMBBd@dDdHdgA0S  0S 0@-@@0S  00S  /00S @-/A@-0  QdAp@-0@P ZP Z ߖ 0p@0 1/6A @@!ep@-`Pd@00`L`F`7V Z❐$| 0p@0 1/8d<@@!e@-@800$  0S0@/p@-P@0S 啖 rP P 0S80$ 40{]00/t #4!SpP00S 0 8厔0 ZbA@bdxA8dA-p`P렀 Z@P0@@3 S@P ZP T=f$c00 Ѝ8d@bAp@- 0P p*\Œ\\p0QpVQp8LP8840=40 0@pdbAT0;cMBBDdH;c- P0 SQO- 4 R 40  #H/" R @RP `@ p`f9gpT@TP^ Ѝ`n``p R  ^n  ` S^ Hp@D ` P`N4UQo @`j `>i ^`  R ^ 40Sp4O-|Mpᜠ0W@P娐`$0p 00$0c0@0 T 0R*Y   Q L B Pb<P" P VUq\PMPP\I 0 00|ЍP$8(L0 C c2#00000P C R 01!01/P 0R0*@0 @!0L A1 a<20! 0 U8PY40 0P00 400Q00000 0P0400CS403U -0Y 000 &R00S P0Y00L0 C# c 9!300 v0 6SnP$8(L0 C c2#0g0!CXT 0 003 UC0 0000$000 010PP 0 = 07L0 C c#3800 9!600< 0 ᷄|2#l20l2+P  <-*H( ( 0 , c+($(0, SU( $-(  00P 4'0Q0YW@ď000\0@00D0T00 S00!1 0001/P0Q00WS@ď D0T00 S0 1 A1/P 0@00 0 W  R@ @ CP R ' '1/P 0000 @bc@-0S    P (000 00 0 <Ѝ$0 p@-0@00P`06/ 000`06/P Nq00pO-`DMl0hp$00P$0Bc 00$00 0"R 0 01/0f? 0004 0>0 @S0$F F6S0JBS @,@Axy`F`$0pWƟ ?$0~1 0000,0 0 0Ճ`P u VyDЍp 00 t J $   01/$]08 0 ` 01/,Q %P$`$0`S 6CP  8?P<0 00ã 0 QjN9NvN\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S$ 9S000S0(0)9+ 00000 0000 8/9 ?o209S%0 0R RVoBh 0! \\0`堐DHy hQ Ѝ!x@AA@-0,@00V@"4/Ѝ66$A0@-@ 0@0S00000@@PD @DPPP  00^08S00P0000VA^AJAA|Ap@-@`P(0P0  Y P bX00 0@09#60pO-P@p0 l0{]Pl0740SI 0SF\0X080L0 000tP (\0S| 0 ST0(R00St0,00 Y0X$X(0h0@0C(0(X @8  X Q :  0  <0S\%240XS@@)@@@@R0*#d0@圀0S0@ @000t(H0S 0S0X 0c0T0(0(儠0"ZQ\mx`,0x0@00 /)H0S@ 9S= D0 " "}P@0S $0d `0T0 0X00L0$0 @<0P0Ѝ|0XS$0 80LJL00 L0 0 S 0 00SJ E x0n@P@0SD0  \|P@(0(儠0"ZQ@  x0n@Px0, 0| x0tn@Pw0SX0$ ( 8  C(0L 儠0"ZQlx` xp|@P9  0 0  0 `pQP @l{hbjAuA@A-Mp@ `0. 0?PP% 00 T 9 0C8C890000{0TP00 0 9S00003/Ѝ0 B?PP 0R    A-Mp`0@8PP%00 0@@ 0 9 0C8C890000r{0H P000 9S00003/ЍO-,M00`p P0 0 00 P *0 P0 00000 0 00$00 ?}@Pj@0$P@T S@@@@@ⴀH X  R R& 0b[P0@X@Ǒ!$@P@ T@ S@@@@@ 0IT0 XᴐǑ@őPS "440 T z0@P00 R ?R *  1/,Ѝy@AAO- 4MPRX0U0 ` 0删00Jp ((宍0 T @?4/@P7 0 00\ 00000)Sc@ "4400  00C00    vTtz@ N0 00P05/T@4Ѝ 4ЍOy@A-DMLH ,  0DЍ y@@-0"GP Ѝ@-0 \ 0 00\JЍA- MP8@<`P^0yᨀPPP)0P p@`B Ѝ 0 }@-)@0w Ѝ@- @ 0  0)0 Ѝs@-`@0 0APPPP |L0 00 ЍpO-|0p s`0$H @4  , 0# #88DLS 0 Kr0 0 p@PX0|0#880'00 Rd0X00$00|0 *P\PY)Ѝ z0s8 0@@z 0 { @*0 p@P 嬰0 Rt 娠0 Rp000*P\P)"sr AQ(00X0X0 0 0X0-@^@P#sr`?$sr;&sr7x@ 00w0 ?P *a00)0 p'@Pf9:(0尉000尀*P\P(K00C0F  0 |@@ 0 p~@P6#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P @@@@A-`p0S t 0d0 0 0P0 L\@P90VdЍ@dO-p 0M0i@PSP\1)R`#@#H*H1 0`@B0 0u~`P@`89 08C890 000000@04/@P 巀  0 @L$@ ԀT` 9 0C8C890000vV vЍLdC-` @PpTLp T, T4000S-@ Ѝ贀 r@00@ M   bCM 00 0P @ 儀 070 @剆LdAO-34M`)R@#*p0 Pሐ0p 0Wf@P 0i@P0 d0p4ЍpP0 000900 0 00Qd0X09 08C890 000000@04/@Pd 0I2(0 0(0$00S0Ӻ20Ӿ1ш000      01/@PA/ᘐ 0Q  000)[ 00Lr@P&0 0009/@P  0 0L 0@ Tum9 0C8C8900000 90000HcY\y@LdC-pP`UP 0SQ9S B@4c Ѝ 00"P 0!@0 @@ 0L@P  0e'9 0C8C8900009 0C8C8900000 00 -  01/ 0@'b@bO-`!pY\M00000c _[? 0 0@00#3* Bp W00?k@000880DP4p<@@HpN0L 0800P 05/PP %k\ЍHP0PG0 0k 0 [$0 2 #"0P @0 00 0U* 0R Sm B PS.0@0D 0 DNP000 00S U0 0 0 0  jj0 0 0\00#0300S00 0 000ź0 000,0$0S:00( K ( ,0A  7K 0000000S  1!  0@0PPgꫪ@- 0 RR@ @Th R( nN@  p  R0  0@/@-0`0CSxG8<)Q\8RtPP PKЍp#sr$ 0JP<0S:P`TtPP0V0 ": 0S`9`V @P 8003/P $ 80 @#1/P  PP$ 80 P0@#5/PP 0:0ZAc@-`0P@ "6000 00"4000")`) P*0S< <00 13/(ЍpAA1Aȓ@4 e@0   000 0 01/Ԑ@@!e0   0:0 0 01/@@!ep@-P@_Pڈ000`0 6/ 0p@0 1/H@@!e0 0000 001/Ԑ@4 e0 0:00 001/@4 ep@-P@^Pڈ000`0 6/ 0p@0 1/H@4 e00CS&\000p00|00000000000 0X / 0, 0 0* 0+ 0 0/0)H-@-@`P9#61S0 S 00S0( '0`S (0, 0C0000N0 @00D0@Ѝp贎@O-M@P$p`ID` R?PoUЍɯ U  @@H 0L @ 1/P  0 0P*)P !PU `0 R0: 00/S/0A-P(M@ 0HpLP`Ѝ 0@KT T hy000@0 4/0V0/oS" R(Ѝ000@YAC- 0" M0p0L @P. SEP`0 R'0 S (p8I0 `0 R ` 0`0)W0  @H@00,rT _Ѝ 0@@0 0$000 0 }@@QA   /@-@0-(0$S, , ,0( d@Ac@-@ P {0800,0$ @R(( ,,0EAcdS/S  !!0/G-``pP |{@P@P XP  `g000 Qpq0$0 PgP gP gP gg  o{X !9+dAcȹd@-! @P  ! H- $MHD 0 < 0 4 40 * 0 0 x$ЍAc0X0lAdp@-@ PQRgOg Lg$0@sFgp@ "{dA- HP0D`p0C ##R@`V( 01S P b`0D1X  Q R 1P O`0Sp@-P@P p@0! 000CS00SP0U:00p@O-0 0C0 0 A < ; < 0D0 0`0000C0sAzAp@-P@ fP$0$0p 00 $0Cp@A-@P`"v$0S000  A G-0P@Sp`P0p0S(W !R 0 !V R"*0PE  1  BS !!  100C000CS0-G-`@$PpT T0 @0  0 TЍ0 00S F0 *0 0C%0@0 00S `G0 0 0C `  0 P R0 0S  f0@G-H`傊p  V@ P B5^:4\P`R  \ #RP  V 0S*0S    0 D@PH00000  #P0S .v PPL0<0##0S000000 00C0G D  !! !R   1   0 S  B!E00CS0000$00Cs0 D0HPD0AcA-P$0@S`p000$00Cs0 AO-pPH@,MD`U0P 0H(6 0'60(% p00$0s   B0U C S($00Cs0 |P,Ѝ 0 B00 0pAY0F0D$00Cs0 _ QI$U@ q S0}0 $0C000qG 0  C 0 $ 0$  C `G!E  C0 R 000D! !00SPÎ}d 10$00Cs  [d  Wd  Sd  Od 0RS PYY  0@d0S :d0S 4dZ  /d PQ0u 0U 0C $00pB U  H  !E00 0U 0A  ! D$0!DU =  !D0Y$0? U7  ! D$0!|DU$L  R0 B0 0C%A Qʸ 0! 0D  0!0 0!D[0$0U% 0 P00Q 0Jc c c0Ks c0 `C0 00C 0pG0Dp0C-P`dMp1ȁ̑@0%T00SdЍ,0(@0P,0Ѓ(0,0(0SX0(0X , 0(P\0;P0 (0SX@ @S , , , P0X0S\ , \ 0P0SP0! 0 R00R0S"000Pr0000S ?(0X@S, , , 0X0S\ , \ 0UPAcdA 0 !6/ ! !Cp@-PS`@!V 01P 0 ! 0ap0 1 Q000 !  !AR !  B /A-p@P` 0 00A0p@-@P`0S00p@S000 p@0i /-@ $M0 4  *( 0 0 00t$Ѝ1Ad @-)vP00dA-PĀ@T 0S 0p 0S 0  7`P@0  0S; 000C0A A-PI P P MPp| `P @ Pp p:w7B77T A@-@ PO0 0p@-@PT+ 0S Q 0`00C000P 000=Ap@ Lu 0 0 0p@}M7 0SK%ddp@-P@ 0 0 0<87PYp@` 0s/ <0( $ A\ @-4 00A A"1S@ ^\10,0//O-(0Ip"AR0,0Paq>4`0AAbAT+W5 m@P`- 1@ S0@A APQW`pV00C00S0S H  zo YZ @V000`@AcO-tMp0圀P@`@ᘠ) ` 80 S6 ?9P 80`1StЍ"PR0%VZY8 0`0 < 08 V80I0 08P "SR 0 !5080S 8 0J0 0p `y8$:00@ 000R   06P VB; 0 0 0X% E8F NX PgN 60V  7 !A!8h0 Sw8 Jp@ `tAAG-Q`p VZ'v( \A0$pp P(00@0?o2X0S/ $ AP0# pB"   40V0X (00(0XH9`$p@p P(p@.`,V0h )/Y Lj@/DP ?@18@AS8 80< <@@uddty@@AcBc@/0@-`0ML@T LPL   @A0 0,0 0X0@@jЍ0d@AcA @-WP@MO-`$ lM@ ^0@pP 1@N@pP0 * 0w$p @v$zF  YlЍP@p  (A70I00 007P?97(, Q0   4,7 /7(P, ZY 0Sllmy Y 4 4 4 R ( ,"&{ 4A Ay@A A-?Pp M     6  %:&p`@T @0 ЍM44C44 0D0 0#7O-$MH L $P!AYp[ `4!C20(2>B"  YV^ |f$ЍO"0 AT  QPP SPUR QP  RQ  R R  0Rl0@P 0 L000 A`P X0P`@ď T0,0 PL`@$Ѝ蠬d@Ac 0s/@-@dM" z9P2!@幼804`S< (q< # 6 0`b6PP60  N $0AQ0%4 0T1.Hf^dЍ 6 0  V35(0,#6b3,G^@Bc#AG-q a@QU|圼`}|@8PU vᎼt"AR0@4 R`001S B YXP Q00P `[V U U,0!Y00X0S `"V0P `U@Ac@BcO-@M ` @VsC f %  ! . R0 J>  0SI!4C    BR - 00> $!*%  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ <P 2 2 2X    0 ,  4 @, dZ>G- P@m  i U `D`(00@0$V0:Ppq$01S0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0p+A3AdO-4MX 09 98t0:cR 0P;?d*%(0$ 0AT,0@T ``DF`pfW 0 0 03*$$ g(0S, , " 80S< < # 0P 003($ Q( (( ,( A( $,0S8 80< 0@<00"S040Q,400400`0 000000000\0$0`09 0*@"*0 # 30 #6:,00$0 0! 0 0*Zh0 d!<!0 \    ,  d . 01/pPF 04Ѝ0U QZD (@J 0B!s:d0 R j R 'Z a R,d36d0$0 P00 p,0W 7 0h 0 0,00 ``DF`fNdbZ>CAO- 00S #6:(00  $ (01/#P1 0B!20S@(060``0T:0<Ѝ0@s 0,  0J0S Y7 rP, ,T20 50,$02P  , / $0  0  ,0,d0,G0,0, Z 00 0 0dbMA0@-,A,Q0  M*[P & [0,0,  P0 P0$( R*0 000 t0&nP pt ,#004 ,0  $ 0,,Ѝ0@Qdtby@WA8d#b|A@1+A/O-pP@@0T00S  , 0;(0  ,0`TPE   <ЍO-p@P,MP` V,Ѝ0 00 `q ;0 T0@P`F0S/p@-tP@0Sp@8 R<<8< ( R,,, (  d 000/C-p0@嘁$MpP`p0p0SP0  >P0 00PI 0 R0! $  4 Q` 0 H\ 0{5/P2H\ Q \  R00QH0: 0 S DI!P R 0H0{RE$Ѝy@0@- 0 ЍD%1@-@ 00 0@[s@-@`P 0S0C 0Ѝp@K̷0 00B0 `(0S, , " 0 `(,Q)0Ѝp@YBcA 0 嗷@dBcRp@-@P U Tp  p@O-$M00`$p` H @" @P 0HP$Ѝ P(0,PIPP0#20#000V P0y0 H0H V00S#1s L0 00sDp l0 40&  cP 0 PN0 HZ`PO-8`Cp@P@ Ѝ$0!SS 80  ut U0S10 0-Dp JPXhh@T00X0< P@{( 0#"SR3 (@00 00 0Mζ0 v000QP (0SR0(0b( P,0,S(0X0 000 <6Bc@dy@A@-@P  0\9   0R  0N9,0 34100S/ $Q 5/@bp@-@PpPU  p@ p@Rp@-P@ T p@p@-`$0S 0$0P@UP   09p 09pO-M00pQ`@HPrPP U @T00@P 000U## 0 @/.P@ 4P 0%8 Ѝ&8k2U 0*0/0W 0 DL 0D0 00@AO-M8@0PpH// `+ 0 S00P  `P Y ,,,, El4P ` 2`Ѝ0S ,,, 0  k/(0, #60 6P ,,,AO-p00@`0PH+0 Q0 00 0`P ,,, 4P ` 1` Ѝ0S ,e,,/ Z |6P j,9,v,Ap@-@ 0S 0 0P`(P   07p 07pO-`P 0M70pS3#d2`200d2`2U300@T 0S Y@)T? 00  07 [- r 0`"+9 Rn [n WI PrD0 0  B,Y A1Ѝ 9!+Pb 0U 00  @@`,@P  - 0&\7P3PL @0  0N7  fDp  Y Wp+t+W++ D  7.Y[ U  0DA'V  0 7NpMp p@bAAAA-@P0` 000U {   pP   00CS0500 U$p p_ 00O-`pM$ P@Tr60`0a0b000Pp>0S >8"< 8"$!< R$! $!}:4P8<040P0 H04 8\ P 4U@d\ b  Pc a\cb R t p  l 0 , c R$ Rd$4+'AdAЮdA dd.7,7E,B4dOA-, N0RȠǠ̌' @N@  0 `p0PP ||Xi000xUYOP(0 A00 0 P =iЍy@AAO-pP1` 10@0A@@00 ,p0T0W) g ЍO 0>$P  $\ @ P$UPp$X w$ ЍԭdAAbZ>dG-@ጠHMT:HЍPp000!PpWZ``X`VE$W@ #I$`Z>@-. .   Ѝp@-N@N@`P@ o p@4  O-@@0$M^00`10 NP  ^P  P(`00@p5ApF0Y0`$Ѝ0  $0P0S  0` <+P D( zI "@0 jԭdbZ>IAO-N@N$M@00Pu`P%pİPAeX0m0 00  00]$0PU (`0 `  v$Ѝ H W"@0 zUAZ>bp@-P`N40@N@ 01 p@ubZ>p@-8PPp~w@zw0P3#pbG-p`䀟V@0 0SP%PU!0A0 0S0S  A+  0S 0S0S##U E`FP}P 0 >ZAA-Pp`V W @$T@A0S0S"000""`W@0 0p@-@ 0H.   0R  0:.p@-0Pp0 b"@"0S d""o"Rp@-@P U  p@O-VlM4, $0 00S@lЍ40L0,0P00T040X00d0XPX` PLXo@$0 S 0$ 0CAP0``X000 00Cd Sd05$0(000 P(0X00\0d080D0<0H0S  0008 R0K 0H0S aL_X.7Sd `0< IpP] 0@ P 0  Q 0S `0L$ Hk@000p >`0 HL P r #Rl4 0/\ )Zf 0 6C0,0 6,0_@0S `0HL?$0 S @v0S!000!!@ 0S ( `0R $@Hp0Q L@D`0 ( I @,0DHD0H 1/Pb L`0H I"HD  01/P #Ph2 d0/ }LWX DD0 @?D0 0 &X `P 0DAP LD 0 5!D DA!D 00 0Y D 0  E!iCY 0 "D'P EYD00 ]0 ? H@ 0 pP0 pp0p 0!pP 0D00 0    00@ᰩ000&# LKD &LP T ( H)LdbcA AmAO-4M\$0X0 ` !+PXX0U@)X0 pCW6p  $ ?0 0 ,   @ 0,p4/@P #T$ U  Y4Ѝ v,T  @T , !+1 0   "@ 0/ PbvA/+p@-,P,@E0 p@@CcLd z@@-`@ 0 ````"!PP 1" 0@0 0 00 01 0S g!ЍpA-p` 0 pppp @P ? P!"p X 0; 00X000C0@ 0`; 0! 0XD0 0 (XHW1 0S1  ( 000LЍ@bb 0S:0P//0 R:P3#//p@- P@u00^p@讨 (^ꀵd0 @0 p@- 0 @`BH0PS   DD00 $p@%p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`S<Ѝ01Bbf1AG-M 0p` @`*P0 P 0 0 0 0 `@8?o2P0S0S 00S00Ѝ R 0000 0sZP b0A /R0C 0a000/P @-E]P010耵d,p@-@P` ! 0P 6  P R0C P 0C0060@* 0 0T 0P3#pP 0Q ppHd 0R  S01 R  S0100S/0/-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B $0Sp@A-Pp`e@P )0H10@0P  0 A"&D)$P 00S 3/000L00L @ 0@A-00@SP  Sppp 0X  S```%0X   B YWW 0 R 00W K XFVV 0 R 00VA7A-@lp`0S #S Pᤦ0S I\ڦ000@bp@-P@IPp0S p000p030/@b@-P fCc0@-|0$M@0:lPl 0@@@ @@0P Y@0 00@@@ @@@ Y$Ѝ0Ad\bAA-P`pP @)0 1000000 @ 0@AA-P`peP @(010 000P 0 0 @ 0@A0-0\ ^^ P Q : Q*C-p @P(P Ѝ`0S 0W  0S0S$0SH0SU % 0QP0  00 I00 P000U X `F,p00 `p`` Z P0Q00Q0000C0 00 O-0M0@0`S@PT @` 0 Ѝ< 0R:)=0#Z00S   X < V@00 R0V0" 0@ 0 0CQ 50C *0 0 0` p P 6  3P UV00000 0U0 0 0@S0#03R0#S  000 0` ip P V00 0S0 PU 0S:p 0 V  P%W \ Qp!*Q Qp!Q:W  Q *Qp!*Q Qp!PS*QV \S:PQN*V V  BS  S: 0 P` p: PP0S6:0P V 00 0 `0C 0 0p" Pt V0 S 00V 00 00C 0P 0` p P 0S0 SS:W V 00 00C 0 0 p Pp= 0S*VPPV00S  R*0S*V00PO-0P@00 T@20S R 3/ Ѝ<0S ꨥ11111 00 0C0 @00 0 O  00P 000H0S 0@0S 0 3@0SH0 S  S 080 <40 0D00000 00P 000HP 0 D B"&0DH00 $00S 3/000$00bO-2@M `W0r   0PP 07/Ѝ4 R 7/P@QD0  | 8  $QvS (0r 0 0 HP   R^ S [ 1q30000 80P[ Pq /0H0S 㘿 DI?0P  0  000:#:00 00H0ѿY 000 $0 03/0 `F(,0`0` 07/ Pm0\ DI0P0H0奿h1d1@bd1p@-@P0S@ S dR003/p@ }`300CS0~A- 0 ^: 0R:  0 \ P00O-i`0@@ 0 (0 $0"` 2 Q?Up0 0S?#03@, 03030300ߍHddG-M`p` Pf0  喔 t1Ph1BU/PBQ<R” @Z ! 0L@CT04 ,  0000<0@0D0H0P0008  0000000 0Ѝ41L0 0S S 0CS Ƞ LȠS (QP0@HDH 1 S*N]c[cbHd0a/Q/0S //C-Mp0@`00 0` P0 P 00 000 0PQ?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Rb*^ 0 B 10^ 13400,0堰0#3[ 0I: $ ^^80@4 60  0 BP Y 0 03/:#:S^X  0  0D %6SP0S 0P 46R*@0 x00 0 Po 0 iZ>@bHd0ʠ,ʠ 0C00S >0 0>000< 0#03\03@ Q03S/O-@$M:#:S0>0>0 T*4!`#60 0 0 PP   VP000% P 0 0$Ѝ R* Q R: R ! 0 $p  PR0T :0 000 R R:J`H[ NW I0T:W 喺[ 咺[0!W00S 0 (,0 D 0 PJ` DDP QPy@O-TM( 04aP40< 0TЍ   PHL @\ 03:N@ @@| 0C400 #@3 S:<0S03:QT0Pp0@0<0  P0P$0 0 0(0S 80 0D00@00<00 0H00xbbC-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 0p0s$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0   00O$ЍO-,M\p `P0T@ P(X0S0 0S0G| 0 W0w W:<0S ,ЍZ P0pG0 0SPZ p0$080$000  KPp+ZX0X X0 !0L @0 0 $000剶p! T0 00@  ,0n0000 00 0,00 0 1/pP   0tЍ P,QP,Q+0,0 @T/6 ÿQ Q $00   P0P$00` ׵0S P   p1A@-" "&*C6?P Ѝ@-" "&*C6> Ѝ@-" "&*C6J Ѝ@-" "&*C6P Ѝ@-" "&*C6 Ѝ@-" "&*C6$ ЍO-Q11@0T qs60d ,R 0 (R 8!L P b@ Ѝ ` P@T2 QE A00S00S  R 0  97U` `d /`101101PPPVꄭdCcHd@b0bG-` Pp P |0   ( $ ( $Ѝ@0 @@0 nP@ T@ T bd 0p@- @P!  ` 0( 0S嚌H0;H0&ӌ P0RaP  0.Q 0+M 0< 0000p0{@ 0p@- @P!  ` 0( 0SjH0;H0 &壌 X0R1P 0.! 0+00C0 0< 00 0p0{@7@-""&*C6@PP 0 Ѝ0 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddp@-@P@T@PpCcp@-@P@/T@PpCcO-DS@0`S4DM@0Sb D0S@^ 10ppG0 c#p -0 @0C00000@000S @0V  DЍO- ?@``X@@D @ 0 0QC$0 00002 R' 1 X1@ Pp T Y-DЍ@P0@@   Z/   @RT 5 . R#:R* @ >." @    !\PP   QU@TQDE 00 "m 0Hdd\bdĭd00000000 81nP 0`8U 0CS*rF뤀p0WW0``N@N@W\0ЍP< 0 #JbdHdAdAZ>'AO- B 2` APp LD p]W@@%p-F%@:P%q(0崁!S00@0D 00@0 61A@0婕0C@@@ r0 ᄠ0 S 0Ap3pG"@0  S0P  W  @P 0>0000000x (0D0 ,  I  ?뛩*@Ec@bIAHddB}\bdb@- p   Ѝ/p@-`P@+0`P @ p蔹d0@ꄭdp@-@lPQ`00 1Ġ  S0 Rp@E@@bHduAp@-@ Q Z :p@ R@-o 0pt0Sds@-P@ ` `"""&*C6 00#  0+ 00 0Ѝp@A-@ PP` ""&*C6 U`" 0pI P(,`0p S 0: ` S 0; 0u`P .i0{@ty@@-@`P0p0:0喱0 p[ Ѝ0 /@-@0:00M0 Ѝ/"&*C60S/ 0S/ 00CS0/@-@C`d@-@ P@ @-0@S000`d0S/@-@ P@ 0ňPp@-0P0@*ᾈp@軈Ṉ@-0@ R0 @00@U A-@ P ""&*C60S7 0☈ P  0; 00  80:0 08$0 00S) 0SA0S 0 00C0 A 0 ; 0(01 0 00 0S0SPU 0WP `V' 0S 0x0U 0  :0V81` 0 >>rRn P A0S 0 `(0` 0 01sQ9 0 6 &! R  010@ 0"61@ 0"601008 00000-`d@bCcdHd0bO-M 0DP @@pH렲2 a  00"603S P0 PYYHP PCY  PX ("($($ W     " "g 0⚇0W @(0 0p,0:  0+ ̇# X  [0L PY 0 P0 P0 ЍP  0PY T  R * R + 0`Ⴧ P < w @bHdA bb0{@ty@G-p` PᔀUY GA0Ds 0 0 0 0 0  0 0bP0 00IPdp@-0@ RP0 6@00 R /TpP00&00"TUpp@@-@@Pp@-@P0p@@-  @- { @ @- 0S Q دP0Sp@- 0@ p PoP U  0Rpp0{@000 //000/ S0/000/G-@0 P0LS#%"&A6p pXl`P ` *6/P0U00000Ѝ X`P `*6/<=`;=L:=T9=@-@QPЍ@Ѝ /A- @@Q P`Up/ Q 000  0 (P+P0@/@! R!/! !AT `P 00S 3/jW@b 00S Sp@-P@`Qv@po@/@-|@|p0 S 0S``&0000P0fQ &0( Ѝ谹dHdb0@-@t0tM@@@0 @LP @吅 @4P00S 3/@TЍ0bbd@FcTz@O-ph1,M`ဓ\1PLL1H! 0006001 Y,A   0 00  0 $$ P YY R 0 0 0勅$$pU0`$,Ѝ d; X 0L \0 PEz@bdHdDd@FcAA@-PfMD0@30 06S  0 0Ѝ@EpM 0 pCP 0S  p02s P (ЍZ>dHd@FcO-`0M  R0 Q @K Pp Y$[ T<ЍV PU@ p ( ,"&Pp@p@P0T@ 10 R0PP0 0200 0Z00S 7V  0@ @0 0T  0 Q00S+ V 0S 0 0 0 V  00 02a T 0 P0  (,,ƠῬ V ,V u꠬dld@-0 I ЍZ>O-DM `@fp PEVW0 0  (V0  CDЍpG-P@`ĐZ7p97P @P#T 0 p^Pd0@@G@DOP҃@8@U@DOoPB@FcbdAHdcp@-P 0?A3c S 0 S4Dt#4L 0 0PkPu 0S 0SDUBp40$0000 ` 0V R 0 `000@00 0S$1 0S; P!000oP.0S+ ! 0$0 0$pW @0 |101ph0 S [ \0R0S 0 @0D0@0DxFcйdHd dعd0{@bty@O-\MP P9A0a@@0 0 ( ^P b< @0R8D@ 4 R8< D40@ O p W U    ?PPE0S ~ 2(10(1j@ Z8 D @ $\ЍFcGcHd@-@e00000000/000/0000//0M0 PЍ/00M0Ѝ/P0P00Q0T00/Fcp@-@ ~P0@PD00|`HP !L0 \  h  t P 2 p@Fc 2@-@ O 000/0TX0P/Fc@-<@b~%0 $ C4X0@ S X @~FcHdA-`P' A0SH~ A R 0PA 000p6~000io~l~*0C0QA@bFcA- 0@R110@00P~P`0 S1lAF~ Q0p~P 000000/5~@3S 0RbFc@b@-p@ l\ `h Tt H < 0 @Fc\AdAlAtA|AAA/////// 01>.2h !0S000C0< 0S0 00 00000/ᄭd0b@-@P R00 O-\M`0 PSPS@#@2T`Z V0!:3A00C 0000@0  V00 [0S ` 0" "& ['(0, 0P0Â\V 0S G'(0, 0P0$@#0#6(00#6C0#60c400,0P0P00 ,0S$0S.`d\Ѝ0W,0P\4(0Sr:Xn*+@LP@!@1-p(0S`1`!@D @@0S807PpL X@1@!p)@DpW @`1@0p0S 8040C $ @@D @@ D0<0C Q<0S80C[ 0D @ 0@D  N A@ @  0K00$0[ `V`t `0S pP0T00Pp#6$000c0000c(0|0K640 6,0=P `n 0 ppppP` 08 0P00SP0TPP000 S00R0SL 00P`n 04 F@D@0@ @ @T@1T@10S (00T@1a0VSP10S (00UP!, 0ES0%#`F :0T* 8 < 08 ,00U: [@P[`PP(G|$0* S$00`F  0w  0@R0T0 0P8 00000 R0T0 08 0-;p00@0P 00S0So0P60S/Y+*PP U P10Sp!p1E W-PX PGE 0KS00 0[ ~YP1 P!Pp1|E 0  Z PP `<A K@^HdA(dA J{(d@0@ 0Q @-(7, P0/(b,dA/0@/(b/(0( 0\, /0P1(b,dp@-P`@, \15#$ RQ \$\J* Ơ     R p @T@D`@ 6,FPT,`\@o#PpA A  B RT `V`F` V, @,LPp,d(bAp@-P@m, 05# Q *  R  p\ `V`F@` Dt6,DPV,@p,d(bAO-01M0SY6p`@ VPt40 Pm4k4T00Ѝ V,0 `T%"0 pp  `P 0, S,\06# U,J ,KPHdA(b;AvAA,dp@-,`\0\P0Sp/P$ \:\*Q L p0C?0(b,dp D00P 80D0S , (00 P///(bd,d@-P@-PA@-P, 00  ,d@-P, 00 ,d@-P, 00 ,d@-P, 00 ,d, 00#P00 /,d, 00#$/,d, 00#(/,d@-@P, 04#(,d,0G-pPP% I W6P `@G$0<`@`D`H`L`#&#Q0R*D  00 00 0000yyp,dHd7@-PPP0"D0H@S 03>80=,0E$ Ѝ0000ꄭd,dAAA-,0d@ 0P@' 0`SS@ 0 0, 00P@0E$0 0  Ѝ,ds@-P0@D0S 500S| TpP: \4`A P@4,04!`P$@Ѝp脭ddz@AHdA A/AYA,dO-`p@PP2 Ѝ Xlp2 PdD0S0S X=*0<4,0P0 0! P X1pW4pGp,0`d&W,`,F@*D0S  B , $S  P P&` ,0D$H0pp `A ` ,2Pvz@|AAdA,d(bAHdAO-,MP`@` V.P 0pP@00㘠N@T ,ЍX PPE%&$ $    01/傠 00@00-4 $M  ( 000 000+$Ѝ3Ad @--P00d -dQP@- PA @Q0/S 0!  U06P`0!R0P`!R AQ:R 0 o0P`pWv#P `p S 8P`P`P `0 Ѝ U000S00Q RA- p$@`P&w 60 003=Ѝ l00S/P 0 4\ Q/8< Q<  #  H00CH0/8dHd P00S/P 0 (Q, Q/8d0P  /,bp@-0@` PU` S R   00 `800l <0@8@@H00H0pQ 0 P0S  0 %dHdP0P/@- T000 T0 @SdG-@0Q00P00CP0`wൺP'nP""R,40Xq0S)4zD140P "7 wL00CL0$ T00CT04:P2 `v000P00P0(w`0``FV`gC`pw, (@0{Hq,P` `T P%HdGcddz@9A,b 0 Cd0@-P$0M 0 0 (xЍ04t42@-(0 0600xЍ4t4200@-P P0 00 P@@ h0 00 P@@   @0 ЍpdHdGcd@z@AAAAAA A,b@d呛dS QN//O-0CM`S$@`7H00CߍPH800CS @;2;2p;2;2;2;2|;27 03/@[ 60`B>  呖0 0000 0h%@P0 S 0` \ P$D6p5 %P  @0S %$0VP000CSl=2A28B28B2=28B20=2h&`P0S |%h= W$0T T0,0h0X 00n#\,`P h@h@p0S@0P4 z4} s`+PMrP@  rT %P04p00`S 00 ($ P"ra@P [rH%@ Kr$0$ 0P0 - !`340XY Y" @0P $30X ""@P qrHt%p ?4; fj0S0F0YzB 00@2,2P0X020 0 4C#"#04>0CYCF 0TI+ |+ı !(0:@P0S& T!0S    t 0l!">P \\6-"h@Pp0`$0 @0S0D0(0(0,`Mq00000L L P Pq@Mx;qzP\tq@0@mq @@Hdd,b8;cXddAAGcYA1AeBAfAAAd AA 82z@AO-1 0S H0Sp*(p젟䰟0PU*3qOm@T P 0! 4  \ g ` 4  pV  X*8 <0R<00# H00CH08@,bHdAdGcd3B AO-0H0SG0` SPQ@ 00ppW R00S/ @T p 0$  0 0S0Dp #R<00# 0800X<0@800 00 0T0 0T0p(8@ pHdGcdp@-TPL0S@ DbpdX40 0ZP@T@@ӔppHdGc,bp@-@8`PIp@e$P$Pp@}pGcdp/p@-`LP4p@( F0 00C 00TATp@bpGcHd00 7@-@HPt@ ,0 6 @P` Ѝ0褬dd@-@4QM }0`o@!N@@ , 0DP0P3P#\P#P2U !p PЍ0Όƌ R p*p0 0P0 DPP00D@#F@oP B+00C@#FD00S("06BS-XN, !004 0 #6:S"&0:///0R/.  0 z@-@|oH0 0%@o cO-$MPH0TQ@`LpP0#0@ 00S 0Sҗy0S R0 0 6 0`P0 H00\XTPLp$ЍOO-Mp800800  0<0P<1@0I1DH00 0L0GL0P0@ 0X041T(2\00/S@)@T& 0`@hP`0 F0PT00PE 000 @P @@ P0@@@xЍ`Ps@-@P`SBP Ѝp@oЍp@- D@ P 0S1(S"3 SR~AO-0M3S `P@P1S S @ 2S t$T$@P $Ѝ22 0 00 00 0$ P $@kF  000,080400"R0pl0@0T L0L00 0 4/@PL0>[(0` 0@ QD T! 3P0P*C@D@00A $U@Wy僒Q'0&0CS$E@6 000p0 0$ Q@P $000CP $&@0 "R"T@10 @ " 0TL0  82$S10S,0 40s0480WXQ (0tD041X00  @P t0t000S6 @[ 5 >0LH00S S00 00L00H0 @P HL0480 ,p 0P*,000S0080@"$@P00( 0;0@P40【 0 L0@PL@P5S7S 2$0|$00h 0 @P 0 <0(0s(0D0 0P(Q $3.  l0 B0 04L@<00S04/D0400(000'(Q$D0, Rf@\\@Q R 1 0P([+D0< s0D0D0P0C a00D000H00 4D0@P0d 0HR:0R050B0005D00D0 0(  (   . Q 0 0A B4@0 0CD00@0S $@ 0,@1!00 000L000H00 T 08 S0002 02000p0h@|0l0 $03/@P 0@H0 @ppeu2\b2A-@pTP` T @ RPUpP f R@@P Q$0P ╵|{@0O-x0bM 0FSP&bpQ0 0`0 $_PP B PP0 2S  8 0SP2Ѝ0S @ T 0@0$ 0  7P  0 00 @DP@D0P@Dp 00 0 T@-P@`pP  0 00PX0@0X0 ЍG-X0 `Ѝ0@S P F`P 0PPPS*0 P000 S S S 0 B Q  p R R0 R 0g` RQp P   ƴW`   廴`{p 0Z00X $p0 $0X 0  0$=`P0 N<` X0V X  R" X0`P 0X0 0\0iR 00dX0"Up\W L"  4pP -AP P P? @//b@-04`*p"*0C00@ 0 `0 8q> 00. 0.0 x0 (034100 >0#60ЍЀ@bA-P@U 00 ` 00000pU`  `bA- $0p0 $0 0@R`P:    U@` P T00 00$00bx @0D0@0D0S/p@-@P`0S000p P PbA-@T1  0`/ @+ P4"p @P0|000Y0 q 0  0 0@P 003/Ѝ@@-$M4a02@00 0000  PP0p  帩W 0 00 .  00P$Ѝ0@-PMP 04@*"*0C000C0 X0  00. 0.0 oPЍ0@Ѝ0 -,M $002040 00000P$0S,ЍA-X0 !@ 0S10$#@04P,04 R1D4(2@`Dp0F@B` <`FR  0H0Ds 0 0000 000H0@ 000 0 @@Ѝbu2$0 0!0 00 /@bxddd@-0`iM0 0 :P 0 iߍ@P pT0 tp Pd  U00> !0hddpdxdedAO-4Az 4M(Pb$sS0S b 3 D PD202 000*0PP Q0  00 倲倢 0  p AT \XDs|P`<D=P}P\D4P D0/S]0`00FD@-0` 0`Q s0!00  "0姅PU ` P0 T | 0 00PፅP;0 0C4/,P000啱 P0@P@ 8 8P<`uP#$ ,B00   P0T0P0S PvAT00hYЍA]cd@A AcAA{@-A7A AEAxAsA~AAJA^AA@-<0CT 0 !0  !@b0@- ! 0 !@- @0S 0@5dxdp@-T0PO`d !06UF Ϡd 0!-T@!p謹d0@-0dM0@ 0 Q00 P00F  @`T#ʸ@Q  v 4/0 0 &#:x 4/h?&6 :  l\ 4/dЍ0@Dd6@A@A@AbA06@5@)AdA.A0O-P`p'DM,00> 0 00P(`$ p0,0> 0> 0 00P(`$ p٬'0 !d> ,0  00P(`$  pĬ 0 ,00!> 0 > 0>00P 0(`$ p宬 0 ,00!=0= 00 0 00P(`$ 嗬 0,!t t= 0 00P(`$ `催0,0 ,= 0  00P(`$  pn0,0< 0 00P(`$  pZ0,0< 0 00P(`$  pF0 ,00!D< 0 00P(`$  p20,0< 00!;0<$ 0 00P(` pS0,0 0$!; 0; 00P 0(` 0 ,00!P; 0 00P(`$  p0 ,00!ʟ: 0 0 0P(`$ ګ0,0: 00!: 0: 0 00P(`$ pī0 ,00!`:0X: 0 00P(`$ 寫 0,0: 0 00P(`$  p囫 0R!9 ,0 00P(`$  `凫R`: 00,!t9 $0 04P0p(` ppR, 0 00!90 $0 04P(` pWR00$,0 0 00!8 0 04P(` p?%0,0p8 0 00P(`$  p+&0+,00! 8 0 00P(`$  p(0,07 0 00P(`$  p)0,07 0 00P(`$  p*0,0@7 0 00P(`$  p۪+0,06 0 00P(`$  pǪ,0 ,00!6 0 00P(`$  p峪-0,0;$0\6 00!H60@6 0 00P(` 圪.0,06 00!6 0 00P(`$ p凪10+,00!5 0 00P(`$  ps20,0|5 00!l5 0 00P(`$ p^30 ,00! 5 05 00P 0(`$ H60 ,00!4$ 04 00P 0(` 170 ,00!4 0x4 0 00P(`$ p90(,00!44 0 00P(`$  p<0,0$3 0  00P(`$  p>0,03 0 00P(`$  p?0 ,00!P3 0 00P(`$  p̩0,03 0 00P(`$  p帩@0 ,00!2 02 0 00P(`$ `壩A0 ,00!l2 0d2 0 00P(`$ p厩B0,0<$2 0  00P(`$  pzC0,01 0  00P(`$  pfD0,01 0  00P(`$  pRE0,0L@1 0  00P(`$  `h2iA2sAlb{AA2Ap9T3BtD5AAAAAdA2AAAxb2A2&A8:BAAAAA&A.A;ACAQAcAb2rA 0 00P,(`$  p峧4 00!4 0 00P,(`$ 埧5 00!(5 0 00P,(`$ 勧 0!h5 0p5 0 00P,(`$ pwDЍO- 1AFAOAZAcdA0@-M4(@8P 0P,OoᥛBP@T0 S S Ѝ00000ddC-@P`px34M 00a,(P$@ @@ @Pk0(003 00a,$@ @@ @PZ0(02 00a,$@ @@ @PI0(02 00a,$@ @@ @P80(0p2 00a,$@ @@ @P'0(002 00a,$@ @@ @P0(01 00a,$@ @@ @P0(01 00a,$@ @@ @P 0(0p1 00a,$@ @@ @P 0(001 00a,$@ @@ @PҞ 0(00 0'>00a,$@ @@ @P 0(00 00a,$@ @@ @P寞 0(0l0 00a,$@ @@ @P垞4ЍoAhAtAPTAA$AA9MBxAB|AAAP ƒ #60 P *R  P 0 / 0CA- 0@`P P(0p, UP1p1:PUp0S S0 0!0d P0*0d0 L0 0!0d P0:00 dbAA@-L@P 0S  00P 0000dA- y@p `PUpP;zD?00ST ~-z<0 80*yAddbAbA0000 yd0@-M 0000P 0`-@PP8 @P 0 @@0@ 0 c@P Ѝ0S @ @""@P 3@0Dp?@ @Spo"@@Dp@P p oy_0S@|y0000婺@P K0S00p 006>@P ddA2O-䒟M0S@ 4X 6y0Su,0 a,0zX⸟P08 0(r/Q0(@8(0H> C'5(@HL (,P 0L P H BRP =)Q -HP PH8( , <@H 0L pP Q H =)A -BLP H!HP$d0 R$d@ @ R D0\ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00A-D 0R P 0PR@0X R`p  +P0S `0SЍ 0 D  P  X R # \!00@00H00L0 0T0000/03/@bA-pP@`V@P PwP dwV 000V 0 `@ 0S 0 00 P000 @  Aw(db0@-@PMv0@0@ @@@0       t d T  D $4(Ѝ0$dA\bA-AAFA_AxAAAP/D0 R\0G R\bp@-@`5Plv&@PTv*p0`0 00$P 00000@v@(d@-@P]v 0S 0 0S0   L00C0v@ 0S 0S 00  (d@-$ P P PЍ@-  Ѝ$d0@- 0 Ѝ7@-@PM00N 00 Ѝ07@-@PPPP8P 0Y   Ѝ0@} Ѝ0$ds@-h` EP0@0@PDPHPLPPPTPXP3  0PPЍp$d7@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\R0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ$dB$d=$d@-p@`M![41 P@0@0D0D0H0H0L0L0P0P0T0PT006 ```41 00pP  [Ѝ $d $d$$d@- $Ѝ$d@-0 0 0$Ѝ$d@-0 00 0 0$0Ѝ$d8 0(  R@0/HP0 /@-  @((hP @ tP@Ѝ$d@-@ L000Pdp@-000@S0S00 L0P0p@bPd00CS0/0LPd@- MPPd/@-p0M`0 P 000\@$0x0,` 0000(80 ` 00 000000ᮔЍbd|bb@-000S ,0 R@LЍ@Ѝ@b0M00Ѝ/d0G-aA8Mp 0HPU [<1UP1?0P嚞0QSD0S  R00RC20@ 0,00$0,1P0$1`|00 (`000 P Pp3P0,00$00(``00 000 `P Pp8 9; |870S X-; P8ЍG)8Ѝbd@Bb|bbA2AdAd2AA\0 / 0\0$0! R!/ R  /d\0 / 0\0$0! BR!/ R  /dP0/ A-(b0S  (B 0x R Sx0t0rsP0P4QoK00S-\0  1SLt00CSt0ڑAK0 001 S P0T 0 P0T 0Ut0H0L 0 H0L U 1S\0  $0Lt00CSt0U3S3 2@ U 0 0 0 `0d 0 `0d U 0 0 0 X0\ 0 X0\ h0l 0 h0l d@b@-`@P@sAo`0S]0SD00CSD0O0D0p00CSp0(00000 Ѝ@qd@bA-l0p@P`?P0 0/#B$'@P@Q bC-0@ Q]PMp0`J0 0 pJ000W 7;40 %ЍCJJ00p_cb<0p@- AM@PuJQp@Jʁ_cL0p@- AM@PcJQ P0p@J괁_c孁/@-( 0#@ @EJ@bbp@-0 0#P @6Jp@bbp@-@0 0#P @$Jp@bbp@-@0 0#Pn @Jp@bbA-@ 0`0 0#`: 5PPP p`0@pP ?0 RS  W* p\3  0S 0 P0 U 0 bA-@ 0`0 0#`: PPPm p`f0@pjP ?0 RS  W* p\3  0S 0 P0 U 0 b0S/ 0S/P/0PP/|@/p@-@P T& p  1 0G1 0zG1 0uG0 0pG0 0kG0 0fG0 0aGp@PeG @P`G @P[G @dPVG @HPQG @,PLG @PGG @Jc2Ic2Ic@2@Ic^2HcW2@Hc\%1Hc '1A-pP0@ MW 00  0 0 p`P 0W4!P0dHz/ 0< `  Ѝ0 0 0 BA9MB AO-04 M`S4Ap0PHH 00, 6:@D S0#P# !+*L0  3[ c,Pа HV`PP0P HU/eP $0000SPWPPHHU[_ 2 KRCPX W 2 (Ѝ%P.0n0CS)x22222222t"z?0JP`Z`d0D"104"J000o(0> CJ "f?P.001`P gPP0SPPWPU`ᢱ`P P 0 0=0`1  PP zx0S P UP 0cP80SAB@bbb 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddG-`@08Q0@0U @0iG 1 @TGЍG00pYG0 0 0W 0S 2 G(AG00pP U @0 yGHwG@00@0ЍGP U 7@b]c[c@@-@@00@0@iA-8Q8q0Q:$@1aOpI 0H!L1P!h1 *0S0 Am1`P0T313&ᩩh8V0 0!4104 00000c`bCAcceA@bc/00S/c@b7@-PQ@ @ Ѝ0@0 @ 0 00Rl0Sd0 @U D 00080 #@0  00CP2@b2c@c@-P@$`yF1UP 1CUW 3C7CU( X1 03/?@1U( P$10S&P" @000@000800<000 03$0P0 000@0 0PP00P:PdqFЍplP QnP@0S RS 000ccbc,`b@bc-//0 60$/@-p|0@T L0S PmE0 P P$p0P%F@ Ѝ@]cp@-@Pn@PU p@E0 @-; skAp@-@//  E011>101?1?11` P@ V@@pp@-@HPE@080C@00S  0 Ep@EXc@-!2 !@!$!!!r!E0!311Sp@-@P@ jE @0 S:EppLp0@00@TPS 0  PHE003-EEpXclbsAAXc@b02p@-1Pa@p@-@@Tp@-!2 A!R!!r`!U "!P "!001Sp!AA2S^ 20Q 0 0C0CSQ Q 1p00Q2-  a>Q 0 "Rq0 o`/O-MAQ$ 408@|9ЍOzQ3$0pS40$000 00?o 2?$0GS!0 00G?oR20S0G?or20SWD`xZ 01x0#D0D4P$0(0U L0S9`0S6 0Sd0 S/mD`080 ``P 0 @DT?<0m`P D ` PD1@,0000,0 0S` DAD<lP00 R 00 0L0L@T WD3$ 0R 0 S030#R0S 0@0Dd0@0234X`x XV0X@\00P XP@T`傓 0d V`0(0h000l040p00| x0P00P xT`l 0V000P00P T`Y )0V000P00P T`J(0S V0000P00P T`9"*0V0000000P00P T`&@0000 000 00t0C CD0( X8孈` CVM(0 0(00 0C0W0 0$000Cs  0002`W l@00S0n000<CW(Cʍ$0S 0+40Ѝd]c@]c b@bO-`3|M34XV3@03?0 |ЍPU@ᫍTt3 0,,00,@LP 0E@0/C8-C434pPU L0SV`0SS C0 0000P 0@QCTA?$0kP: FC  C1@00 00 0S! 0S  0000@T  B00S $ 0R !C0000?S0G 0C CB$LkYYP134yW@ 81 #0S1 0@0 0D00H00L00P0 0X0$0\0(0`0,0d000h040l080p00S<0t00< t B@0 8⩇P0@p@0C00$00 @0 440 HD000 LP@00S0g000 B`GB`,@bXcd]c@]c bO-@Q<ЍXcH2A 2\bXcX22A`22A dl22As@-@ `]A1 RB@Ѝp@ATB00@T `A00000B0@-@P$MA000CS00 AP$Ѝ0A 0  (0S  0 ! 0 00  PU 03/P0 PXcO-1,M 341]00AA0 0 pW ԦA ,Ѝ0001S``F` "`ᤦV `ḦA 0S   0$03/QA01!ὦL0 (0S 0@!!$@|A@00 0r3A nAi @bs@-0P32!1  SA0S0C0Ѝp@O0` @&lV PЍp@b7@-032! Q@APT 1S000 ⚽'00@T Ѝ0@bp@-@P0P ( R p R p0pp@-`P@P (0S &p00p p@- ЍO-@ PM @1失0,0p10Wp!0`1V1!0020[ 00 0p@'  T0p@ BZ0a R`01 S 0A`@@ЍV `#`3@lbXc0O- @$M00100`1V2ӆ 1 00 "002p0r0WPò   (@넑0V b@[0$Ѝ0   B B|Vڜ1S [  !hh0 0!h\W0101P"0 1@@-@`Pp?00000@ 0P100Q @ ЍG-pPt34a @P32100 01 ЍTR@bO-upWpME@P`31 0 00S<@1 ` ? 210030 10 *11 R``0 ?0 %;00T X\PP P3 4V l0 Ѝ34 ?J0P  E?  @bXcA@- `P1 @00}1 .?i?T 0 Ѝ@ ЍXcG-p`Ԑ34 hPP 0 @P  PU3bP ` 0 `> _*?0 ,00 @@bXc@-@@ >@-@>@@@-@P 40 U@01 Xc032 0gg@bgcO-H2 341M p0240@1 >똁1X``ӄQՈ0cV.  lP` nQ  I ɒ ?R²ʂ?1?1 `1P111100V !>ЍS`b/c ! !0[0   pW (Q1Sa`P@>0  0 {>Vl0 p0 02"!!!rF0!31 @bXcO-13B41LSgͺPPZN넡 pU/^ U 8 mQ020?S P !011QP? QQP ?10 ЍO`V   P  RX (Q 尐U<0 {P  $ Ѝ@bXc@-@Pp`P @ 0 W321001  @ @ 0@j 0@P Ѝ@bs@-0S4a @1S@^ @B1S P1Q0``1SЍp0S  R R    P@bp@-@T 0`QT@dPT\G=@IPHPP=UP@pT 0d34FIPvt]c@b2MR  !Ѝ/0Q`/wt@A-@PxM␀ Pp`x }dp` P =T IP  o,>=xЍdHP 0 #o]ct@- h@"+ 4   00(  03$34Ѝ@bQ-//-//-/-/-/-/-/$0 0!0 00 /@bxddd0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Q7@-P@ hv<`0 R 0SP D00000S !0"PT < Ѝ0Xc(bp@-XP`@ PD03 1pV T( P p#pXc@bYc0 100S/IXcWcp@-P@.<7-p@h<Xc@-000S ۍ  0# ЍWc@-@0S0 R000000S 0s0000S0St00dd.WPX00SLp$A@,0 0 0 Ѝ(bXcAA|@(dWcYcYc7@-@P : ԋh04t 000l00p0000 Ѝ0p3p@-@P, 00 00 0X0$00(0tp@3@-@ (@ j`@f7@-@`P^[0 0 00h1S\P\0Z_00 @00 0 $00@0 Ѝ0AAAA@-QaAM0 0$01 0S$0 S*E;01S< d10\00q01v;W  ⟽0 f  (; !(0,0(00, H  ⢠ 0R1!0CQS B0 00 >VP x.S1! B0C 00;0  8l{Yc3XcbYc!3(bcXcd|@8dA.AA-P|`P p吀H0L,A0 U P#H0LTp0    0S:|03/0S:@(bXcWcA-M 0P`p` @i 0  00P 00@ 00ނ?o2P@@T P : :ЍXc@-<0CT 0 !0  !@bp@-80P@0003* pYc@b0@- ! 0 !A-p@t` P0S C C S S T00S $ h0l0h0lAXc(b@-00@0Yc0@-A 60Vy0S: S>c4@P0,aFV@ R[pĒ0VSB 5 4p`,b4200 00< @0 @@ C 000 0 000p 0`P P0 N0 `10G0 0!#4#0 !AL⇕ 40//X00CSX08rЍT `[ `@bA-pP `P' 0   ( H @ /h8j!`0@@@%+3 2 034Ѝ,}@YB@bA-PU@D0p00`H0/ /\}@p@-@D0`P/ p@/p@-@PX0Sp8%UpA-@P pPn/80 @ 0P  /X0S/ r@0X`803V00  ///@bA-R@P` \p>/H003/x/H 0 + !01 0 R)p'/80% @00C@0 0R 00 80080U/ S/H00 LeA!#4#0!10  :/p@-@`P `@0 1p0 00F=00`'t` pA-A@ `p.@0Q0@ /@b "nQ "R P 400 /,0P/0 0R03 0@2#/8b`dp@- @`}0PT 0T@)0,tV@P"VP P@ 00tWhVP ,~<V0iV@Jp V@k hd Bp@-0` P@@=TL ppA-P` p@0U @TP ?. A-P0@(PP3pb-.+.@01@0f.1S1S ^..8 H1 Q  PP10SP@bH0 0///@-@,M _ 00<00@00PP剪 P:: P,Ѝ(`P pp-0P`@00q 0 0".0 bC3@-U@ RhdDM3FAO-P 0pQS dA`U PP 4V0 s VPQ# S PS0P PY E [  :  KP(  S% p0T 0EC1 003  V00U`dhdp@-@P 0S jUP |Up@P\UpPU @Up PP  PUphdA-P-hAT H0pS `` -<0$ 20S$0 @-@A;- @A-Ppᘀ,ATA.-H0S ``,< $00$0  eP$00$0$0S -@ @G-`p_AT ,P0 C;00",`4(0 00 0<0!$00$080080101 ,0S 0H0/p}@O-sM 0(0 0P$0 (0S (_ @1S 1 083/@P801$00000 0 0S 0Sx 0 @ (>sߍ 00S0#001 @ 04/P0`2,00:00 p\ mTP 0S8 T@1S 90?00@01 @!04/@P10C1000 Z T @ P  ,1 1 R!Z PՑ0@ D0 000 0LH0 0<00@00 00!)H0SS  Q  R0Q @>{0!#4# 11 \ p+H003/P@qPjpP \+0 0@+80080+@@+ @ +80@08080 R08008 0P@0PP0@0 $ +@0 R 0R PUj j+Q 0#$# Y^  S Q Q  11 0R!ŁV@\+0PC+80@080H7300{+ pSW Y T0@,0 `S 0 0C 0 000@+80@@0806300X0S  I+D+ + @:+ 0<00@0= @1S0   532 0$0P1S: H@Xp0! 00@lTpPp` h;0`0xP*0010@015w  8@P@0!S&1S XHpP@qt@ #T *@ 0S 01! @04/ 10C 0@0p00h t0 p00*Ȁ 0 z*x*0@hT8 X" @   R S8@ [ *Z  **m Q   h T81 S *~8  8 " 8 @  B@ \o* -* - g*%*80 0Z!080@00C@00H0 0SY 0 0 080P @ 8 P" 0@0#800 @00C@06*   )) 0S@08p%* #* 0!01 @04/@ ))0Ȁ000 0  R   T RM 'R 00'@ 8E) ) 3/  $!080@00C@0 !00 0080 0 0@@@@. P0r\ )000H0 0S 0040~)H @ 4/@40)T ) )6hd}@@b@-,0 00000 00Ѝ}@p@-P@Tp`UP n@G-`p3bMD)1 PUG|)P 2)@bp@-P@``)) @I @p@b)p@-@PP) 09 0p@V)00/A-@P@pT\` )H0000H0B)@}@00/0 S  0S o/p@-@PP(80D`k)P)k80080F)p@)0 vK@-@L喒8PQ 0 @zpe@-@X0 0dX0h$&`03$"$H@ |pP tP @@bxd0@-P0M0@(000TЍ0(0 0 @ 0'{xd 0{xdO-p`@嘰  HQ:/PDPWe \   04PP ?P Ѝ0S 40A3/0`@00@`PdO-dMZ@$ ` +0T L0P $0(`!T ]`P8p$p- dЍ P?`P$0匲p$p 41 00P`P /wP n0Sx@"HPPs"(XPPm00h( 0;0"PP^2 00 0000P 0 PPM0$ 0C0:P0 1 T01 R )" ` !l  2/`PH0T S*P S:00S418 ,0 0Rk pP ptP tX ZxP P`PpebxdO-hM@ `@pZP+0xP@@0/S WѐЍ+O0 0 S?@# ,* b~0 C /  C41$@ ]O00<`00 އ` OV@ k`F ]0W@C `F` peO-,M00`\@4q̔ 0L0 ?0'OX+4 t尐|4LP0010 0,0 p00 00p0P ,0/pt0Q0*#P$00 0YPP僐$0L 3K0P0P0 0PhP|P 0(0L0 C5<0X0pPtPlPxP N >SPP X0`QH`P aP0S X0$P0PX 0$020 0PPe`1$ dQ0`1T0S h20X T 0$PPd1$ 0d1d`1l H0 0000C01\1 $  BX! 0D 0TRg:D0,Ѝ H @k Cv[10S a 0 `10`1PQ\`X00X0 PPP\`X00X0 CX0 0dX0r$y"$/$S H pP ^tP ZhgNcN E/o\0"0S R 0P PPxdpe0BZAZc44Pdb00S/ P 3/bA-P0 `p00l 0 0010 (@0qIP Ѝ iIP'0MP 0@00 0 0CS 0QIP`V pZGIPp BIP'0oMP 00@0G-PM" @@M a0 @@9 wQ1 010;0 @0&0`!3PpH(@T `X,W/AU1@P 000` S&Ѝ 00S S S pp@PPxx 01@ 01p@ 00P!0 R ZcdbbxdbdAmAb ~@AC-PPMD (@T* $` 0`V@% @T5 Af0Ԑ03/ @0~p00~p 00@ 0 @P 003/Ѝ | Dk0 ࣉ(0003/@bA@bP/(0S/P/ R  00/G-Q @8L0,(Q!PU Lp PU PU ^Lp R(0 5 @` ipP .PU:(@0S   0 (0P(@S0`(`Zcb@bG-PQ, `XL@(pT p(쀟W LP$d! 0SV$@0S LPPtI$hLPg"(@T 0Q S   0 Vp@Zc]cbp@A-@`PpU 0S A  0S SP@-@a₠P]m_#hP lP 0@bA-@4`O00Sʬ#Ѝ0 00BPP0 0,0pp00 0 000P ,0/pt0Q0!*ᦋ[ctbO-$1L048<0L0 1 111##  #JK` X#.넀d <0<0a$,0SG,0,0XPTpPd0<1|8O4"P0# P00P0儍/#\0\0(H(r`0pQ h1d0l1g?0j?0l0040043 `0040040pW 4pK40r40r400P "40p20"0, d001"10 0S X0X00X0|0St t0x 0|@x00H0T0>SpE T0:T0d0@1h0Sh h0l 0h@l01 R @@0f 1aD03/d"(Jt40004`0e"8"  A"JJ(0$ T T0  ?"T0>S y"<ЍE,(4040pWct'" $ %U@ ^"PY r @XJ,J#@A@b7BAT3]c@]cZc0O-,Mp4Q#0I`P`y@T ,0〰t2 PD@PP T P` X !P P`@#0SO$V 0UB >0$0@$ \D@PUp 9`0V): _ `V 0v0 ` AD@P1 00` 00# $00@PQ  $DE@@,Ѝ0 0S S+$0JI@P $A0$ *`X luPlb[cpec3|0S/@-@h3/0|0h0O-4a04MPS@ 8!t!1S 0181S uRX0Y3T P0Q 6,00000>0#6040080>0#60D0>0#6000<00@00{80S JUO 0/01000L09L0,!4T0  0 0  0PpW*pWL0<L0 څ0P . .`1Sp 'pP?0  0  pW *pr0P s 2p0 @;\0    X0 lw p娠帠AX0L0X0D6p3pGor )H4qP ˹$$0 1 p 0Z # 3W Rℼ$"$w$囹WpW /pz BpDe <DD0ĠN J41 0哢`1H!<1d1 D1l0 p07/pP\T!@0AX0  81 0<1$0@1(0D1,0 CpPGk l0 0,03/l00S 3/el0 (0$ SKo [m Zj 00 Lp@07/ 0 03/3 0000  0 0pP 01I 0 03/2H0S`-HX D#VH4 }pP tP Y JypxW      2/p ttr7H`w1S M Cl04q 00S p0S-$@G$0p  $@G0tp0P  1S 8 R l S 2/l0 000S 3/l0 0 1l !D03/<10S ZG0S(G T % "  RP0. pp 000p p p $p=Ml0 0`000C064X2^0 _ 0S Lp4ЍPd]c@bZcxdZA0B^c0@-_MP P@P0 z_ߍ0@-(000000 0Ѝc3@- $0000000Ѝc3O-ȄlQ@cUX (X0Ph >10S `10$0P`p@-P4a@T 0Sp 0P T $P0&P R 86P03_8A B m p0S/` B\R R  B 000X00S0H0d0<1t0Sx x x0t |0St t0x 0|x0p/dH-f4A0pSM dP0P:P00Sړ00P0 *  bJP_0p 0000`Q00C0 IG0 ]0 11112J0`0m0S I81S 4뒏 D z6$_z0$0j4H?p 180S 3/>el\0   xX0 00X 0 X A 0810S0 Z p 0pYచpp[  M &  p0 0000 W &Z ly (sN*T0|p4Z(1S,!,!(!,1 0S   2 R @@00p`0000|0S t0Sx x x0t |0St t0x  0|@x0L0pWp  |0S pH0S p  $M0(0 =W :~1S =`$h'T L1 `5L1=0``0C0000002p xjC4+Fj0 [N[0k P 0fPa 0S 0ST t  T #+T p Q Q ?00  sO ? 5 1dA^c]ceA]cA@]cp@-4a@PP0   AO-M̠pZP` 0  V p80Sr 6X34A WW`1p|0 $00000$0SB 0  `$%p9 Pn 0S$0' H0S* [$0` R( R2 $0 R-P * !P  00C0VJ 0000 T  H0S P80$0$0S YIT0 W^%P(. =B $0` R RT +    B V /  T0 00꜐PY$ $0t0$0~`0S 0T 0` P(P $[Y 0S00S mPS 0 0 0 Ѝ30(0(5P( 30(0(,P( `0S(0`0S(00(00T0  `(YP 0T0  `(LP T0p` ! 0V bT0P3;T0@ T|2@H0PS (  (MK , ݃P(*P0 R P ( #T00T0(^<(X[<((XW<Z X ( X (0020`00S   00C0t0Sx x x0t di%Db~ |% b @(,<(?P ]D   A P%5 B/o0"S R0 400 d0O0` RP0 C;00"4 0S ]c@b@]c]cd[c0@-q@M QaT0P0` ,0 TP X _Ѝ00@-P0dM 0 0@S0 0S0 Q  @<?o 2Q0S X 6$100L0㑯48<0L0 !80 !!L0 ! d  `?T L P >n001P ԰DP  UD< <0<0= u,0 S9-;,0 00X00 01`X010 P0T0`5 pd0<10|080C4P0(% P00P0壁N\0\0(= ( dgl 4R g?0j?0l0l  0000p0$  0h00,00?, 00!! 140S  3/yD10 0S X0X00X0|0St t0x (0 |@xH0"T0#  R#000 S pxT0:T0d0@1h0Sh h0l 0h@l0x3 R @@0[ 1aD03/20283! ! R ! ! ! !@P2S X20S ^QP1211S lgX`^\0  Y (Jh 0p? 0404 I0<0<0ZHP00J 0 0` 0000 ut0S d0t 000k!T0  Rh!000 S T @10t0 a IqAO @ 6 POt$9, 90808000`0X1ST 00 Y t0 H;88[ctbbxdABAA7BAd3]c@]c@bbPd@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- 0   Q      0 Ѝ0@-P0M0@z000TЍ00 0 @p@-QC 1h@g@00@00 00 !!0300000, !  !=4=P 0 6HV@0Df%=P3@!=P@3S @bcxddd@-@0M 00000 t0"P d0P  P H R  "" "3:01Ѝ#A$3+Abp@-@`P Pp` P0S0@p0S   p@-@PTp0 3/@ b@-0@0S R 2/b b@-(@P0S   b$00S/ R0/0b b0bp@-@P,`< @<pZcbp@-@P<p@<Zc0 b sbp@-P` 0@Tp03/@b _bo@-0@T0 3/@bA-Pp `- @P  p `Bd00 (R @@0@0bEAb R 00 ) bPA-@`!PP0q0开0PU 0 0SAS 0 0 3/00PTpPDU 0 S 0 0 3/Pb~@uAAŽAp@-`P㲵@  ` cs000p@-@Pi@㔵0S   匵G-P`X 0003 0@T@T. 0pSW00  g@pW @ 7/|0SpW q W i@ @@@bA-Pp`5@ ``pS0S0@@PA-P`@pB0S 0S   As00 00S<0 3R W pbW@bp@-@P@STp0@-P0M0@000TЍ0?0 0 @@-$@ 0 0dAO-p0S`,M@PTXlcP p 000 00P0lp 00  00 @0Dg@ pP \c,ЍZ  喴@ \0 @$0v[?```Ѐ x0V 003/U 0S $A 0 "P! "  2< 2 2@0 2 2 0 2;UY 00b@b@-0C0P @p$!Qd_ 2  TfLP 0S 0< 0,$(@bAAdd Ap@-@\JTP 0S H @8` 0S (}pddp@-40CP0[;P0fUMp@bp@-@00S P00#;#P0TTpp@L@b-0 0/@bA 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddG-0@TP᐀;p`ᄣ6QP Zd0 `0R@4T0P@H0P@P T0 $$u @d@bWckBB8:A#A0~@KA@A0 0 0/@[cdO-`PC1(S 01O0ಀO{ㄐ0I0SaO pv@m0S p0I0SOa岀` vOvNL@b@[cDbG-餀PဓopWUpP@@ t@\!8R#8 @L A@ 0B062S PS B! 0B0*@b@[c0@o/@[c 0Q/([cd0@- 0<0@000$00cP Tu @bdC-p0MP0 0`` @0 P 00 000 0@8Y?o2P0S  R ЍGc0@-P0M0@000TЍ00 0 @@-@08M@@0 00@ 00@@0@8*0|0 0000,00 (00!P0 0H0$@ @000'> @00\8Ѝ[cD3d3hA[cGc3nAp@-t t@t@0@@lPSJ,(1\0,1s@ LsDD@@O0 2p@趵[cbb@b[cp4uAb}AbP 0 |P Q Sp@-@4Qr 0S p@j0`0P01P00Sp 00C00Sp@R?0S P00 0000p@-@4Q`"FP08P0`0S P0S 0 000C03p@LRA- 0 b@SPpb?u b<0@44100S V0 !!03L0H0@000, !  !@bxddd7@-PQ+u@ U034100@T0@ P@ Ѝ0x 00S8Am@P 00S u U0 #4!Rd0S@b]c@-P 00Sp@-@4Qb{[02L1SN P0   (1S,!,!,1(! >  PL1 P  $!.>* @P0#/G0@ 0P2>00C00S  O jZW.0  Lt(!0b0?o S,!0b0?o S `<:8aV։@b]cAAA-@4Q apP0F7S Y>P3 P0  00C0K  0 KP0 6P0  0 000P00P0@ O-`Pp4A0$00HP0   P U Pi L1 G0 0o PR16$1U8SH1 SJ P" L1 UD  \D \ H!D! W B $!  u > Ѝ\ X  U P D! R D!  B H! 0R ҿP A- Pp`3@2: p@#@`5<`%J2ၫPP   h0@D@P0Q @@p@-PP@p@Tp``FT@@P  ᙌ B 00S0R0S/ p0Q   0RH     /  Qbdp@-P00@Tp0 ΊP @bp@- P0Sp8 P`@b0 QV Y Pp!!0p@-P@M@0$P0pd@-@000P 9@@5dC-MP00`0p0 0` @0 P 00 000 0@Q?o2P0S R0 Ѝ$0S/7@-D 0qP0PP0@EU Ѝ05MA0/d-@-,00 ЍЍ/A@O-P`ԡ,M @T pMP VPPp P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #X0S 0 PP 0x P q0 000!R00! 0V0C0@bAd/AA7@-P p 0Ū@P Xa Ѝ0Q000 $!R@ MgAxAAA-@-<00S 0,0AI< ЍЍ/b0A@G-`2Q" @P"PX  P$0S00SPqP @U003/PP80S 8VU  ( 03/P00C0!R 00! 0S% P *$`X!P ᷩ Y0000000@0@@000000!00C0SEA@AKAjAAAdAbAO-$Q$q `@T  l@$0S' 0$ ~<0P000@03/ P R0S  ; 0S " P0D000 @ 0" dbHdA@cdb0 /$/O-Rp@M50"T@TP:  $` P1 !R  !1 PUp㔡儺 P10 U"P' PP PUP70 0 00 0㸹PP Ѝ0Q@D0 =P PpW F0P0U0000000XpPHP ῨPU 0  0P  D~@bdX~@4A@-Q`M P0 ( 000a@P  t@P ЍXp PU@ 0  އ@P0P S  !  00C0bdO-DMB,0RbS2r0,01 {0"00 0 @R 0"00 00" U:0p`l"(00 <0 P0p,`$  BsBNBaBA-M`PPPЍ s@p崀T sU 9P;P P ִg@PϴP P r@BANBXAp@-`0 MP0CsP@@ U r @P7sT 2 Ѝp0000/7@-@PP 00P Ѝ0 Pp@-M`P sP@@ V zr:@P rЍpp@-M`P rP@@ V [rP@ rЍpP7@-@P0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0Wq Ѝx44p@-`@PjP PpTp > \p XP@0S T$ + p0dBBB,0 0S @-ܱ@0dBA-Pp`@ᵙ00$0p ` P@  b0@-l@P0^P UPU  PU0^00 0@荙 b7@-4Pq@P $000 p Ѝ044@-` q@dtPp1S`00Z1S0@<0 AA0,000 p Ѝ0db8d4@-0@`P 00 0@0@;-|=0t tt@`P 0P``X XX0@P H@WZ 80Ѝp@ZBHd4Bd B 40Bd;B@d'4@-`0@0 0@0 0000 0@00C@0]c@\c0H S/P  \\81L@ t000 S \/4d0 SQ/PQ//]c@-P`00C0 -@-;yFO-\bM P"0L@0S 0Q* R00S 0 0Ѝ 0 hP@  wp0U  n 0倐 0 00000 \ 000  0#00 00000U00 @PE B堐[p[0@@DT00@@00@h @0`0 P00 0 P 00@}@\c@b]c]c0ud 9;G-MP 0`` @px 0P 0  00 0 0 p@T>?o2P0S 0000 0在P0S0 0Ѝ0@-P0M0@000TЍ00 0 @@-p0 0  ^8 0@0000@00C@0]c@\c@-@T`0SX02X0''h@ p@-81M@T-  OQ o 0  P@@  `  t!00wP @ 띴0 x0@Q 0l0300@ @@= DDЍp@p@]cd]c0u@\c@b`B\b+4BC4FA0O- a 000p(P$@ @jA0찟,00 000p(P$@ @ @PVA/0,00 000p(P$@ @ @PDA00,0`0 0X0000p(P$@ @ @P1A<ЍbH.4BdY4BBLU4B000/p@-00CSP0@@$P,U ᧖Tpp@(㡖]cA-0 0 2#PU 0`S@T Alpd0S R@D$ 0R l@TAr]c]ceA-pj@`00Y 0 0  00@PPTPU @41 0 0S r@n@Ѝh 0S $1S@]c@-@M`0p0Y 0 0  0 0 @00TPPU@U 0S~@41S$1SЍ]cp@-P`-  0 00@S @R@T  R@@4Q 0SPP@MPpP]c]c&$0@  !"P/ R0S//]cQp@-@ @PXTd0P1@0P !0@@T@p]cp@-P(@pdp]cp@-`PX\ T d@00  R$AP @p$p]c]c d0S  0  /]c 0 Gdp@-@Ph0Q@Sl l & 010Sp@p@e]cA-p0P1@Q`p 0SR 0 0 0X02X0|PU1T  R ` BRQV X "X  tP0CS 0  BR |O-SP ` (`p"" 0 㒣*@T 0 S8d0S" 4P0@hJd R p0UV#1!0 ST  SL0 P @[ 10S P1 Q@S@V @oYQVT T R S(@0`00pS V d0P @$00@01 00001suX00X0@`@`p `p - )h0Sl l & 1 RA0Sh h0l Pl@x @V (TW O]c]ce@-1PM?@?@`pL0bP?oP20S`ߍL 0RP S@0@6/P0S   0]cp@-L0@3P41S P0 00SQ000pp@bp@-T0TS4A,00S zbPp02p@8@bbG-0@Ppဃ4Q0@` SL!,L!81SbT ءBYL0<L0/WVG@b 0 "d0Nd0@ads@-|R   D l<i ,2,BRN<8!"$0d0@尰d@-H0 夦0@`06Apz@d 0 @帰d0 @̰ds@-@Pנ`ԠV Π`ϠV͠`ΠV00Ġ ҠPoЍpBp@-P9 R@*B B00CSD4D40D4D4(D4(D4(D4(D4(D4(D4(D4(D4(D4D4hD4 B0! p茠`剠Vᅠ@冠T T02S SL0  p,0 00CRP@btbp@-L0@P P`Pp@`+ p@0v 03/@pMcO-TM@  08 400 P  PzT T u(0,0 0$0Zp`< g @ *  0  :0#::c@004 <@D@8Pju 0qA@P0 L  QS0@  QR03@0B  x0 <1@11S7 Q4 0D1R? 10$01X0; 10 R6 0L10S00VP10T10 U> 10 00S0l1R0l11  >0ZO000Ѝp0 >0!0 >0L1O- M`SP@@ D H L P T X \   0$ 0$0, (0(04 00,0< 8000D @040L H010T P00 %(0V`00d0`00` `d`y>phpH0| l00p0Lf>p00p0PX `>p00p0TD Z>p00p0X0 T>p00p0\ N>p00p0d0t0<1x0幞崞幞崞寞岞ߞ(0B(-R #- . A. 001Vq1`00` Fd`>1 1mRfq qVbq00 0& ` h!`|2[/x1k1P0C;00400z0 := 1 5=0/h2p0l"/`2 `0S pCSWppp'p00 $! ! ! ! r"&" 0r &0B27\0V/p2t"0 0p0`00` d`= 0xh1P=p00p0T00 10 0S00@00P x0 p R ?S Rt 0 S0i1x0j10S  b<0V100`00` d`y=00 8 0 SW 0@DHLPTX0\ (!@0@J0@0,!D00D00!H00H04!L00 L0p PNp10S7 $0 |01f0010 0Sh00h0100Sh00h01m<1 0=X0 100S R  V 0X00\0`00` Xd` =` 0BRS000#0q-( (! m!( %0!!0 r00X 080`00101 01(01(-p 0 HpW0/! 1! ! ! " " " "  " $(" ,0"40/0 (X0h\ l00  ` p , R00=9B =C00P20T2Ѝ0`` d`< 0` `00d`~<$0` (`00d`v<(0` 0`00d`n<,0` 8`00d`f<00` @`00d`^<40` H`00d`V<1` P0d``00M<q qqqqqqq  ppppppppp81p00ЪP 0 R0 *0 `#8q:|@@@@ @@@B@-@P`t4 Pt tPt {T0 00000 00PP t 0Ѝp]cO-Q,MP@\|,ЍO8QT@@`Vp: FZr@RV6 @PH >00O0$`@ X;00 L@ TJX@D:@@u 0Uz6 xP@0DATu A@ jX` @u0`8T6,Ѝ0V01 0@P0V@0 T01 0P0T>6lPP& Z00 @@0P 0kP@  X`F0070`0 CSRL@ @꒯ \P@T0F0@P V0$0 0 000@0 00 0@]c8.4C-M p@P0S !PU @@A:` 0 q@P`P /Ѝ@@-@A0 000 0@0oЍO-LM00|0P80;@3p 4`Up0s  80`x|000tpLЍO6Y00(0(00S40OU 0S0U U0 0i5 ،P ӌ1L0:`@000 Z,0 01 0!@A$<0T0Sv :ATr 00L0S`0S 0 00080@ 0rP  @U0媿0 000Sg\4(\4D\4P\4`\4pa4a4a4a4dPP110$X0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z#04 0S0R0S  40SW9 0000  lW000 9 l lW$ 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@lH0WH0L0L0P0P0T0T0X0X0\0\0`0`0a0a0d0d0% h0h0l0l0p0p0t0t0x0x0|0|000000W0000000000000$ 0000000W0000000$ 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/N<9<1W<1@1@1D1D10Q/Q/9 RRyl1 1qlW  11222/W22!2? !. (2W(2,2,20/80 <0$ 8.r[ 0S$S 10 Rx ?RQ =X7<7$" 3P00 80  80 80 80  80$ $80( (80, ,800 0804 4808 8|80h hv80p pq80t tl80| |g80 b80 ]80 W80 R80 M80 G80 B80A/A<80B/B780C/C280.-80E/@(8@0F/F10!80G/G80.80/82@0@ 0 Dp 8080 M00C0$0 0$0(0 0C(0,0 0,0 0S [00 0SY $0 C00,0Y * ,00 U=0- *2 LЍ R@b@\c]c41d00/41d<10/41<10/p@-@$P4a'100bp]cp@-@`XPT4110$000PpP1@0@$00]cp@-@`PPT41100,5pP1@0@0]c@-@ȗp@-P@志p@-@ḗ@-@ᵗp@-P@᭗嬗p@-@ᥗp@-@`PΗ PpR0p@pp@-@4Q0d gd00p 4R0QdR Y/O-MPp48ƙ`Xu@w5xGuYw YPWx ]  IP @ EP  0 P ? Ѝ,P  %P  !PP    P    PPP xu P :O7O눐Ii8O 5Ox w  ՖPzO-MpP`48&w@u6vHwZu ῖPXvl   ᯖP @ ᫖P  0 ]P  ЍᑖP  ኖP  ᆖP}P    vP   rPiPdP טw fv eu ^ NP@- 0  Ѝ"0@-00  Ѝ@-0t`r&@u#P$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`r@uP$0P 000 Ѝ741L0#400/s@-@`800 0P@PЍp@薘 Ѝp@-@PT@#D`4qM1  h  Ѝ]c0A-4a(M 000` 0Pf@P p0  @P ?T@(Ѝ1P0 d $0R  TP 0p0z/d00 ]0 00I4]cB(03410S/00S/ӳ@bc@-h03" " R @@P2S ~'@T*P @bp@-P@Tp *000000@p@-\034Q0S m<@T 00@ Tnp@bG-@`PT1 TG TGUE h1*FRA:0CU= p81P34  1 0SP{?% P$ V* W%0034A } @T'@ 0V00CS  @G@@ ᭆ@00D 㢆@@bbA- `@p60P 0SP\Z0S=ɌP ͌QX 0 S R^   ЍS0@-M p@`P6@0 0S @ P0S \Q S000U0Us00Ѝ@-`pP`#P@HT 3S 00 0 $@b dxAWc0@-M 0000 0@0P      P ЍA-B@p B0 p`V1U:`V U UL0341S ( ,02 0P0*P @bA-qP`4A T@P<&p Pppu @]c@-RM`pᴓP@W@T@0@ 00 0@`hPP PᛓP ᙓ@喓T ᐓ@叓TP ЍNO-QM@Pp帰U @PL000 @@0 0/@P=00CS@8 a0` L0000 0:f0 00P 0 0 pP+?o2P0S@ 000` 00@P 0N0S0P ``P` Ѝ,@G-QM⠐嬠;0`S6p  9@P000 @@0 0̕@P  Ѝ P` e02 00P0000P 00S+?oY20S@ @@O-T/DM 0    Ζ$O$/ 0    N w 0!. Pq B,n 0   0,p(P$  /0 000@!p. 0 h.  4,p(P$ @.+0$ !00/>.  .00 0 4,p(P . 0!- 0   40@,p(P$  . 0!- 0 4  80@,p(P$  . 0!/>,͟, 84 0 0<0@,p(P$ . 0!/> D40  0<8@0@,p(P$ {. 0 !|, 0   84@0@,p(P$  e. 0!/>̟ 80  0<4@0@,p(P$ N. 0!/> D0  0<8@4@0@,p(P$ 7.0 400 !h+ 0   80@,p(P$  .0 400!/>ʟ 80  0<0@,p(P$ .0 400!/> D0  0<8@0@,p(P$ - 0 !X* 0 4  80@,p(P$  - 0!/>ɟ 840  0<0@,p(P$ - 0!/> D40  0<8@0@,p(P$ - 04 !D) 0   80@,p(P$  - 0!/>ȟ 840  0<0@,p(P$ }- 0!/>|t D40  0<8@0@,p(P$ e- 04  !,( 0   80@,p(P$  N- 04 !/>ǟ 80  0<0@,p(P$ 6- 04 !/>\T D0  0<8@0@,p(P$ - 04  !' 0   80@,p(P$  - 04 !/>Ɵ 80  0<0@,p(P$ , 04 !/>@8 D0  0<8@0@,p(P$ , 04  !% 0   80@,p(P$  , 04 !/>|ş| 80  0<0@,p(P$ , 04 !/>$ D0  0<8@0@,p(P$ , 04  !$ 0   80@,p(P$  y, 04 !/>`ğ` 80  0<0@,p(P$ a, 04 !/> D0  0<8@0@,p(P$ I, 0 !# 0   84P0@,p(P$  3, 0!/>PßP 80  0<4P0@,p(P$ , 0!/> D0  0<8@4P0@,p(P$ , 04  !" 0   80@,p(P$  + 04 !/>4Ÿ4 80  0<0@,p(P$ + 04 !/> D0  0<8@0@,p(P$ + 04  !! 0   80@,p(P$  +8 40/! 0  <0@,p(P$ + 04F! 0 <8@0@,p(P$ y+ 0!/>㜐 00  0  4,p(P$B]cB$v4FAB$dy4B4uABB Bl4BBB&B0B^B=BsAJBVB]BnAXx4hBqBzB  @B+ 00/!8  0   4,p(P$  @-+ 0! 0 0  4,p(P$  @+DЍA-4AP$p`0S S# S;V @TA )@ V P )@0S)T@D@!h0T@V偎`)@\0PU L0S tP1T@P]c@]cA-p4Q@y0S S2 SPT iPUN i @`V@=T VP8 `PU@M r@T`hPT"`0PU L0S30P@ R@`eTP_@@`]c@]c@-` V@4Q,  `G ЍpO-`O\M 00$00,00(0000000 0*0pЀP@0Tz$0( ,00 000 0 3#4##4000 00@OᣀP0 U*PCUP!@TP0S 0<#@^0 #0^0 0S 0" P^0"0 ^0 0S 0 0 00#0 0 ^ 0\" x^ 0H"0 q^ 0 0S 4  \Ѝ0<0< b0D0D0YI8<0 0#0 P 000p 040 "0p0, $(, @R& H.{BPHTPLX P 3 0 H L RH LH@ D QLP# p0  pU8A. Q0@0@$0 ,0#$0 0 ^(0@00 #(0 0 ]P+0 T2*@CT@!PU@*@B0 (0$(, ! /-@0   R0=9B =C0 000  \ R00=9B =C0 0 $R 0$0X S  @Bp@-P@Tp#* P0 R T0P 0T08Aqs@-@` QPP|X (?_0 PnЍpfX (*_P@-XM@ 4PX XЍG-1p ֑ @:P0Ѐ0PP: ^`ᤠ0 S 00lV ~Đ U`P ^`XV } }` P]cbXA-@XpX`BAXP=AP }P 寑U@b]cp@-@,0SpP,0 R p@000,Pp@O- RMЍ`P Q@ 0:,p2p\^ 0R Q 0 P0@` 0RP0E,p SVꄘ44444 4444P41 Q8 R 1?1 刱 Q8 R 100 ,6:ί!&S 0:0 0#&* R :>00 004Q\ 0 S L0 C B  B00#01B%B, pD,q t0 Q8 0P 0 S5050/S05 5 blbtbGcO-QM@`_0KSPYppG WU XR$ 0PH 00$0 00㢍0P8T() 80` ]$ , ][ 800 00h @00 0 0Oo `%#BP@T00 $0 00$0 0 0i0P $060Ѝ000@-MP@ UP 0 4Ѝ0G-@`P,@ЀpĐ`P0W Gh|bO-QMⴀ`V @P000 @@0 0@P Ѝq Z` 000 @@0 0@PQ0,P@N+W* 0`  ]0 0000 0 0P`"0@?o2P0S+ 0000` 00͌@PXPP"@P[@PU 00S.0CSP{P @  \ _{ 帏@@peSBp@-80P {@ W\x \p]c 0 嚏]cP x0 p R ?S Rt 0S/0O-DM(00<P`p!0  <0 a0,P$  @<%<0 SX h10'>\  0< 0a,(P$ %0 01 0'>< 0 0a,(P$ % '0 0< 0a,(P$ %0  00< 0a 0,(P$ %`0  0X00a 0,(P$ < %DЍ'BB(dBBLdBbB  0  /(dp@-$0@S,$0 P R$  Upt`0@o>0{0@0C0000   0 S pb\bC-@0`Pᰐ1qS2 10" 28. l R R R ' 忔먌X0@00P0#*1S0Ap@0 0@0000 2S000000SP ЍCC000@Bc@-0( R (   B "R    B A^!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GcP0P 00Q 2@=P TPW p xW 3V  GP 0Scb@bp@-@Pe p@//// 0\ CSR 1d 0 1P0Q#7Ó7P0P00d0\0cBp@-TPC׋%0C0\0(@T@ 0S 0ABƋXp@b@-0 10@@@b0  /B0/000S/@- 0 00z ЍdBeb<@00/00//O-<1`Q@S20pp 2  X0<03@P2S  Ѝ00S<&<0 X <0 (0<V 00S 0@bbG-0P@s pp< EY UP;`P WVV `XÜ< 0Gx<<0 X<0 @bA-X0QPcpp `@`  RTq<@@bA-Pg<`@ =@V`;pX# .@;0 "S "V@0 A<;p@-P @H0c   0S@(<p0 S p@bP/00//P/ 00@o/@bP/00/ /@-03Co@b00/]Ӆ@-0< <0 4 000  ㄊ0Ѝ4\b%B]cp@-,0P !@00p]cp@-00 P@P 00p]c*S@-@;/SP ;0 ']c/O-41 刋P㨋X%N@ ap[`(R03/@( Ѝ @P(R 03/@( 0 @O-41 刋P㨋X%N@ ap[`(R03/@( Ѝ @P(R 03/@( 0 @/00/0@-003/ ЍC-0`M00p@PUЍ 0R P 0` X0 P 00 000 0@?o2P0SH00S 0 00,,媏03/P ~4dbL@,BGB@-v^B@-P P d``叏PTL劏 Ѝ (,倏{8dvBe@BBC-PDMp1 p`u@T+0400000 ,00(00!0 000'>@$@ @ @0<0!@P<0W0 00PSPDT`DЍzVPp@@b4d 48dA- @M,*(1 000p<`@P0<0A0,p(`$  _!0P  @Ѝ<     '.A 0 ,p(`$00 0B! P P\PT@<`PpqP  PU@8dB}@BbBBb&Bs@-`P 0@T T0@T  S  0D 0 0 "P ((導$o`Ѝp4db@TB8dd04!(1<T  ςP P R00@"j !03//@b 0S(0, 0 (0, "0/0@-P0M0@y000TЍ00 0 @p@-P`@Tp 0SP0 `00C08A@- Vp@-4Q@`0S P0S00C00 0{0 6p@G \/Pdp@-@DP(F)p@bp@-@8034Q 0DP 0 0FRp@b B@-0 @ 凄P 0S(0341!1 0R@bp@-@00C"0!300 P p !A\  Q` V000PUR0(00@@@#p$0P @- /Pd 0`0?o s/0co0` p!/0@-@0M 000@0@@@|0P 0x00@0@ @@xmPPL6 46 ,,Ѝ0@|4B^cB]c 444FAp@-4` Q[ PpT0@  S0P8V+V`^cp@-@[8PPp8>0p@ ^cp@-4`8SpP0P 㿈@  "+U084@p@^cO-04P@ 匡@0D0H0L000000000111 1a   p @w@pD   p^ypp 8 p wq^&  ` qfa@^$ ( , 0 40 @P00P00!!!! !$10(!,!0!4!!!!!!!!!08@ ]c@p@-PU 0 R `0 1@P U x dU000000Ppt T0^c0 0S/0 @^cG-`PPp@U#P0Z00 U00 t  +U @T 0S P x T0p0p@-@0PQp R00  ^c0S/@-@P`P" RS . 0 000 00 000 00 0 ^PP  E2 1"  P0E0A 30Ѝp0Q0@-! P0S0Q@ L >̠ TP00000 00 0 0 00 00 0 00p@-@`P@Tpn 8A7@-@P  k Ѝ0G-@Mc04`pP0 000"!ġ       P0?S$P(P,P0P4  r L0QQ 8QQL02 SR0!!!!!!!! Ѝ蠀@@-P4a@6 =,10(1T0 41 1 00000110010 0 k@Ѝp0D"! 03@0A-4q001P0j?@00104!(" 4!0 & 0`0(07 kA10101A-0P`4q !( @T  0@P 0010 10010-A4"j 1P $P A-@ 0S Pp`4"P0 8P0@H0D"j !03  0SW00S@ x0>S0?03/ 00CS(h448444h44T P@G   0 S 0 0000@S P@@  @@O-`0$M0C 0 0 $Ѝ0@001S 0F٦P4 T<00p0 0C"03 ԑ Z `( f`P P  j!QP!g 1 0S  P  ` P1S01ą`$ 0  0    @0 0qW ` RP R0p Q2  @pP Q   B t2V `Po Z& %@P nP4 0 Z B\ "RqW`P P R[ 4@T 0 0PSP8A?o22vP X0 SPPU    S R P Rp  B  ` P [!P Q ! P zY0` R011aS!!1! 居ꠀ@@^c^cG-P4dp@U" PH1@T' L0Sd ZR`  0  ``封PXP <@T P @T.UЍd0SL`` 0  ``儁P XP `0 CSR h@]c@]cp@-xM@?x ` P,Q0U0000d0 0~(0$(P pP, 000P0 TxЍp@-P0@1P00`00p 0000p@ A-p崀`@T$ L0S{P0S 0SP`PU UVA 1@P]c@]c]cG-1`ဓp4A`0S'P\W P@>0SP0SsPn30SPP0S G0 k8QU J1@b]c]c0@-|M@t PwP00P >|Ѝ07@-P0@60#R00SP  0$100\ P P P $ Ѝ0@A-P`p@TW X0  h@p@-xM@`Pt $P0 0 0`xЍp041 10/O-$1M`p04AtPp\P0  D8\S6T04j ㇒) p 0RX0"? R (`pap0` 1R-P  P[ 1 ` ^0& ЍO/G2  Po \ x|20 |2oЍOYP k`  0  00  2JEЍOAЍ]cBO-p1唑|MS4A僿P0  .l,XO oX嶈T  !8|ЍO R (alS  t 7O0$! Rp 40堀尐1!` p$O0  ZWphpAo1STP 1`@T 0j/ 4/|ЍB_@b]cBp@-@HP`T0; S p@@!p@{]cO-p`P4A$M`0S P R gU 0 *SZ XP=$!00!00000!00000!00 0000P Pn8J?Z~ 000 000 000 0000  000 000 000WPPP04P0pq$ЍPPPp  T0E⣲03 !! W 0QC p R!` N0 !!  Ru  U  R X  p Q W  0 0?PlPPL p402S SO 000 000 000 000OX 㨑N0HQL1d0S2ڜ01 ZX  ) pP% !0 N?PP0 1P0!#xPom ]c@A-`@4Q` 4R{pMb2! !! ! ! !! !0 0F"0Q!V31 $0110102Axꠀ@p@-@P0d $d 彄p@  BB@-4APP0  P08P0W2  Oᔿ!p% :P0`V0S 0 00偁 墀00C0mVP08P0d8a7P0/000X GM0XHqL1' 䀟P&  03/`00S P zz?Vd 0 t`}VP02P0P0 :P0^`$i B' B@Jc0>00A:MB@-L0!C !!R@ * *P@@bA-l0,q@0 PO `  0*  @X @R X A!@b Q ,1c@bP ,1! / x/ / /@-@b B////p@-@ P" 4]Np]c///N/-////@-   No Ѝ@-  No ЍQ@-@ @94P  ,|P  B B@-@CP @ݛ@?G-@3@M` TV 0  n30S& EP B0 rs #}NPP  G0"0 !& 0! "~ @PPKPChKP>XKP9L24b0`K@K7:!#:  : 000@0QO1KzKPKP KP?aecЍ>@Lq``T>Tx mK ~N`PqdKPaK0 40 00JKP!~KP *UPP o0 'n` b @|+?PP p8hDP0ST D80 0 0S ~?CS̀IP&000007 000{0 cR[0 019 0 `, |T I|IP tIPdIPXa|P|L|8?oT20S I 88PAQڷ0 0R`A*S 00B80 (0PP0 08(0PP H" IP \IPLIP` ` 0<# 9|V qI2| 0|8P[V ( 0"5 006 #::000040# 5d50YO吕 |8zPRhECP5\% ,I@P}1I8"IPVIP QIP4?a~4P^# 1$0$0 X8CP   008WP `D R 0BP0 hP08BPJP8BP 8=0P D R{30S {P 8BPD R 0{0h0 3 o%|lw{H30S ЍPU<T+ H K`P$H2PRdHPHPHH 0 10 6#::`0000PvHsH(```@ 00KPPa' # UH@PYZH<~KHPHP |zHP41l?a&~1P<1 JP pzD10S~  P  000F4! ,qj 8YC 0"6 0 8100 00 {8PP8 zz00P;cXdH;cDbA?A@ba B7B0;c"edc/Be B)BhAAA Ar B~ B8;c c B BĎA B$dN BEAxA BAS B B BbA B B/ p@- @RP` 0|PS0P}p@C0Q0R l R |0 p@|P0p@-@|$ B0@-P0M0@g000TЍ00 0 @p@- 0@SP`xP?p@S l0S x p@xPpP00SD0P 800S,01@o/Wcdd@b 0!< 04 0 (   !/@bxddd7@-h@hhPu \00@0%S D000S ,000S Ѝ0c2 B8 BA BY BAG-`pP0ဣ0P& Sp0!D@ӿ a vL  @0@c, ЍGEЍ@b_ccHbO-M` 0uP8p X1@Ѝ 0儰&TဓPp ! @ '  .<0  #00 0 0 0 G0`*0 0R `30(,  0$ 0S 0$ 0$  0S 00 $ S0 0 0 0 !020 P0R 0000S 0 0 \0 RL000 Rm00000 0S 0 ccdɚ;6eʚ;0 &p@-d@(0, 0S(0pP(PC$0S $~$000Sp@sdcdp@- x#p0p@Q0}/’\ \#3,0KP5 8@#4Ng03/p@0/dbMbd@BcB0S0/0C-DM@`p(00<  0 80a0,$@ @@ @P.P00H0000'>a0,($@ @ @<08 DЍB[5BC-Mp 0@P`` 堐-0p 00 00  P 0 0?oY20S 0S0ńЍc80< 0S 800< /$ap@-@ᘪ@0`0@0a,PU #0 ʪ4`p@聪 aP+`@-@PP@PL0@-P0M0@k000TЍ0ᢪ0 0 @@-*fB0p@-`Q@P0 ')0`, {dup)0` p@qdPAzA0H-@`,M08P0S@ XX$PU? ,ZO80< 0 80< d _P @ _H D?Rp pӷ1 000P1D HpW  _T!0  tv_@0I_p00 0P00000pf`p&թ0SЩ 0R 0(0 0 ,P0$  R 0(00$P 0t&P=`ᰩ| Q 0   P,`ީ$Ăc*B2Ba5b?BC-@,MP` ㆩ0 $0(  ,0p@0000 HPD` @$_?U  t000000 T0 xPP _\,Ѝ[00_ᕩHBQB]5p@-@`PP&K PpPK00p@-P@9p0S 888a 0S@0 Z( 0R0000 y]^0 ^㜖^ 0S 00"#! "#1^P3 @103@!3530 3/0 00000@000@bcMbĂcb@-@X0M 0@0@ @@@ \  00@@Ѝ@辨\BĂcdc0SA-@p`Ḩ@T`J P@P `JH0V P@垨@0T@SP P0PT TPX0\ P0 X0\ ʨU ``J@@H V P@dc@-@duX0\ 0S X00\ @P0ST T % 夨T@`9Jc0SA-"<p8`QPU 匨$J0@!`5Q !Q0S PJ Ѝ0V P*P0UPS 0 |0@ 0@0 T0 0 UT PIP V Pdc\5a5Z5d@-@h0 0S 00 @0S   $*TyP@Icp@-@UPPePpp@-@PP@p0-@- p@ 0P` 0a0`00c]PЍ@Ѝ/s@-P@䯧00`V `P] 0  0Ѝp@G]`]5eBp@-@SBUPЍ%  $RQ B#P0 SQX  Wp   W  t xW0 W0@ t 0 00⌠A PT@@-0 Ѝ䈑 A-41`P F?o2!R0S0!RX00CS 0S 0SxxS 0{HHL@LpH@L@PPp^P@HL@P0ɚ;6eO-\M00PĀ @?o2!R0Sp]a`PKYa`PG̡̑0AT}`=888$0P0S X 0BQ0*SR#H0 L0 H0P L RP 0 H0LP !p DU 8\Ѝ@S jH0L Q 0H P0L 0CSP05Qk9 p U@p xP U  0t  00 t  00匀P@@Ϡ0H0L0P #0 RQ @ U U' p T @'H`P H L H PL  QP H LPɚ;6eT@C-P`U@4p,M0S U IP ,Ѝ p03P  @410S/p@-@`41PU V @T h00P 0003/@T ,00P 0003/p@zbp@-@`PW0SpG-1C0(qJ@@XP`X R00G~ 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80#ST 0S6S Ѝp0 <0|0\R qd@P03/@P cdxbi@DBzB cBp@-P@p@@-400S (咙P@R@WcdBp@- P@ U 0D P@\p0P HLHPLTPTX\^X05\5 0BBdA-`@ 0 0qPUT:@`p WP p0SPT y:d O-2BDM0S @090`p\0! (0 0 80a0,$  P1倱< 00 0a0,8 ($  P<1< 00a0,0(8 $  P0< 00a0,0(8 $  P0< 00a0,0(8 $  Pnp0 00a0,($  P<08 ]00DЍO0`bdBB5BBBVB5BO-`@M0尰p3PP(` 0 X G)AX 0" 00 00000 0)Ѝ@Tx@@-@ @?@-@@ 8@-@@1G-@pP@B $`&Y0030#T00S d5`M!40Ѝ/0M0000# Ѝ/@-`0F S#*@\Pb x:0 0900@0<< 0:P@TЍpA-@pD`@DTPW:0U090E0U@000E-0,M$00 0 00 00 00 00 0 00000000 mQ,Ѝ B-,M &  &Q,Ѝ万A7@- P@0000#4000#4000 0 0 0P S  Ѝ07@- P@0 P 0000000E000000E00E0 @ E S  Ѝ07@- h0@b"P!4b4# 0?<00 0 0 0@ T  Ѝ07@- @P X0b" @!4b4# 0%D"D00D0 P D S  Ѝ0l R/4!!?aAx R/00/0@-P0M0@ᘖ000TЍ0ϖ0 0 @C-0@`p\!DM(0 0 <0a0,$@ @@ @P<@<0S+ 0 0 ?A1c00 00< 00a0,0($@@ @P`00X000a0,0($@ @ @P< DЍ'BbgfffcOB0B5>B@-p0@0PP`M:} ? 0` 0 P 00 000000bЍ?` cb1`SA-@PHpkPUTL PE 0p@-0@0p00#1R  p@V3Spl0SpS @0@0@0 P0@0 ʕ @@0 0@0pPc@b@- 0@ CSR 1SL0P @0+\@0 ꄹd/ !R/@-@$0 B !@ꄹd@-@T徕8Al0S/@-0@; S :#0@謕000000/cA-P|0@`]l0` 0p BH0S `P000C S :#0儕A聕ꄹdc//00/p@-P$0C0 00p@m@b//P P  P! // //@-  N蠂@CBA-@P`Tp T T` N`0 0YB0@ 0 0/p@- P  @\ QP00R0S" 0S S 0CS <505$5,5$5$5$505S S <{P@ Tp@BB0SI A-b@0PpP TUSR #PQ Q AQ 85`505T5050505t5Q Q pP  p@q q p p0/p@-@_p P p- 20 2O-M0|2 xrp0p@p 00\2\RXbP00P00 082P`0`` @ <Y< X- < << @ЍOY < Z  RR00@R0S2 R0[:0S 0 „2 "" BQ#P2Q020020S R2 0 ;R00 00S 000 0 0S 00 0H@ 0 O0@- @`V?000Q|APURPU P   Q<,  Q0  @ Q@0@ @U P  Q 0   Q0   Q0 @U P   Q<,  Q 0  Q0   Q0  Q0  Q0  @ Q@0@  Q0  Q0 0s@-@0@S`Pl0 @0\ 0 ЍpPP P$$ 0P@ Tm0 CR4-"0S S 0CS ,5@585,5858585@5@S0s 0s 00P0L 0S20QP//-! R 3P R0#3p@-@PU 00 0000P pO-( |0RxpP`@P@:/@P 0 09/,8LQU 58/P66B@O-M8 QܠpP`GU @ 0 ;/PP 0 P :/ LWЍ@!Qp09/@T*X @ `F1S @66B@A- 0 00|Lp /P  H&P (03/PЍc5BBABB(BAB@-D@᠐0S FKd (00 !@АdbMb @-@oQPG- p@@ `P7/P @@U@- 0@0 0P DЍ5@- 0@0 0P DЍ5RPA-p00Q0SP@` @ R 8/P W@RQA-p00P0S`@P @ R 8/P W@00 00000/c0@-@M0 RPU 0SP0S   Ѝ0 Q0 Pp@-@PP`D p0 RP @Tp@-`P@PpQ 0 R P0s @opppp@-P@Tp0 RP @ 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxddds@-`@ hP c0Ey0 x`t0 h`d \P\08< 8000H@0<0008:X4`Ѝpd@cAB5l@(5@c(cB-|0Qq80S-wA0SN`P@TNV0da0PPL?\1@0 X 00S 0PBUT1TG !  B< @@0R:<R0@1``16/Ԡ8X 6/`/0t"#0> 6/T3/@0 3/@` R0T0  *dcMbȬ@dBA`kABb6B06A@$0$$08S 0  &dH5ddp@-@PD守T 0S 0AT +0 @߈p@c@-@G-`Pᓈ呈븠p娀U%0S" 0 @T +0d0S\0S #S`0S ᳈@>nL+婈姈@d@c@b@d L0+d@-@P@@-000 Ѝ5@-000 ЍL5@-000 ЍK=@-000 ЍL= 0Q/P /@-00 0P Ѝ5@-00 0P ЍL5@-00 0P ЍK=@-00 0P ЍL=0 Q/S/< /< /0@-S@<00<0p0S 3/P/<   /0@-S@<00<0t0S 3/P/x0S //x0<0pt 0<0/0p@-@Pp0t0᥇<0`0<00Sʸ0Sp@؇>@=@-@0P|0S@/|/A-`@ဇpȀ<0P 0S#Q003P0 000=00C0=᠇@bp@-@PX00CS00=p@莇//<0 0S /0@-S@<0 0<00S 3/P/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@ <00<00S 3/P/)00/0S/@-@3/00000p@-@hPp`Pl01Sp3/h0PSG-lP 0h@S qr(0`S0Z 3 #pG Shl`T  ]( P0!!00A-P@l`hpT1S S@ R Th@l@A.(1GQ @p@-P @P>0P       PU  U p@xcPU P  80R 0 PPU P 80R 0 P@ccp@-P0 0S S- S@@1px@P00C00S8 R@e@P000 R8 R@@cp@-P`@P  P p@@-0@Si00@G-A_P 0p倀0| ``@lT AdP AP @zA,BBdB@-@6@x@-@0x,0@T   B B  @謅@ccp@-M` P@P U , -BЍp R 0 R G0 QS0  'PPPP c<Bp@-MP` P@ ЍpP U @P C-Mp `@T ЍT P1 W - PP @P0 T B 00 b B0"\ /-L \  QG-@T. TpP"!bIUW :T0 pG PW T0 pT0A0U!O-@MPP 80P6#bP"ᆡ  80P 0Fp 080Y0S:PE pw V    r R:V  Gp 0PBUPP5Ѝ 0 0 0U? pB0 b B30 @- ? 00/BO-PM @0@#0pS0D0UPPQ" 0   > ~ 00 @P"  GZ 됚!0H00`0@0V RЍ  IU1!pd>X  0 PE p`P5 0 0 0B1BO-RMP`<p W0HЍV ,580R#"  80Q  H p㛠!0I@ 080T R00C0 @t Y    0 CV1!p0T[>Y p `F @ 0 0 0ZBBA-P` pW:H$0@ `:$0`rb@-@,$@($7@-@P 0P S #p A  Ѝ0  7@-@P 0P S 0 Ѝ0O- RM`8pcc0000/@bp@- R 0@ Rʠ}6PQ BP P0 h00R ]Pp00000C00 0C000 0 pBBZ> S# @-0@(M0T (Ѝ@eh034100P (Ѝ@0 00 !0 0 0  (Ѝ/Z>@b@b S% @-0@(M0T (Ѝ@8p034100P (Ѝ@0  8 0 0  z(Ѝ/Z>@b@bG-p`@V4 PPU00C0 0VP1R 0S0 P0p`F0000C00 0C000 0  gZ> 0S\* A //@-P`pᓇ@P0 H@f Ѝ@-P`pဇ@P0 b@S ЍA-@`py᥅PPdy@Ѝy]@y,yT0  @+]c\ v/\ n@G-`p0S40 0@P202@@P0 SY@@P2S o41 0@b/// '/./M0P PЍ/  /M0PЍ/@- @ P P R:H 0R PQЍTVRPA- `pP@T X@0 8/P Ѝp@-@P Pp//// /$/4/Q Q Q  <@o/<9@o/</<!@o/D0/P@/@/H/P/P/@-oP/P/@-oM0 Ѝ/   /@-0Mp00 @0`0wPPV 05/Ѝ@-00 ЍЍBA-pP` P110Q 0PP00V@ @000Q 0P@000FW p 0  0 0  0!VLP0 00  0!\%c`%ccc(d@-@ w@-(dBO-M @ 8PRPQ u`w0ZV 0S 4 44 R@ 0 SJ1 *Q P 000V 0S000S000 S RSV RS 1S w Ѝ301SVO1SS  R 0\ 0S \P  8 0R PP 3 !62<0貟 01S : 0  a0S 2 22 R 0 Sll31 1SS  R 00S P b䱟 0R P 1 !Q1N<0刱 0Y  ~ 010 08 0!0 S  KS % "+ P P  K㐰0 0P  P 000 00000 cc(dĬ@\%c`%c@ Bc@c@<Bcp@-@P`v;p@v(dqp/<0M 40000P0000Ѝ/\%c`%cqp/<0M 40000P0000Ѝ/cc@-T0@00@ 0   PЍ  Q \%c`%c@-T0@00@ 0   PЍ  Q cc@-@+vT00Sڤ001S 000P0\ 0S@DMv@ < R0 AT@=v(d\%c`%ccccc@-@P@Pu H0D00Q@0\@v (dcc@-@P@Pu H0D00Q@0\@v (dccO-@P' `Ppu0Sڛ 0S/ 0z0 P$ 0S 00C S@Tlu@h00S\001S V  >0P0Eu Ѝp(dcc\%c`%cO-@P' `Pphu0Sڛ 0S/ 0/0 P$ 0S 00C S@Tlu@h00S\001S V  0P0Eou Ѝp(dccccp@-P@ Tu00S001S 000Q0\ 0S @P@hAuPp \ RP !R P<J4L@)u(dcccc\%c`%cp@-P@ Tt00S001S 000Q0\ 0S @P@htPp \ RP !R P<J4L@t(d\%c`%cccccqpO-MpЍ8A Dpe2 10T/10 0 010`V.` y2V @T 4/p $@P @00 0;/ 0pS U h X0000T40 00PU QU Ĭ@`%c(d\%cA-pP`P ^ 0pA/A-pP`P p0A/@- }@P00$0 0000/cA-pP`kP p0A/A-pP`YP p0A/@-KP(@-EP(@-@?0P 0S @/A-aP0P a0A/p@-P"@Pp 0Sp3/pp$Ppp@lqpO-MpЍ8A Dpt1 10T/10 0 010`V.` 1V 0@T 4/p 4@P @00 0;/00pS  U h  X0000T4000PU QU @c(dcA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`P p0A/@- @ vP@0/@-@l0P 0S @/p@-P`^P 0p@/pA-pP`OP p$0A/p@-PA0P p@(0/pA-aP4P a,0A/@-'P8@-!P8p@-P@Pp00Sp3/pp4Ppp@L/ 0 6/O-PA(0娡M#F0@9ᤡ @Ap`@Dxqa l4-hq d 0\! `  H7/$08<` S, 0(7/X= [$ (0R7B@8 0 @`J P7/8 0?, 0:$ 0ЍO/[ o 0p7/#$\ QĠ<7/Ѝ6@D6\B:BaBBBBxBB@-[P0Sp@-@`P `ql q0t0p0P0 0T0`\PpX@-@f  AXA-@lP`pqH@T @ U@ 5/@q@-@XG P 0 0f @@-@lq`@qX`XXXuG-<@Y800P$A`Ϡp?  V0* `V p0 W$PO-@8P<M Q00Ѝp(0 S:80S (0 P`Ϡ01 F 0f800x00|0$ 01/ ?;; 0 4;$ X *0X  R$ f  ̠>Ɍ8  X ` :X 0*0 600 ( 0$8 0 p@-( \:P80S @<4;$< 80(0$00600<0845/p@p0@-@MS 0 0C?o2QP R\7 R4 P@Ѝ008@Q AP"080S  a "!008SBB@-gM"Q`@! Q Q"00@lpfp `VV@ @pT H@gߍ <# sv 2Q9 3C7CQ% 1Qk 0Ql @1QQf/!@1QV 3C 5CQH 1QY  *gߍ@FQ f/ 8S@E/  u0 S0;30?`aV!  0S @2  @    *! R@T P@q  gߍ@Dgߍ@F G_ F[ @pd@hd d@edA|dA-0pS<00@$b /o bP c0?o 0cT0 `$0 ." S  R Q $!P  R ("( R ("($ R 0x lfW  XV P   0UUAB"B.B@BTBBAgB0 60/80S/A-(pPW {{W0sf/@ S  R8S`P  d /o0bCQ b#PQ 02THطf/2 P 0R*WEVs@-P .p5 `@@PA@0 @4@  P  |*xA  @P T H040 ,( Ѝp)B@qB@ B0p@-M0@P0( `P0P P <2 CP *P0  Ѝp00$0 P0 zd@hd A-0(M pP0`}@P. 0 u@P&`'d)0' pp)q ap x(@0T po(! * * C(Ѝzd@hd BgAp0S/@-l0@ 0P 0 ]P0p0Ѝ褍@@-`DM@PP `& l0 00S p0StP np0pS0l0@0 0p0,pP$00004$`P0tpt0\DЍ00@-lp@;ldP%0 0z?00d0 z?80&ilgl @@b6=ABp@]cBG-0p @l$PU 0S   0 Y 0;lTaIPP00X `  !P &l!hd   @- @0 R   $ R 0 $0 00 0@O" hdp@-SP@^0S Q)  B  0S0@@Pp^  \B  Q `P^  0S   p@^ B  R @@0p@-0 00   00BЍ!BhdG-PSp @$`3   ,@00(P$ @$ DR@ဠ ?k 0U00 000000Z0p00 $Q0$00$a @P!Bp@-@Q  k0pp@$ PU00 $O-0AMSF0@ SB:`pP P, 0j 0 00 R  p PPPk P 0S: 0S   PP kЍn 0j#P0 PO-DMPt@`p 0P P0 h0p0c0h0Cl0PPE0Pl000j0 00 S0jPDЍ0PUbS R:lhA  t tl@ (   ,I0i4D8h A<UC DP3P# ZPPU Y (PiU PPE PP@[vZu#3 [3\ Pk t000#R00St0 | v PP dj> R*0P ^$#3$! ^3"Q Y( 04  A [$K [#3 ^3\ 0< l S0P 8  \ Q,N ^Q,RRQ   P \Qdt ^QRRQ  y^i#P    ix0P0@-,( $ Ѝ@-00$  0  Ѝ@-($ @0 Ѝs@-@P|?%0ji0```00 V#PU0 Ѝp@i H#PЍpB(BSBG-@P`pI#`P PU 0:iQ 0ri$  #$ P?:0S @C/oo"  0S   1V ,X$P S0#03PE P  0PE 00 PS00``PPPt)igBBP P @-$//B-pBp@-T@T\L00 P@ 00B0C0/(0, @U%]pdp@-P @\P PP]pdp@-T@`\ PUP 0 0041d00 0RPP\pda0@-$0P 0 0 Ѝdp@-P@\Mp@\dp@-A@ <`P\0 0RM@\pdp@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \Pe\0L$PBU 0P\Pp p@ 0 p@/|f~fddG-p@`PF\L 0R$ pY+ 0@@T @E@D@ T @!T% q\ (\Y@T@ 0TT 4X\#  P N\ddp@-@T P,0,H0\ M;\pp@ddG-頁@0MS㠠$ Ppx1 R0S! 5S-@Z@W 00@ ?[ ` P@U`1 \V @'0@0Ѝ 0`` 0  00  00P 0 0@PEUP!U @ `0@S 0 ゖT0p`FP@da0PdQ/p@-P0 @AlP Q QQ  @ 00H0pda0O-@M@ 叔0L@`\p,00 000($@ @p @`Py50,0T0 00`0($@ @p @h<ЍdpB66uBBp@-X0PUpL@ 0Sp[$L0S L嘕p@A[Wcddp@-P@0SZ 0S 0P00 Q @ Q   Q  0Sp<p@[  R  ^ PWcda0@-0d 0 d0%d08d0<d0  0j@bd 0 cd0  c@bd0 [d@-@ yZ@'dBp@-@PvZ`0S 0 S 0h0Z5/TeZ0L0 1S/@-@ 1S 0 0 1N>P 1  S//1S/0N>G-pMS`x@Q03/ЍGRQ 00000 ` 0PЍC Y@\ 1Q   013/ Pq 1 @b6-0 RF0 10S L0F010S/ D@-%( @tQ 0 @@bN> 13/ O-P@む80 S2Ԁ<0s`̠Wʀ ! , !8!< S  T` Ѝ臁 1 3/ p dG-0 @0 0 p  (`,(0, P0U(0, 0Q Q000C0000Ѝ 0$ 0 0$ P@ 13/P fPV 0 PL@Z>A-@PxpHN@`E804P"8%< 40R:AtNXp@-@Px`*NH0,PU< 40R*p@]Np@-@Px`N0Pp@SNA-`@xPp N? 00+0`@`E0PPpNK8A5N//\00S /@-X <!t  L  R0S pcp@-PM@NpdO-PP@4M;T4ЍO/lR` pR cR sR SR0 RS 0S 0,0,pW4/"Zl L H<00 4/4Ѝ0`t(L4/X @4/<080804 ,4/P0 0@$4/4/00-4/X 0S 4/ 0S 4/ 0S 4/0SE4/V|4/W P` 0GOQ  0 `$0P ZP4/ 0@4/4/Y 4/̀QȐȠU~  4/`p0W:P4/ r 0 4/p` 4/!B!B!B!B!B"B-"B`"B"B"B"B"B#B&#B@E#Bg#B#B#B#B#B#B8#Bp@-P` 0@Tp @pcA-PxpL`V  `V`V@L F@P` >@P` 6@P`A-4@c0(P  Q QA$[ V`W, pX0@  1a1 q!1Q<1( >01 1010 G0110SDp0SYL`(RU,2P0@0,2 \01000x0SlltPP0P00@000S0mLl@Ѝcc4d@cc@bWcdpc#BdcA-`ph M@ePP L0 0H00D0@0@0 0<008000` ЍdA-PhKd0\`(BpTAD/L101*LK10C1i@dpcp@-1@P . 13/p@A-@p000`0S 0;S0S  ! PU  0RP Q  q(0, 0(000,00000Ѝ $00 $0dL@p@-0@0S00S) P`01!000C00aP0A!400C40p@0 6ccc@c@bX6A-d0@S h3/00P x`KPЍ000p PQ aK0S  <04S 0— E R :@H B, R:0CP ^ꀂcpcp@-@`PJ0;SQ 0@ <0S T0l+0T0&K`P`HJT0D0CT0d,KU@p0T   dpcd@-PG-@JP1S1/R 0,2/ JxP.J00Jp吐GoOPU Q 00Q 00=U  XGo6dpcL@dd@-@@ddh /FXa%//A-Pp@`ᘀ010 R BT1 000  00  Ѝ P   0P@bA-t0@@Pp X0 0 `ሀ010 \ *! Pp0 0 0 A` \ 1:0 DP@bG-81@PY`10S 00 1 /p0V00  7JPZ u T T00T00S Z oTrpW \003/Y ЍG0000pW V`PЍWcd$cc @-I 0 dc00S/Icd00S/Icdp@-P<IX@@ 1 @T T1@Ip]c@-@P I@T]c@- 0@ dO-p0A?oR20LM(0S0(000p$000%PP/P" 0 P 00 0 09SuS 0 0CSr666666666666666646<6<6<6<6<6<6<6<6<60000S W 0W0#03[0S000 M+6S:666666666666666666666666666666666666x66666666,66666 666666 0D0C6S 0JY P0S00c0P0*S 00S00 1!0 0 000C S\00[00  000C1!0 000C S@PP00lS0P00y Pw\u\s0@00000mP 0`@V0-@t` rNS S G$ 0$B0N&b0j0I  @o  @@hFHoP 0`@0s 0l@  @ `@@` H$H`5`$0x0@P 00s 0 [RQ   GG 0@@00T``Y``0 R000X50,000C Y 0SW 0W0#03[0S,0 S0C 00@DT 0@ T0 @`Cv Vt0S$W 0W0#03[0S@`Ft4Z0s   x@P 0 @DS00@ P 0`@0s0G0 0 0 TC0P* 00@@Cl@@ ` 0`@@@` H$H`\3$0 0`@P 0N 0P 3l@  @ `@@` H$H`G0ANa00 0j0SQ000JB5 0E 00  C 0= @` 0Sc(0S02p03/LЍ0SW 0W0#03[0S 00 00C 0 0S M H! 0SW /o0"W0!03S0000S R 00 0,  0SW 0W0#03[0S000IY 00S W 0W0#03[0S@D 00S W 0W0#03[0S00  ф@$B@c-0@-M P0$@ @ @!800S @ @qЍ0@Ѝ/d-@-T0341X  1 0S 00 00 ЍЍ/@b-@-T0341X  1 0S 00 00 ЍЍ/@b-@-0 000Ѝ Ѝ/s@-P@`0 `Ѝp@-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@d-@-00 Ѝ Ѝ/ဋA@-@P`00 `bTU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <!1 @P >`Ѝ 00 U00S`C 0S. z,@T@p T @@ⵗ 0R#T d  R ! /@!bCQ00 0@!@ x @T 0 0 `ЍG[?@1c  Rp U 0 @cgfff%$B@-@ @@ 0 4 00"  |@d ф@ s@-@@-?@-@P0 @ @ @800S @ @sЍ0@ Ѝ/d0Q   4$BL$B@-`@P T0 P000S   yIЍpd-?@-@P@P6 0  000c3Ѝ0@ Ѝ/ 0S EP P@@-0`Mp@  FP0 Ѝ0-@-0 000 3ЍЍ/@-P`10S A3S r loPT #T 21 2@00@00A0S;$10SA000S 1!0Q000 Z$p0 P| 0 pp0 0S d0d 0Q01_T90 `b@bddcdda0$BdA@_$B-@-`00/s@-@P`rT 0 ,@e0 `Ѝp@idA-@-  ЍЍ/-@-00- Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`pp3T 0 H@&0 `\,$00S Ѝ@ ЍdAd-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`T 0 ,@0 `Ѝp@dA-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@0 H0 0SЍAЍddA$B-@-  ЍЍ/-@-00T Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``WT 0 H@J0 pP$00S Ѝ@ ЍdAd-@-  ЍЍ/-@-00  Ѝ Ѝ/-@-   Ѝ Ѝ/A- @T4qToBBP(@B01 010101A-4a(P!R Ap@1!#880RoB$1 q0$1 20 20dAB@-`R( 4q@_~B\0  (0Q!@D!!R Ѝ@BA@B  eP ^BB Ѝ ` `fP BBc"!p00S/@-`0`@0S@0D 0 @0D /B@0D 0 @0D @fBdcc|0P-  !T LD.!      /@bxdddl 0CS@-T0 !< 04 ,   !/@b$Bxddd@-靂P 0P@b@-驂0@傄OoB@b$0 0!0 00 /@bxddd@-<0CT 0 !0  !@b0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`L@ aAPp@-@UA @/00/A-@Pp` 00$0@p#0 A@bA-P@`wp 0S00  0S00 x0SAA-@PpY` 00@000#0 A[@bA-0P@`xpx00Q ` 0 * 0S0Ѝ@  A[c7?/0 0 1PS/ /@- @@00@-$BG-@R`pp@ 0SP!R PP Q PQ e vP0 00 0q@Pt7p@-@P@0S` p@@0U* `V 0a@-@@ e@p@-`Pb@@Tp00_@`0S   0S@p@* p`p@-@`PA@@T 0S@A @w@pP/0S /O-p`$@0S R 1 ЍOW@U@@@Y:N@010@P@@T R A8@6@0 ЍO0 S   ! 0S 0 0P0P@@T  Ѝ %Bp@-@0T S Ppx0T p0APdP PpL0`ۨP(0A ppcb@Bb@- M@  0 R0 00CS0 R=9 = 0 Ѝ@- 0 ?A3c 0ЍMb@- M@ ẑ0 0S 0  AQ0S00  00 Ѝʚ;@- M@ j0 0S 0  AQ0S00  00 Ѝʚ; \0R*PRQP/$R//</@Bbd 0Q P QRP/( Q //</ɚ;bp@-P@P@p@-M pP@0 `\0`^Z\k` 0 R S Q 0 Ѝ\ S0 C^  0\ 0 0/ʚ;@-PM) B>T 134AT0 `p`p`p>0 000@0 0/@P< ЍyJ@BH HqB34at>T3 .0S>@\`d0p`>@ ?\ ?! `VP *K0@wv@xPt*Ϡ !8\0H !2P P*]c@bbK7Aʚ;@B@- `@Pl0 00  Q00t0  000 0S0  AQ0S0$0  00Ѝpɚ;6eʚ;@-@^   H0R  0S!S 0\@tɚ;@-@^ 0 R0C? 0!T0R0\!S0C-@` 0M0RPЍp0" PPX P  R0 AQ  R0 X000WfPP 00S 2aTP Ѝ000 @ 00@- X( b0A*(P Ѝc@- X b0*P Ѝ7@-P@J6 \0P Br4  0 Q Ѝ0@00U -,^ :!!<  12X0 0(cX 0 p@-@P6`Qp@H60SPA-@pP`50 00@/6ЍO-s,M@0PXP`$ 0) B5  5  540 L#C8."<pZy?#ßpX0N40 38<p000Td0a@P] pTh 5d0 H0 TpXp媅0F1PT0`@VL0X0P0\0$ \0`0apUP!>pq q,Q02012410Q'5*5V`F&p8!qU.0P`Pd0 h0PS0 з 0 PSI d0 $SPB m@,Ѝ\J  B(xp0EQP! 0@A 0 Pc h0 00 0< X0O< @@ Q P`FpGd0 L 5( @,0,@SI$1((0(1>5cxdd*%B`-7x.7/%Bdc@-@`z0$MP00 00 0`0@pN0 00  0|0|`0@0p `0` (X00P0 `0@00 0$Ѝ xd.7,76%BTV1%Bc\bH%B-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 C//@-EO%B00@-M00|0|@| 0x00c00PP  TT.o <Ɨ80 0 Ѝ0@脗8@xdL&7Y%B@e%B< 7b,,00 C#' ,00/c\b00 Q0000$  B',#  /@b\bA-@PM` p40 0 0! 0?P W 0  \ \0P  !PP 3Ѝ$ 0  0 P B 87Ap@-P@3 Pe4`!A-@P3x0 3R ` 0SP` pp!VU A3Sd0@bA-0P3w0@ v!3p `V 0 00003`03/V30 0 0 1@b@-@F@Q@bs@-0PQ0 6 0@S f3000`ЃЄ 0S 3S3  Ѝp@+@bH77O-0Pp,0 `0@ `F`! P (0P@0 0 PP PUP@\b@bp@-P@3000PPp@E3/G-3P@p0S 00 `@53 6/2 0$ 0 0$  $0RPi@c@bDc@-L@L03/@2`0d 0 RS`0d DO@3@ccA-`pP2@"^\Up `0 0 P0 @0 00AT2D>0 000  0@c@bDc0@S@-H /%B@-@q`PMU:,A0 ִ [2  0 @˴ @P2D k k  k k0  00c0 0t0\00d0 0T00000<04Ѝ< c@c%B%Bt;7%B%B>A%B%B:7\00S/QA-H@H@`PQ2p"R0:A=2cc@c 0h 1l@cG-pP1@@X\`&V\UPX0LLP 0PP`h0TpXP\`2 vc@ccc@- `0@0S4/Ѝ0 ,Ġ 0Ѝ@c0@- @:7G-@Q 0,p䐟PcVʀ0 !0.!4/ 0!!c0    ! ,Ġ  GlGc@bxdddp@-@Q8@TphP` L P0RP0 0P0L JᚖQ 21p@(ep@-`xMV 0@S x P ᒳ000(`(01 cV1xЍp]cO-4M` 0100 RB 1S> 0S; 8@pT005 0P0p 0UW000S  X H0 S001PWxH@T8UP00 Z H0 S(0X 1 Ѝ0XL P0RP0 0P0L 0LP0PL0 0 00C0T R 00CS0TZpLPL P0RP0 0L P0 0@ H80{0P*'㨠  $0 0  0,p(`P&{0PX  P   0,p(`$0 0P{<Ѝ&B @ cI7 &B I7&B@-4M@(P .h`` ]`0` 04pPT#`4Ѝ 1 g?0j?0l0 ``0 000`00!`P  6.80S .+ # p8P$p0$0$Pu.0,0,0U  x0?S 0?03/ q..0(0(P#&B+&B@bE7G-424p0 @M0S#@! 23@  4QP@P 0?SW0ST 0SO 0SLX @T T= T@@Ѝ8@TX ".0S1].W5 $0@  8`80Q@P ^P@ аHTp.太0P 0R:P3.H RL0'.@80SP L@ 0WP0P0LP P00000S .We@ c@be f bO-X"0X2 00S#` Ѝ4P80S 8p0Z@0 Z ` P    P0+ .P`P0?S0S R PPP0 m-`00CS0@-T .f 7  00`PP0XH-U`Z P0SV``V``@ cee RR  /@-@P T@Lq@P-0PU L0S480S1 K-UP% q@ЍpP`0 X @0@0`0  @0@0`X[4p@P eP@]c@]cec3&BA&BA7G-@41@M8X T`p O4 ,N ` P0\ 0$C! $C1T S 00R0S#P,FZ   |PP ,@Ѝ@ R 0S H0R 0S,@ -OPP00S {,HR L0CbMbC-pMW(ڤ00W$PP: `O@P 2 N@P Ѝ0 S 0 s@#@@ cs@-`P:P @ 0 l@ 00ЍpA-p`%PP @! @ ,@00000Z,d0341,0(V0*H00V *W  b@@0` @@blb@-  Ѝ@- 0 ЍA- P` @P= 0p1S 4W 0 0 0 1X34A X& X. @@!R$ R R 0 0 @ L0+L00L0+0 @ЍP 0 0@00010CS@0 00@bO-` VM4 @p*0FS= PP+ Vh 0 @ tFxWI9 WR   N@P8 Z  : 4 V10@Y @ЍLP  P M@P  KVP@ N@0W0>  ᘭ 0 03/@P0W0>  N@ V [7D[7d[7[7[7\7 ]7]7]7]7]7]7Z7[7[70]704!, Q *" Q: @0 !@001 00100  @x#000 S '@k: 00C 1 0 0 00 3/@PX 0  "  00 0 0 3/`P 00 3/@@0@ 0@00 04 03/`P 0 0 0 0 0 3/ 00 0 0 0 0 3/ 0@0 0 0 03/(Q-@p 410 0`ᣌ@P0+KR@  @lb~f}f3{f@|fpe@-@=P p p@-@P00P @ 003/@p@-@M P MЍA-p@`PP @ (0SS-@ \} 2@S-@@0S<@0@@-,M  @P T-@,Ѝ0 !!0S`B S S 2( 000 00@ B5 0 00 @0@G-pS0P e0`@ U0^0S10C0XPP @ (0S 0CS@3-@#h P0JS 000S Z@ЍZ a7a7a70a7Ta7(a7@@o),)@PU  0厱@l0S10\ ^P@N@pT0wQ0 0 0 @@-0@0! Ѝ@-@  jP0000Ѝ7@-@P jP LP Ѝ0@-@)'0 0x0 @I)p@-D0d@P)&r"0@3@#V7)pp@-D0d@P(&"0@@V$)ph0p@-Q@ 1CQ 1CQ pP(&0000 )ppf@p@-D0@P0S S p80`H0PP((p0@`p@@p@-@D0P(@p@(p@-@D0P(p@(p@-P@P6 4v@t~(\pp@-@P` s(&'00F= 00'`P000@0?B (pp@-P@M(A` &0H0`3P &r0`1:0@(v(p@bG-0SP'@  pPP srF  (h0l Y^:0 h0l `z$AF(ЍX#x0S `;(P000p0t 0 p0t p0t `0Sp0x0 t S PP #`PC-0SP,@ p`'ph0l  y R< 0Sh0lz D$@'  ቭPW!x0S P' Ѝp0t 0 p0t Wp0t P0Sp0x0 t S PP #P 00&G-50S`6 PX`P.00p 0 0(00 0D@ \' | D@B0l000y0hy%+  @(034i00Ѝ蘅@N&BV&B@b0 0R0,00 0 0//s@-P`00@t  ?RPЍpp@-P@H`'U88hP@P PP@ @E'pcccs@-@`00P ERPЍpQ@-@ ʏ@ W@-@⡭P@oЍ0P :0Q:///0/P$ Qp@-$PP $@*&p@&&0/P$ Qp@-$Pp@&P $@*&&C-@`00PUE4&MP@ ͋0S 0S00&T5 0`{&840S$p&r&(PU l&-& P &W&U&a@ ЍC,ꎋ EhQP ЍcccC-PM0p\!Q# `4!0   LPP  PPY .Ѝ@@P# P0 0$& 0%804(t,0%0S``T0`0 PPP`(+&U0S F@bg&BcccG-SPM@pPtpM `P#@D U x0S@P:  0 0 0  R0 0200P  e@P (%,J4@H$L@%P#@$%P ,7(%PЍ(%0(8@, 40< 8 , %b$%(@r%H@TM 4@TJ PnUh @P0  RS@ QQ> <@4`0pO%40S@  @00( 4 D0%0($PL0%=%(;%(w%u%3%@0SD  D 040S8f%("%#T<@(^%T|0@P0S 0AQ 0S 0 ( ,(,@ɚ;6eo&Bʚ;O-P`p(@T 0(  X $$Z % @ [%HV(@  W $$[ $@T 0( u `,0pG0@0,0$v0@-@M0@\ QP#4!0  ᭌP@   o@ Ѝ0@b@-PR  `@P PP $q$0 `yP $$  0PЍp@P/p@-MP@`P V0 ! 000Ѝp"RS+ P P $4$P2U0!٪0P  RR   ' $V$ vͪP2U0!㸪P!SSp@-,@,P #Gp@Ccȅ@#cO-,M`\ s p'  PTXPp [ w7w7|{7x7x7y7|{7|{7|{7x7w7 P00\T X ,ЍOP 0 P00,ЍO3??@P $0 @P+ 0SP  $ [@P![ 00$ 0 P$ 0PP P ,ЍPP#@P P0T \0X ?  /%>2   4"  R0@`z 0S4#,S  @P  @Pz0qS0p'vw  @P^ [ /z7z7z7z7z7 $0ݩ@PO$ 0RP` 00 0)`P3  Z 0 B%ZRz7z7${74{7D{7   ! PC_oRU PSPS000  ` SPPSPPS, 0P` =P`N@Ou&B0@- 0@SP$M  sEP 0 P    $Ѝ0 0 R !//p@-@Q1P0 4a"P"@p1@0" 0@-@ 0P  MFP GFЍC-@$MP #EP 41$d z?0 0?^$ЍP`p崀P`1S$ X*41$d z?0 0x?EV  $V $PPPdX&B@B&B@-P04Mp3     41U`00@ P P$ (0"L 0 @ 0H4/@P 0 S tT  #T R@PE@00S 0 @\P0P4Ѝ@bPd@-P@`P 0 0 `ЍpO-R@|M8 PP 0 @+Y 0,Q@! 0000 1/@P0qlX X@` TD@P V ~ x|Ѝ8 `0P!,0#(04!0 0 X/(0S8(0 0 0 @ 04/@P(0  R tT  #T R@ X0B 0 R   @O\9 (( R LP0<\P "  @@bPd0@-0 0Y ЍC-4MP 000 0$03Up41@00 P(03`T 0 @ 0P4/@P 0S tT00#T0S@  T  0h!3 4RPP 0 Q @,ᛄЍ   7l0P0X0S@7 000LⱿP0'7 y P0S4  S1#U S1 #0 LݿP  7>@P0@7 L⩿@P 7 O0 @LPd ኤ@PU @ZaP0 UMP @HcB@bDBB00@-@0,MP 0 00!00T0@34100 00 0S N0@DT@,Ѝ0@bG-P R `0S0R@:쐟@ 0p+>F@P'U  V @"`/0 -F@P PP@ `0 U@ ᛌZ   peO-TMS L77`777 0@@P#@TЍ0 0E@P0} 0@@P003 @@3 41P00`@G$PSpW$0Y3pW$_ÿ῿pPY[`3Y94P0pU0,0 U 1 #$, A,0@PUp00P00S X ! 1, |A@,0pPE0U0T0S V 1 !, kA@倿}T` 04[A{0$00P e``p0$P Z``p0 0m0 R< 

P0< 0,p(`$ h0 0,1 0'>< 0 0,p(`$ h0 00 0'>< 0 0,p(`$ ~h 0 00 0'>< 0 0,p(`$ lhh0P 0'>0 0,p(`$ P < ZhDЍ M'BW'B^'BH cj'Bv'B'B'B B0 /@-00P Qս 0 cp@-@PBoPPVP ( P p@z㲽 R00 A-\0P3`4q00CS@@0$N@T <@bA-@` ㅽ0p CPP |Ѝ@P` 0 PP 03`P  `0\P1S!!1! PU020( w P s cp@-@PM TP0_PP+@@R@`V& T_P0@0@ @@@0  tP|0 @,T@:_ PPPL0Ѝp80@0@c'B\bc7Aep@-@P`0P ( R  pU  @@p@-pPPM @P Ѝ =@P0S00C>S@0`S@ 0S@ x⚝410 0@-@M P P ⅝ x>Ѝ0@-PM V=@P p@P0`S  c0000jQ  O>@ЍO-@$M4 0HpW0` UBPP NOPP<@ 3 P@P   (  , ^ R 4!W$  RR R0R Pz@ ,D<0j/ 0R( P 0W`0" 1 00 00!  尡@OpP> @B  =P $fH1 00? 0@0 <000000 P  Px0 00 pL0 T# $Ѝ0S@P]vo l`rτn0X@Sk/1!p@@PEV/H c@@'B'Bo cc0p@-P @`M P  6<PAЍp/G- p0Pa@POnk` 0 Sr$0SH PU10 c /o 0b4 bQP  S  !R!0C31$00C$0 PQ  T 40  <?oW20S@   <@)Ѝ!U   0jP @P P0 200P"  #P<#(@@- 0000@nP 00Ѝ0@-@PP$M  ;P 0 XP 00$Ѝ0O-2P MⰰR`0S: S: Y` ᘺ@ c;`P Ѝx2 : P `P rjU(`; p 0S{:$ 0REXc00 40h!  @ 1@11ᨁ$0 S`PU Zx0S P x |0 00$0080匰$00$0 A(n  4VU U TJ[ 0 P `P   P0 #R< # 0S000@@ P0P(`(`d 0  @@H cc]c0@-04 Ѝ@-@PM  :P#Ѝp@-`0S4A 1X03/L0T `0p<T00 p@$"$!p@J@b]c0@-P0M0@000TЍ00 0 @C-$M@`p4?hPP @ \0 0@0 0l00<0p `0000@0 @P 2h$Ѝ脆@7A-`4AMpn 1PT 8:@P*0@& (C@P! 0  0j?  0 0@P I.;@P<Ѝ :@- $10/10/ G-4QpH`P@dW0S P0 oq @4@P PP P0P@@G R HS@@p@-P4A {PPBp&;pp@-@4Qf@P-@pP0$P R @@@s@-@P4a0 - @TQ  :@Ѝp@-@|M?T@$x 4Qp` 00d0@ 00$Xp0pP@ T EF@ |Ѝ]cp@-@4aP$1S !@T 0S LQU000L15L1 0S  pPPG-03p@40P`tUN !0P R8P Rw@P "P q@b\ cC-`PRp`$M` V000 0u@P $Ѝ P0C@P0 4P0N%@hp0p M \ Mp@ #PV  h<@@V  @b\ c'B@-`PV  8@P  ` 0S  @QЍp s@P 0 9fC-@MT;0 p0I S@#* aVPቷP T8@P U Ѝ ?@A-`@V$am0P k=@P ?T034q`P T@O@A@QT A@@b@-0P@3U$Q4aWPPЍps@Q  Re 0R # 2=@b@-00@P 8ЍG-pW@ PP F40`0St _f@P0S x[x@/A-MM R 'Pp @U 3: `3/PEX01 ཚP 0S 0S 43/ 0 ۍЍp@-@$1P 0j⑗ ⍗@ Q$-180pycp@-@R 0`$1S 0PS P@pP@L 0@0@P0 /P0 //@-000D v Ѝȳ h @-000F/j Ѝ@ / B00 0CSr//Q 0S P 40 P0@1S///eA-@@t03@`P u|0S 0 R0`h+d0P0U TpHc0AD0Q00C0 R0(Qc@b]c[ce0@-P0M0@000TЍ0=0 0 @G-0@`p @M(0 0 <0a0,$@ @@ @P<@#`<0S% 0 00< 00a000'>,0(0$@ @ `X00P000a0,0($@ @ @< _@Ѝ'Be 7'B$7LAC-M@p^ 〵0 P`㬀嬐0 V:iT` V 1N7@`b]Ѝ0`1S 0 + sc'Bce'BC-M 0@p` P+0 a 00P 00 0 0 P[?o2P0S@.0S@*ڮ]PU@$ @9pU*0!R0X H@Pf@$_ @{]Ѝec@-808@ P 3  @`be87A0@-M 000 00 0p@P@,P 0R Ĵ`0 S |Ḵ @ R \@0`80  @6@P ~Ѝec@-0 000 0 000@VPЍ@fЍ0G-M0 0000 0p>PPWa 00R PY|@Ѝ&@P P0x0 x#S X  0@f`V`PU#Q  6@0S >P 噲P dT@|(a0 S  2#9(Q@bc[c]c@0G-M 00 00 0pP@ d`P HK@Ѝx01043P@吀0S* S@ud$a t`" P L@@@ PU!Y@TQ  5@udV $1S 0᐀09o8Qc@b]cA-L0C\1S`d1P\ATApv`@@b00@-0S &@1 0d1d4R00h1lah10,0, 00000(00X\1X10 4  ?? 000T1 0040v3 R `p0尓P$0Sʐ0`EP@ppWt3, 0倣噓 00P 000p0!`000i 0?o S c $0Q<V 20S0`` d1 0 ``@P p$ 0R  R 0 00SW p4T1S0X!00 00S wp #WpdЍ8<0 Px <0`1 0 2/P<0 ! RT!8 `  00EP0P #E`U 003/|Z @1`0S#T1EpPY X P0P(0`P  04 0S "T1S S 0Tp`p0D0D n0L0L0Y 0 `G (3HpP l 0H0H pd@b@c@p cO-QM )1321$0$0@Q00p>pBr Z0A(P PY   2 P (0U   Ѝ ᄒX `? 2 P1[ 0`8  2 P!0 !0 0 toYQ   3 oXQ 1 3 o[Q  ` 3 = 9@b@p@-P@U`0M  g2PPP  ^2P 0P0\0Ѝp@-@PP4M  H2P0D S# *a/b(0 0 00<4Ѝ@BO-p0EM341, 0 ? S0@3%:a V PGP 2@P81 00H@P 3@ U -Eߍ@b@@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  1PP P  1P0(ЍpE/0T!PR/p@-SP@daCtP\10`1\A `0p 0 pO-0@SP 0S 0`P `2T0SST1[0S+G`0D 0 0@ 000 !@ !@#88"(@#4<@"$#2>@""#1?@@0D?Sp@!@D cD8B\!s%1&000   FVU? Ѝ[U  0 h0Y% lР21p ppp p p\0R 0T1X1 X!| R   ЍO P `|c@A-`唀p?`@T|@0C0 P@PEPE 0 F0 f021@& 0@@Ac\b@-@( ぐ@p@-@0Sp 0P R \1S\  0S00p@20@-P0M0@ 000TЍ0!0 0 @@-0M?SR41pd0@SPT9( `P `@@D@ V@@ S @Ѝ$`嚽V00S @@0` 00M@P@T N=@ L t T 0 d0 Ѝ@^>0@]cp@-@xMP` x `  0P0 xЍpp@-P@xM`x ҏ0041d0 0A0$ xxЍp@-n@P4qeM  ṏH .<  1eߍ0p@-M4aP. /@P 0@ , ><@f T@ލpO-`0A$M>SL0p0R00P4A 0 V4EUSpC 0S :$Ѝ0S[[1S L0  P3 [" [H0S1S 30SX|)n 20S 2  X0'1Q>C/1C  Pp@\1QE 1CQ [?0Q Pp@Cs0S1::8C81Ppd0!S0  00!!0000Q0S: R*0 SP0C BS009&LP s@s@ c@b~f}f s@-@g_)0 0h0м@a_p@-D0T@`W_0\,0(@P@UQ_pp@-0PQ x0@Q l0Q?_\0S0 R009_p R0*/_0\0pp~fTf@p@-PU @D0`(0P`H0_p_pp܆@p@-@D0P _pp@ _p@-P@P_bbh⏻p㻧pA-@Pp B^\00tp00@`0^00F= 00'`PP囵垵 @-)0@ h2p$@A\  \ R/ C-0SP2@ p`^쐟ph\ 0R S( ^WP"P #PSW0S0 0 0 ,0 P0S00 S PP~^ Ѝ\0 Wv^  .PcAp@-` P@e^\0S0S E``^p 0p.@bO-50S8Qp@ Q1 `P)00夰 0 0(0 PhĺphW.^WKK0 a)^$+  P,034$00 Ѝ`@(B@b0p@-@PP D0R p`]b]p p@@- M0@ P ( ЍO-p0M `PP N D1R F@]$$880S   $0P0S X0 S)VH0 L0 H0P L RP 0 H0LP uap \ X RPP PV]HЍV@ɚ;6e@-@LM`p  'P P0U(P?oU20S  (LЍp@-dPP@dA| 00C/(0, | 1R@0@@1B @@VjpeQ!8 8S0 00C0C0CQ0C0C3+C? R0//p@-@ PP` p@=ep@-@ PP`p@0eC-M 0P`` @嬆0hp 00P 00 0 0@ L?o2P0SЍ c B000= S//-@-0 0008Ѝ Ѝ/A 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddqee@- Pep@-@,Pa080(p@es@-Pn10@T HJP4͹(Ѝp@ DZ.PЍpeeA-<1P@4"000000D1 PhP P U D1 _```fh !`F000000000UL!000000D15 !_0 ? R+@77$707H777 U P D00000 hLP U  _?0S00h8PS0C<Ѝ0`!@b@Oo @t!@b@Oo d @t' !@ D12 1"!10CS1!1R10!1 TЮ V% V+ VZ "`V00D00 0  Z [  0[ P 0]ce c0 @-#PO-`@pᄑ StM0@!B @  tЍ< #" (1204!QX0 R D! -P1 0S@0``$B 0 |:2s[ D1 |0 S0V dQp1dp#  P` p_VG<1% ?0T!kMVPB|I D1p`F|0 S5|0 S-,g00h 0 A000p`F000/P D1|0 SVQu<L Oe@b]cb0@p@-,`0(@$ <08 HDЍeA)B 87AH)BO)BS)BX)B^)BQB c7d)B- B 1"011 S!1 0 !q 0$6 cep@-@PX0U00 00@1B  Ap=Pe@-@$0  (@sp@-@P LQ 8CQ > _? = 0>;0p0<0Ј|Q h'K$p@p@-@P & oc/0000`0001S 0V (pCe$c]ceA-P`p0|@@ @@1B  lAT 4/0 #P@P ep@-@0P#PP@ [m pbe@- @$L^eG-DaP@ H8& 0 4 0 T 4 T ( ,8q ( ,3 $0000S P + 8 < 8 $ < $  R P @ } zU <0SPpm P @14 0 LS 0000?Y$0!D1  L0S81  UP hEP000s@1 t1S 3/P0000  P  9\0 6 V1 C/oS" R   ^VS090DW1 C/oS" R D15 0L s OD15D1G"< P1 S S RQ1 S S R VeP1PC_oSRPU   0 9  7T!U1R%2R1 S S R V@  & U1 S S R 0<0T!0B?o2R0ST1 C/oS" R D15D10<0 U  P < SK1 S S R 0S b U@ PM1 C/oS" R# _ 0 R P ,  'Q $0060S0>;+ J L1 C/oS" RP N1CoSQ0 \ P P pS  p0L P P  l@p0; P P V  @ X Z1 C/oS" R #L 00 S   | 1R!i  P XN U_ H1S I1S J1S+ ) U' 0 0830  :/0H1PC_oSRPU  P PEUP#U PE0 S = e0@p@-@AK `P @4pe@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`@pAP P | 1RP 0@1B P U Q XP Pep@-T@P`<?P,00(@@UpeO-0?2cŸ ?B3c 1#PESYL0S800ڈ0)V0S 0  #P& 0(PXX!R#U U#U_ `iSQQP 0 S BU` 0PP[B0H SQ00Q00SK |PtXUAQ> 0S  R8 HQ IQ JQ  R+p$p"@be]cbgfffQMbO-M=@QP`4q/ <=Q+ "=0S-3"=U C=U%0CUl=U Q0CU 0CURD @19@10=0S( -3$ =34!1P ,<Q ek0CQ,0CQ<0S<U P<0S S/8,8,8,8/8,818,8,8D78/8,8,8/8,8/8/8/8,8,8/8,8,8,8,8,868(<U %40cS KS V0CS{ ?P 0 :/zh{ *P 0  9/Td;Q \;X;0S~H;0S<;0S P? ;U gy 0p1S 3/P %X ` S] 1 0SY X0V ~%PQ( ~ < y( v 4D:P7 l Ѝ:0SoT18@18,828,8,8,8189U907 0;9U 0CU 0UTX D 10S 0RS;d9U \90S<H9U 0CU  09I0CUC000 U (9U 0U0!0k8UO >C0CU .8U 8U0 ~DU8U 7U@ 0垨P { ! RX   Qu0(03/38U0 >0U> >C0CUl0S00007U& t7U,Y_~ ~P  =x :m9d|00_0| 0CY0;P|UPPPbvI0 0Z - RT 0H0HS ^PP  0D @0D 0P&HbdP ^Pf",{,w^Z@XZ T ЍO, Nw YD0S ! S 9X0 0S00c0-1 0RX0 0S001 0SX  $0|00@1$0\1(0S`1 T,l4U D1"    2D10R810<1D1  0;; 0D!"0D1 hw1p8P3 pD12D1~PPN 0S" l003/ 03/P  8/y100?qPntQ0D!  %<D!08B0 <0AP usP4 100100@X00X0c2P0S ! SX0 UUxOe PP 1 0R8PPQ 9Pu 1 0RX0 PP0 kP R vS.+ЍO. Petrt0ht@f@^t e]c@butttLcj)BRct)BCt gtt,bt nt ot st@jt@wt@tt,@Bt @HtH~f$ceAp@-P@U0  @  @1B  E0p00sPeH/H!/p@-81 - U1@PSPSPU 0\ Pp<0 |P 03/T1 S S R 0<0l1S 7l13/ r#Pe/p@-P,0@TpYtP @ c/@-@PD0@PP  80P  R 00 0De cp@-PPL0@T 0S 408 CTT 00 0,p@e c c@-@P($08 TT 00C 0@e cA-@qP/pPP` sPQ00|0p @R 0PQ 00400S  R  0?e@ c@-$PP ] c~)B c)B@-@XT08 CTT 0S 00S   e c/ c 8080 1l1S 0 0// c 8080 1l1S 040// c0 6001/ cp@-PX0X` 6H001@0003/%000lQ_pe cA-Pt`P@@@ @L @ Q@P0/@(0, 0 00CR QD1 W3P00Ce0 /@-P0 @"6 0<  $0000P0@\ cp@-@Q@ x0`"6 0h Q0000X00X0 0$0?p$p@6 cO-0lMS 2P"0 & `될@, 0 XpW 0X0v@P@  ,Q,#NUwlЍ Y@T 0HY0lЍOv| R L @ Y<  @P  v@QT0@@ @phdRd #@@P~ w@7T0@@ 0R0T0S@#@@ ceO-P @ |M0d2db 6X20h00 @U  k LpWO R LQ 8 X}2 gTidRd #@P@1@!& v PW @Up@@TdR@1d@# v P@ @ D!L"$ L\ "P R (;  0  Y#p@@  ( 2/@T Rp0M  R} @@|Ѝ K@P{e cG-P81 6,10q$`mA@ 0@ 1 | R    X0S $ Y0S@ 0@  L0  S#  0@ T Q 0Y @ 0*Lx@  BQSD1  @ cex0p@- 6h0@ 0R1 R p@ PH P04 Ip 0P c@e@p@-@ PP`0p@3ep@-@ PP`p@&eA-P`tP @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @@Wep@-d0PQ0A TT 0SlA@OoBU $p@T@ ceG-Q`Q3@ThhlVT@ Pp0q0SS@C R !&r0p@p@ /0X`'p 0. ,l@0AT Tz & $`v0qi c)BG!BeA-@0` F@PP x0x0q@l1S XNPH0@`l1̀E0003/D1;D1PU ce$?8Qp@-4Pp@$0S@@'p ce@-@ $T@ ᳐0e c,sr/p@-Pl0@"6 0\ \ a $C 0$0;p@ ceA-\A0` F@pPP840101@0@$lJ 1810<10D1K<@1=`1\1l1S000( 0 03/P @ 0WP \PЍ00   0PP0C0 e c+T0p@- 6D001P003/@~@ep cO-P졟`3䁟4q1 610@ a  1 QX  S L0S& pq8L0SP.9AP1 0S X :  1[P ,< '# XI[ `s[ L R8LPHUl!R 0 03/@be cbG-,4( 6 4,0 a4PR"@T 0 X0@0X0D1;D1@D1  0 X0@0X0D1;D1ЍpvP d3R \3Wk 8>C1CW $<3Wl 0 $@ 04/p@z 0 $p@q0n 2 Rj@ Ypv2W, 1\0CW?h|z|2W" 0CW 0TR 0 00*<0e,2W0CW20S0S00@0T @0 @00@0T @0 0@0D>SxD1S0 008|00D1  0 1W )1W 0CW X0@0X000S81< U1ST100C?o2 @ S8 X0@ 0 0X0 .p0W T00SS%X0@ 00X0 c`tHJ8ft_t u wt@ept tttut 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxdddp@-P@`0V` UB&00 0Pp@-@P P 0SB 000p@-@0SP  \P 00BSs 00lRQ3\000 0S00000CS000qpG-p@`V0SS 00^H"U PPEVP n0 `F0C0 0PU0P0A-P`[Q@ V @@DT @@D50L@0BA\@ ^@\ A\0SpspgR\Π p@-@P0S0000p@ S0C0LU0 BPE0 S00 0U RR  p@-@`0 PSpS 0SW P0000`\ 0BSs00aR! 3 C<  !0 0000S000p)BO-`Q_@p0 S S0S 00078 P P PPB PE0UP m R A00N \ᡡ:50C0 `F00 0pPU0P0V 0R@ 0030c00 [ 00 *B0PPQ/@P - Q^00@Ss00nR\3e0l S0 -0 ^  0CSs00nR\3, /ep@-@  RP 0 BS 0 \0C0P 0CSs 00lRQ3\R  pp@-@P.pp40341X  10 P /@b-4X  \( f@- @4 X0  P p Q  Q\ 41P!  SX @ X @T@$@@at ]cp@-`d0@341X  10 PU 8p0 ᷓ@ŕp@@bp@-`d0@341X  10 PU 8Q0 დ@ᦕp@@bp@-0@41X  10 PU 04 ْ@ንp@O-@*Bp@-P@eP`  H0S p@/p@G-P0P @NP D0S G/p`W 1 !P @T0nPF舐Y B BR !  #nP @W1!V``@- @0P @p@-`P@p@ 40PS% S S  p@ S S40\ ES! S S 啠|xS S p@A0P L\ 1 p@ p@ p@ $Bh*B*Bo*B*Ba*Bw*B~*BAA-`p@0@TP0SX@0S 3/,P, cA-PQpT0@T0 R X@`0S0S  3/,`, c800S(0@0#1P! P #/bd0@  S/@-$0 @ )PЍZ>G-MⰐ P`p ` @f0P00SS-ЍS00000@ 00000Oo0e,BP@TQ $0S S S h 0QQP<0H 僙80(0z$00Xbe"@TbPbC-釟M|@P` pIfp0p $  ᷌0` f2 020202HX00 ,ߍepu8p@-1@SHP偟L0S0L0 HHLd`P UpH@0100p@ XHUH  L00L0H0P @0` FT^ p@X0\ /*Be 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxddd@-$MP0@TPp# 2a1 2000@T# 20#1 2 00 0$Ѝ`0SX@(0S 3/,`~ODT  f0S 3/ 10@, c@b"ee 0O-DM!3Pp'`0< C 00p 0,`(P$  P&/3 4p?0h380  00P,`(P$  /,3 4p?03<0  00,`(P$  .0 000'IJ!2 0  04p,`(P$ .0 000t!p2 0  04p,`(P$ . 0'!  2 0 0 4p0,`(P$ .0 000!1 01 0<4p0,` 0(P$ .0 000!x1 0< 04p 0,`(P$  .81 001 08 0 1 0@ 0<  妗 増0 Q3!P<0 嗗 dH0$厗<0DЍO舗EBeP{@*BL{@*Bu8Xb*BTb*BPb*B@w8/B*Bu8+B +By8d"@A-@`(pP$\!$jAaeP 0 0S/p@-X0PP LU@P 0 H@Q000 0pe@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` &PP0L00H@40 400;\00T0X0eG-0MZKT 0E0 0 A0 S@L\ 0pWЍP@T 0H0 0E0 0 D p!` `FV`!  dpG@0+B++BX+BP/Q@- 0ࠣ @a0 RS000(0\ 0C L000RS A(0C(0 ( 0R 0S PA0@-@P 048900H0000000H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ/\/0 ASQ/p@-@TPPP@pp$00$/$0 S$ /0S /@-@p@-$PUp@Qp@@-@0 ( 00@bp@-@s0 0P0 p!R 100 *Bep@-P P@ 0P@p_p@-P@PlUp0 #R PpH L RQ  3SHL0SP0\00CR0b 000P000F0G-@0P0,0S *0S  RpPA@UpP 0 0 夐0J,b 0U`V`! V `! b0PEJ0000CS0000E@TUU@peO-pPU@PH`V:S`F V@` @P 08 0 000 000HL%\H0H0`00000 @P 2V2(0 0C(000(( 0 p PP(` b0O-rMPpD@0 pp(p0 0pSpG@00 0@0000U Wk00} ( R(xPE0SY@0 `fV00 0 Y0" 3SH0L RP \0 fV, P 0% 3SH0L RP \0  ,00 BRR`10U 1 !2a P H`` ,00 BV 1U  1a@``Vq 0n 3SH0L0SgU 0 `P7Ѝ`P) `P U$0! 000S0pS00T:  7 #RH L R0!Q,Y @`@HfW0;0 Y 1S 0  00IAQ00@Y0 C 0V`!S  `000PpW `VP@-P   Ѝ@-0000 ЍP/@-PQp@-ppЙ`P+@Pp0 0` U Pa@+B@-@P@Ѝ@-  P  Ѝ0bSG-@9p`PP2 0 0开   I,b 0W`!V`! V `! j`0pGI0000CS0000-@TWW@$yPeO-`RppA@0```M 0PP 2@20(p0 W P U @POPЍ000JS0!fS0 0  7 P S 1+#  ` @`Z`pG RU0R    0eG-0@S) `<(0 S9ʸS C< 0CPHPI^P (00 A~(0000'PP@0 jI0` _y `P p(P0PEU.0 U + (0A=0PEUP p`$P/0S/p@- @PP e_pA-@pP$`V@P W0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` 0L H$QPp000$ vVQ@#pU  0SpWP0Uv    0 T P@ 0ЍS v(0(`0C(0 v B R ! 0> 0S0000 000HLXH0H00v p`F0Sp0P G0 3SH0L RP \0  , Bv R ! 00CS 1 ^+Bk@+B+B@-T Ѝ@-N ЍO-P| RP@ @ Ѝ0S@PETUT 0S     @ QHLQYUP`C !ZP 00YPZ0 P 0 0SP@PpJ^? \ RU [; #RHL RP \ 1  3S@H0L0S<\H 0P H  0CS300C. R+0 0000 ]00C0@ , B!R \  0 |0000#PZL0 @P> ` ]00C0 00 R00000 @o{@AG-0P 取p@P: 8  0 0  000HLYWH0H0`夀Ve]PP P  0 0 000HL8WH0H0`H]n@ꆊ@+B/-/-/-//-/-/-/@-@VT-@-A-PUp1p!0@W`DS W c c`cPW(0G-p`00 00@PP) X01 0!00000P XI Y 0 000P Y J0S@GЍ-/-/-/-/-/-/-/-//A-@$P` Pą@ p00  H\X  \`Wp  \PG-4pPPP8 `V@P 000 0 `PP@ЍC-,pQP`M 3 RP0S PЍ05Y@aX  00040"@8P 0  5 0SP20@T@ lL2WT W" 0CWe P$4US@P PU PH00@D@DT 8P$$0p 20@T5@1PD@DT 00S H0 0 @T 0S900 R:0 @T 0T3 0T0 $WT@P P $8 mPPUP W  `4PwPuiiip@-@PPPU@` [`PpPp@- p0Pd00S P0pDP<@r80 @pq'0ꐋ@@cecp@-P`0` 0@ 0AT 0S`0S@ 00 0pc@cA-@Ppx Z, 80R) 0 R) *`00<00@0 0$0t`|`p00S0x0 00P0:0X*`P@@A-P@pE0`,PVU  A^G-41p!,10RC*Q`= V PP<*P00 /R0S /XPPy@ (`Dy@ |⬍0PP 0,`8$0 Pb݇<@<,@$T@P?@cT c,B@-@P y00@-@<@l,= 0S \0LS   @,P 0yf@Dy@ccp@- 0P0CS`@ 0400,0?o2@T vpp@sp@-@P 0S 80 341R00 p@bp@-P40@AT ,XPtp@@c@-0 00 0 P Ѝ0A-0SPp` x@dTPKP (0S @A 00 0@Pc0@- @P ,0S@uT p Ѝ菕@@-@ P$0 0\  Ѝ7@-P @P 0, R( R@   R t #4!Q@5T 400S 廕 Ѝ0@J@@b0@- n@P$0sT@ 0$0(0S L Ѝ Bp@-0P p`8@嘆<0Pᗆ@0P pO-@PDM TP\DЍOlQ @A@AH1  6n @00$,ap0 !@(0 0 <00,p$@ @@ @"0 00< 000'>,0(p0$@@ @"0\00 P0< 0,(p$@@ @"@MPP |DЍ@cc8Ae ,BT c,BB@p@-@P8x0 @P wp0@-`PP @+TKP ЍPPp ?d=0XS   @00C@00 `V40040)V c@cA-` M4Qp 3/@Pⵖ@P 0 (00 0D1R 0ሖ@ Ѝ0 @P  x 0Q$ p#Ѐ4!0 x@BP 0 @0@0@0!R pq 0 00 803/@P  0 0囕@DRSP@bcc@c@-00 0 Ѝ G-pP0 M 40)@P9@P o Ѝ0 (00 01R 0 @ D H03/@P$ha5 P LUZ0j@@00 0 P @[  V@ /T  ЕP 0`P 0 0 0?V @x0!0R:4@@1PPS0P1@01@Q%00  P@@cT cc@- 0000 00hЍ @-MP `bPp% Ѝ(  ( V00S  0@P ⋊@ T(00C(00$P @@$ U0 #@0 0@-@MP 3P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0!0@ !0f@ W qqq 0000S 0 %P  0  000000C000C0$  S$ 01<1&30<0<0T00S7 0S 0 ?o200@0HpW81 [ .pP 00 0S 0080 3/0  U P A1Tpp0T@t0S 0t 00900#0p@bA-pPd`@0 0S@0d00T T0T H0'&"@P2$P @eX cHdbe@-@ 0M"@bO-+ܐܠ`̰PUV 婅ʄ0 0X0HP0\@P `N@@ p @@D3\0# $`%0 ,0嶄U eX ceZ>eO-LMPD00p000 D R Y D (Z`t    ""20x0x t20t2p0S@t0p@3040X040+ P }4S @t004C /DP p0S LЍ00 ?o2Z0S 9@00SL t0 0 R800 ZBT@0S 0SP00 R0S  2t0 /  3 Pa@Y2t0 D 0001 DR   Z;8 10R0 D0p 3/0@S000Z1;ò10PD0Z[pZ`qzD0(0 D0S0bg0`(0 0003 R7000S3# RQ- `# ,  , R% S 0!Spx 00(#0@>0H 0P$0  H0`0  "@P(6<00 $ @0S@@ [fZu.0o Ti p2 0{b W p00K S@C0`H01`C0 @R$06@0<0S,0!$0H` \p 0L00P4040T XP00 0C0000 00C00 R0000C0 0SK (0p`D(0p(pp,TZ(`t0000  Z p{ [ p p0WpS@@TK j 0[00Sx  @@0 p04/'@(@#@ @p0X cZ>e8I0O-@`'~:0,0 1 01$@ @ @000(`p+0,00 00$@ @ @000(`p p@p qdnKg P D匈@@<ЍOV~8e,Bd c(,B`83,B89,Bl cC,BI,BR,B8_A@- 400,00 0对P iЍp,Be 8{,BP/P/p@-@P`H0 Q f/Pp0 03/PZA-@P`.1 OP00T pS00?S0!40003/PPpᴄ5X c1 0 1 000/5/000/! 000/9/%/0p@-1@P`0 Q /p00 8pP 0 p@ 0/-/@-@1<1ቂ⇂⅂@p@-@hM`P-1@01^  h  N0 RN0 00S 0L03/ hЍp7@-@Q1 Ѝ0@ 0S P 0S 1@  30S 1@  3XL1TS U Ѝ0@W Ѝ0G-` 000@p0 4b~PPV  PPP/P ooWb`V )PЍ+P0S 0W0pP410@810007{2@9{D41Zd0H1 pp'B003/PP 101f}P@$8Խ8ep@-@40400$03/4P0C8#84?o2P0S Dpp@-@0 (PU0PU PU 1P0S 0003/P}0P1101p 0 !L00H` 1 1 kPP PP  bA-P Mpဃ8  "#@P ╋@P Ѝ%. b w=Fc 0d00 00(0<0 00W0 00040 @b@Qp@-0P@`@DT0p@ 0//pA-@p`P Lp` Ah@-@0P :l@ Lp@-0@S`P 0U 1 !R p HP pM@-  Ѝ@-@MP `2R 0S 0S  3/@e`$2VB VVE 7 V2V0FS0:F Sx888 888888`8888!0F3|q7PR   03/@?T*@'@V V 0|@! !@-@||@| P4:A-`SȀ@Upʀ 0! # 0  , !|0 ,06Gd0 0!!S0    !/@bxdddl ce@-@Q Ѝ0l  R:` <P#4!, i` @F.P 00@H 0TD@D0<0RH0e@bl cG-`RPp0  ( 0d嵁 0 R Y<8 PD @R @ BPS @P P㮻PP 0L00H@40B300\00T0X0C00 jHY```0ST0S@L@T@P,BG-PR`0 0RpP@@P,  ;HUPp(0 0(0@QpWT0SPLPT@0@TP0@Q@PU7,BA-@R0 p0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@P,BA-`@PpTXU\ 00 0RX 0SUI 01QT0S0T0@U: 0#! RQ&  3SHL0SP0\00<0CR1Q 0G 00080 080@P@0P00@pL@A~,B@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@pQ/T RT 0 0S`p@-@QL0LPpS  Q QP0 R00S0T@@0Q 0 00000 p@6p@-PL@Q``UQ V 800`0S0C0000800C80Q 0S L`L0SP0  RpT0pPE0`L`,B@-@@0S87@-@P1 @ < 3,0D0 Ѝ0A-0Xp@P` U[<S !P  P71S010SP0 R0` cp@-4$P 4`0?RL1S(@pP ,!80R 0,1010:01 010 `8@P 00000111010044P0P041418181@1@1D1D1H1H1a00 P 5001111001.1010.0000003/P -V 101y@-L@Q0L00P0T0PL0SO-p(0pP U[  }@`(0N@P U U(0 PP 0H@L0BÌ\PTX0\ 000P `E G[Eꂌ@,B@-P `@P   EЍp7@-P@000T Ѝ0 00@0s@-X,`0 ( P@\  x0@00U Ѝpx@-P0P@-P/ R/@- @@u@eA-P`X0@0X0ЍV,@p &x@000W T (x@#@X0, 0X0xs@-P`Q :x0@00V xЍpx 00S/8Pd7@-@00P>000U  Ѝ0@Z Ѝ00BSp@-P@`PP  $0S0$S0ĕ`p-Bp@- 0PS`(M  @P- (Ѝp0  >@P0V" 0;;0@P R 0  R ! @P  @ 0 S@ R  }@P h奀p@-M0000`P @P 4ځ00Ѝp@-Pp`@P @| Ѝ0@-AMP@ fP Aߍ0s@-P`ۀ@P @[ЍpO-p`P0vP (0S I&@ Ѝ K@P >00PY 00 u 0} !* 4S#@k,u@Pd!401  504DT04U0S ӗ0P`|04 8(040B=00  0  0 1 ::8C81@PsPTP 0000943 4嵁Y~ е{40#. ⶃ34-@,034噁@@ @_HB@@b@-Pp`@P${1%@ @P%0!00$@ K0@1P pPt@Xw Ѝ1$ R 0@4 101 @ 0@-AMP@ OP Aߍ0G-L1p30M4a0$000P 0 @P/$0 (00000 0 @P*$0r,0 WP@ @T (@P , Z( V0Ѝ,  ( @bG-Pp|UUpW @0 S0S``F``T@PP o~@O-`RY0pPP Ѝ@ T     R R @ 0P  hU0pW@@IYW 0JPp -BO-tM  ᜀ_ 0X  qR R? R(@Jva` R7`@P 4 A0$ (P;! RCP 0 0 0$ 8A0 04/ 0@0BPS 0: pP  #P RFUH30` @P 00V 0atЍ 0`   ^%Q# .WP a PAUT P00XP P@U@ @0 R   @`-BPdA-PM`pQ~@P 400000 0<@}Ѝ7@-P:~@P X@} Ѝ0p@-`PV M  V00 R0S@"  ~@P0LV :0@0  '$  Z@P E} Ѝp #@-50S@,M[5221P0 4q ` 0@PF0 000$000@P& (00(0 (00(0 1:11:1010 S;305<0@ T ?$ 9   $ c~ _~ 00$00,Ѝs@-`P}@P19@ 00003/@|Ѝps@-`Pf}@P 00403/@|Ѝp@-`P CP0p0  P ЍUP 0 S05 @ PT00  -B0p@-M00000P0` H@P #0@P P|P (|ލp@-p PP`IM  V@P0 0000 0@P # 0@P P|P {Iߍ@-`P CP0p0  (P Ѝ RUP 0LR0  +PT00   -Bp@-0M@P` ? 000 00 00`0 0 4,00003PP #0PP 0Ѝp@-P4M`p @P&043,0$0 S0 0 @P$0S 0@ P T @ @4Ѝ @P-BO-PPlM%  (@PhB00S@c80(8~P_ ( 80,00< (0 @, Q00(0P2 , 000 |@PA0DT:0` S;# p0t @s0Sp 2 H0P@P :`0P 8 @X0 S$0 00  H0P #0@?oV20S@ P TV0`D@ U{lЍ 10@"X0S 0HL@P H0 d00H"@P`0`0S  p $ HP@P 8(, 8<0RP00@ S00S @P000ɚ;6e-B@-@0M 0 P 0#܍@-@0M 0P 0#܍G- pW`P_0BS-3U@PP 0L00 H@$ B# \PT0X0Y P`P |>W@ W ` 0 R $R ÕP`03411  U``pV 0 0F0ERd000  R` R-B@b -BO-Mp 0K0$  $  aM R2 R(@=a]P 0S* P0 400"04! 0 $008 P5Q>QFd20SO VVPH 9] p#>A@P @P @0U (]P 9P 5Ѝ0@P 00 0 \`R^00S  @P  RM0S @P p04AQ00 0004/0@P0 0* R tT00#T0S  T 0 0$;0|4 h*W T00S 0@  0\0I@@-BPd]cA-`MpP z@P 0 0 Ѝ000!  @y0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` 4P3$00` (ЍpO-LM` $ y@P0P S;# p̰0ts(0S 0 P08y0U@LЍ2 00P" @p0P  0 D02 0PP-B-/-/-/p@-^- `  R0S0000 0 0h 0@@0 PP00@@0P !@100D1 0ppeO-P0㈰U`!R `VP R@ R RppG'qZY08/@07@-@00Pȹ000U  Ѝ0@ Ѝ00R0 0S  0Q v<괌@ @- @-p@-@0`PVp@0 `zᕹ/p@Ϲep@-@P0S 41d0D0giHji@0L0@0pp@-@P ~ P R@PF[@-@WU-p@-@TpP0P R  RpPp@ R   R4u Q  101pO-B@-C-@M`Iip 0p P 41 Pd00hhh h,i0S -`Ѝ ipsC-0`S' 0S$0S P@,0! C0001,0 (00C  @!0(00M  XЍptf-B_-Bp@-P@e Pp00Fp@-@R 000S0S P A-@pP`V 埸pܸRp0S 0`V`x` 0S  0S 0SD|@nA0巸6P AeXce@-@5p@-0@SP 0S%Q0S 0S P!ZP0D @Pp0S@`00d s?P pp cem-B@-@P,"80 S 08  @< @WXcep@-@PpP 0  p@I(0 S 000Yep@-@P400C403 Lp@+vep@-@`P̸ʸ 0 ` ¸xp@t1M/  \@-  0S 0S00 s)/x-BA-@`pPP 00S0pO-x@Pns圷cs0S 0S: 3 \mPU5|3PxPU>d3hP00UC0SX,34PU m(0S 00S 8 R4 S 0 0S ᛷ Pm<0880号XKJH &\[P6    00C000Sh P00S  4S 80S r(0SZ 1P Q@00=; )    +uY000 00(X0X  8  80S00@000000t᷶PU000 ;-BXcebeXc&9 c0S p@-@T p@P1` 0 叶 0S ö/O-PM0S@i@0%@e@`0@0  4Yp .90`PR 0,0X000`Og4%@P @T ,aPOO0@Kl@00@0(O@O10@0$0 00D0, @0 _@P }O\ TM0 0$pamO@00@0Ѝ @O-pDM@0%@(@0@0P) 80y`P @ T0,00`f4%@P S  @00@0DЍF0S&@"$_@PƵ됰[=@ 0R )@O008 0 `P @0S $别$ ]8$0$0@0@041d0D0peHse@0L0@0@0 DDF8@00@0@P  `00S p@0@ 0  0Sm/ 0O-DM!2P`p0'>`B` 0`,` 0 08p4($ P{0 00!'> 0`,`0 08p4($ Pd0 00!'> ,`0  0 8p40P($ PM 0!'>X ,` 0 08p40P($ P6 0!1 ,` 0 04p0($ P 0 00!0 ,`0 04p0($ P  ``$@gj @0`@ǡP (pDЍաAep cߡA-B-B-BH(9-B0@-00PSWP`. P @ Ѝ0 C  SH$10SD @P0S S S @0R00 @0R 0 0@0 @0R00p0S S S *@@0@ D@@0200S @*@p cO-pM0 0CS@U#04Q 0 V`$@V0001[ ! ts@P $ [Ths R` $Q (@T R 0P0 I D ;t Z0I   "  S$@d U 0  BJ6Ѝ 0 ,  v s0 ij4  B4 q0P Y0 00@(@eP/ <&9O-S4MP`  R%Q@ TppTpWh%@D#2\%0T%$10 000=0 00S@`pP 26  50@@ !0 SQ 00/ 0S7*# pp 0 1tA00 ST[  / j L  HPp$   D  p\ TX@ T[=  4Ѝ rP (Q qk pp0(2($ ,,0 0 00$00441$ 00q[ B RO  R R @@  @X @  r @  P L2  2/Zy pP ,   B  , ( B@ (Z r0!S B R8BX |P< R=/ P@H@ UP  1 @ @  qⰰP 0  2/Ḱ 0 gP7 FD 10 10S- *R9 i R R(n9@bp clbe-BKc@-BP P// R0@-@d 40  000R  0 /0@-cMPa/@Pcߍ0R@-@ 0S R0a/@-@H40  R 0  /0@-R@cMPa/ cߍ0Po8P0S lp@-@`P4Pu 21^Pk]ps@-P` !@P @JЍp00ꤍ@00ꬍ@s@-P`p@P0 @>pЍp@-:SP004SA-@`p PZ@P <O 2]@]@-P` p!@P0 @J Ѝ0@-00 Ѝ䤍@0@-00 Ѝ䬍@s@-P`,p@P @oЍpA-@`p\PjO 2i]@\T @@-P` p6!@P0 @7J Ѝ0@-00 Ѝ䤍@0@-00 Ѝ䬍@s@-P`o@P @}oЍpA-@p`7 P@Pi 2:]@/@-P` p @P0 @I Ѝ0@-00 Ѝ䤍@0@-00 Ѝ䬍@s@-P`}o@P @)oЍp0@4SQ@-l0/-B 0(S0e(00b0e`0P R0z/G- P@+ 'U `D`00@0$V0:Pp 01S @0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`Pl0p-B-B0ecO-QM 0|ЍOQe00Y 0p hW01h0#0 0 S0?o2?YR De@ Ce P@@D 0pЍb|婯@Th2`SP W00Z0S@x 4234EPh  10 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP#%$%U  0&H & 'L ')4(ᖯ  POU70T' 00S0/ 儯p0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsn#P$Ss 0 ]P[0eccHc@b0P @-P <P/ 0!< 04 0 (   !/@bxddd\ P/0 !8 00 (  , !/@bxddd/P 0%%#3/0e| `0R 2"-D | 1# H LH RH P LR P cp@-P`@TQh00_Qhh_000X S<@@ @DSd  09#900S? ! 0R9ڜ  I S `P 800<3/ƫ0` =V0 %%?b 0S 1pp@|Q t  | x x |000900000 0S"bw0p@ JaxS0000 |  @|    , 0C1p@aLec0c0ecp@-@P`dMp@螫cp@-@Y0  $g<00 06H PU 0 0傫0p@/0 yp@ap@p.Bp@-K0 =0c@b p@- f@PP P` P$0U0C$0 00`` 0)Z0 0$0p0ep@-P@0`T$ 0Rp0P@0eG-MP 0p` @,  P8 ll0Sp p p0l N  @P  0P >x E4PllpA d0ic1p0<!wP00c0e@-pM(ppP,`@P" 0 "0V060000T0#l20l20SrP V 0 0 0 ЍV 0 0 0 @bs@- `P @ P@P0 <P @k00ЍpO-0Dp`8 P P @밀4P<0YPP@0 e<P P>00 Ѝ gP ݧ 10 fᕧPcA-P`pዧ 0M@P 0 p 0 0(90嵧A\A孧c0/0e202/@o/p@-@xPZ 0$ `S00$ 1D " D0 $0@ 0D000001@  B@ P00P0p@}cA-P` $pAT !SR 7E0P AR0030#A0000S ЍA-,P@U(p Q* ao4 0R01! P ,% 0$ S00$ 1D " 0Q@0X0C@0+)Q A7H!R01! 0A \cDc@-@0MdЦ`2S D!0,0D2N, 00N   44N 8N8$<<N $ ,@@N(,(4DDN040<  HHN8<8 D$$LLN@D@$L((PNHLH(P,,TNPTPTTT X 4 )0 0000q 0Ѝ@w@c@bebDcHep@-]@TL 1$Pp@ PT0QP3Q/0@-@P|@0S0 $0@\$ D$L P$0 0L0P00CP0T00T00Q0cpbDc@-0 \@: ^0:@#77. 2CP/2S @-/0@-PR@X0\M0 P ' 0 XSX0# t0\Ѝ0 0 R/00O-0`M<@ Y001 0AS *)D!000`Ѝ 08 y !!X] 0  0  01PD!00080i FD!000~,`VY600pWpXpW D!`000i %D!`000\r?pW D! 00 0D!000G@0``Dc@b@-900iЍO-$M00L 0 $Ѝ(2` 0S*"D!000@ >H0]X P z8 1sU WP@W0S% 1I0"0p0@0p01 :#:0 1!c 0  WP U / FD!(00(020 00 0c@P` U .D!000,0S$D!000X UH0 P,00wD!000Dc@bO-P2P 0$MS ao@pH0S9 y@-RU@nW0S( 1I0%00ġL001:#:0 1!?c 0 iW P D! @(00(0W$Ѝ2AT !D!$00$0E1괓Y@ 70.SY Y80.S 0000S X 0 0CX:00y"@ 7&( 4>@lT X0 0000$ yD! 00 0Dc@bO-Mp80 0 0S:RP0b00T @ 0 Sᾣ`0cV`V``V:H0ST)Wu 8Y`(,@ 0 ᣨ 6 s7a& 3!V u,!刣 P00 0P0D0$0` 0D0]H庣T a_W 0 W: .R7 .R4  ! `1 ЍO(  0P0 $ Q$  L $  L $ 0 0L00倣0$ 87E!R 01a@ЍDccpbG-P0 S@pa`A >Z0 qa Q11 1G0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝl@@-0)  0;Ѝl@@- 0  Ѝl@@-@1 P [ PP  ЍO(P 0P   P 0;  4 ; U 0  &Ѝ#/B7@-c4P @P Z;l Ѝ0Hi9@- yD!000@@b@- nD!000@@b@@@-@-0@ @0 8 00 ,  U0Ѝ9\b9+/Btep@-0 9W@x0341$P@`P ";P ;P ; 0 000 pte@bp@-@0341$P2$Pp@b@-@4P:P :P :0@ #Wte$00S/p@-@P$$Pp@-@$0P@:,0 R P/20O-@Q1DM 00 @@@0 NX1pTa 0 0 @@@N zS0@(0100p00,(p$@ `@ @<08 #DЍxe0/B7/B c?/BG/BO/BA-@P0S`Pp0S  ! PQPW\PQ 0L 0000 0C00S  ! Ppe cp@-@TpP`Pz☠ 04R00 0 ΠP00pxe`eep@-@`T N@0 StPzs0S 0R00 0 0 8000R 0P0@因@pexe`ep@-@PP00C0p@芠`eO-`40@SPp0J  0SCQ  0RPDS 8 ! .P(0 0S1z1000 0PS,P_Np `000000 00 00 00 A 0000S0  @ Ѝ R RQ 00 0R000pe cxe`eA-@p`PUddN0Pp `P00S 0 000$ 000 00Ppe cA-@ `PX00pQp[0S0 R\S  ! 0< 0C0 00C 00 0C0 0pAV/B cp@-P @R0`"  0Pp R Rp0SP/0S5:/ P/O-EM@1 `Q41P$ @1200(0,0`V4`88X00,0V@,P 0@,0/00@@0(S,0 0P 8U 88Eߍp<1p@B =Ts@ p0, (p@Wl=0S6 J@  BH@P JUJ0@TJ@Z8+80 E=PT P:=  H@Pp@1X! p!H@P J0(0T,0S C, /  C80(P(0810CVS81ӂ@n :@02H00< (L0` H00`00Q \R HH V@X C0\S0@/B/B/B/Bp@-P@@0Sp0>00P 0S!!//O-1`Ps0 P @/0P ;/00041$@pW 0 8>p0@0 /RF 0PS P0 U p 0 ,/0 P '/0P "/0m000S =〃~P  0R"  4! ` !`S T0 i0 P 0 S !"P PSy Pu0LP00 0000S000 0: 00 00 0 /R RPPL z 0`\0Lp 0h0 PP0    +  Q  00}0\PP0 h0 Pr hPg0 00 hP070Sk \僽Lr.0L0h0-UP0K00LP0L PUP0S R0S 00 K0P L$PP LP K0S 0K00.000000 00S 0 000 000000 00 000P 0 000C0_0S .PP 0h0-Ph00S 0 L0SE W-0 .0\ 0 0S+L-Lp0S 0 hP h00Sh0S p0h  .PPh000S0^.PP 0p 0#hP -0h0 L)PP-PP\PM ̼K-tP0LS 0S0`(0*00 P K0S 0K0-P-0000P00XS009_ P  K R K0s-P0L00P0K0S 0K0? 000 00C 0L00<0S0S 0P00$0(7倓0$0 S$ vg200 $0@ ?=PP ?LP K-PI-g dITT p;h  hX0| x0l$0h 7?P?U uIxx mIP,0S60S 41 , 40/I,0/P 0 `@R 0 s {R}P` /U 0X 0X 0S hP40凯 P 0 S k*(0 0/U  ` `70/P0(0H00/U(0X 0X0S P0 SF*80 0/U (  (`0/P080!/U X X7 0S4 DP.44 0 S"*/U  ` 0 400 /P X R   003 H0 0 S:3 H?P!/U  X X 0S T@PD 0 S *,/U (0 0 ` u/U X X 0S !P40 1 0 S */U(0 0/U80X 0X0S `PP 0 S *(0 0/U 8 n8`4 0/U80X 0X0S P1 0 S*/U 080 0 N18`00\0/U80X 0X0S `PPB 0 S D0\*8/U(00(0 0/P &0(`0D070/U(0tXS PRBC/B0 \tL 0 S 805*(0/U\ 0 ` @ }U0 {  0 e@bPd0B@ c"AA0BAddA@A0B@AddA@NBpe0B0B0BANBR00Ǘ0 0   \0 G0$ 0 00/Sa+00S0 00 .R  .R0/S 0 00b+$0 0 /RS 0PL0A+0P00 00SL L0P 0 090P0S}  SLP K0SG +0K00L0P+ P4+0L0S> P P  Q7   T3P K0S* *KP0L0P+000P000000Sj 0CSP$ 0 00 00C0>PPP*=*U**:M R 0CSP K0S *0K00L0P*0000P00~*00 RP R=0K000@LP *L@PL00P000S  0Ѝ P R /PI00SC /U X X 0S (TPA@0X$(00S /U X <PA@0$ \K 0 S */U(0\0X X 0S /U0X PA@~@-(0M00 0   00   @ Ѝ0@-0M(0000 000000000  y@ Ѝp@-0@P0MbP?Pu/YPPPo`V(00,0P0,004P P$P(P@ 0,0P:48 $0H9PPN804 Q0C00 0,0(Pɀ,.Q .R: :9,0`)0` 0PS <00U0S R 0S ,0 0 jPP )U00P ,0 .00,0ЍpA- 00S : K0pP`800@  0S P `)@ WP@a.@P R)000B1BA-P@M`b@P P p,pp0@@U4PPP007@Ѝ0 @-DMP p`M@P,@0@00@U4P@P00DЍ0 G-P`ሀ#pᎏ@0T00/ 0P0T}l(P 巏@ q,PV  6/P 00S0P00P0圏)P07@- 0PI @P  V>I Ѝ0 1Bp@-P```@ P@4 @0iN  * & 0!pce @-@c P^<0,N4P @S"ep@-Po" @@ s"@p p@-Pd"P@ @@ b"@p @-@Y"@A-P`P 00܎묀p@T00 0S0PPP@ 0S@t V P@ᱎcep@-PQ` T00S PpR U @ P Tpppp, ep@-P`N'@勎0 R000@00P0徎@pp@-@%P 0Ps 0R 00/ 0P0姎p@E'0A-`@VP pY 0R 00/ 収UP pI0000@@@倎VA0O-pPM0@''`бБAP A0OBAd@ 0P - 0 S  0 z'6 X |,P3 }8P3 " a7 9X X'X) i/oV" R# 00S0ЍX0S(0S 'P %P ڔ00CSa*','`XVb@bgfff@-@G0 !!|0x0t0l000, !  ! 40 @P{GI1B@bxdddduA3B 0 Le0Le0,Lep@-P`6 E/0P0P0P@0PP4`v M0 0H0L傍pceA-Pp80`Vr@ w@P h`00 N./ V?U 0WI=.Pd0$0d0OPP @c c0,Le 0 ,Le0 ,Le0@-0MS@@VPP@ 0  `V@P@ VP @F&Ѝ00@-@P0UP !0S S0`D@P qp  0#P 8`&VUP Ѝ0P (`@0@ R/"A-P` Ⓦ1@S0101p F@ 01$@ 1R xQ1AqA`A诌 \ ^ \08 @#8 ecep@-P..000@ 00K,0$ R @@0@偌@pce@-@P I45 0$R 0 l@.ce<7@-P@P !0R!0R Ѝ0@-`p@PP ЍT$ P*R0*T @C-sMP P P9 P0d3qpTGH3 sr+ <" $$"GS P6* 4@7T EЍE@@2P `P PP` D0SO@ 3/@d00Cd0Tq P,R0* 4Y7$} PU D0S< d0 0d0屋D03/@ ld0T0Cd0-yH墋U^0S#噋V |HEhRpQ@TP匋\>ExL9EiP04 1E /EO@hPh0`%Eh@0P  $ 00$0$0$0@嫊lP0 `90d00d0 s@P hF$d[1BH;c1B~1Bd1B2B92B0;cĎA cca2B|2B2BA@2B2Bdbe2Bp@-P,`@P,P `ފ 0`  @@p@ceO-dM0P匰00 0P`0 f=P dЍ0S 0  9@P : 3 00 00PM80 ipP` 4冊 PT0P00L$(0q;T$X8P #P 6F0S # 0"P 8#0  00 0^0Az8@#!PM  P쁟310S[ L R$pW UN@a G U # 00 U # 00 ቲZ t#Y p#=Y0Uc# y# 00 H#4-V!QBP K#0 0U0 tP0404V*3B]c 3B@]cep@-P`峉\0@T Q   4 p@+ R R @ceG-@r`P4 P40 0匉p@00  0'00' PP) 00 00A0@p4pp嫉V  0P440PP "PP 4卉 0p0W 0PV{`V 0 EW "B3B7@-d0P@P  P N?U.00,V? SE Ѝ0ef3BZ3BO-pQ`0$MP!ࠟ ܰ@P $   _ P N?U.0  V? (Ep U lVBU TBX HBP$Ѝe`kAf3B3B3B3B@-@B @3B@-$0C00S@@bdd0P0S R 0 R 0S 0S/00e@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝp@-@H0  9PH0 0S010H00A PA00Q00@@@pe c"0O-DM 00(00!1@p`0< 0800p,`$@ @@ @ 0'Q!18 P0<0,p(`$@@ @0 00!018 0<0,p(`$@@ @0 00!08 0<0,p(`$@@ @ 0!0P8 0<0,p(`$@ P@ @ `)0 T @s3DЍO0@0eA c=Ad5Bn5Bw5BeO-ptQ`PM@@冯P 03PP'W $Q d@T`@T#凇 1P P0 D tq0P s 0o0PЍ @0 D tZ0P03 0 300T/  @ c O-`P0HAM$ @ B2 b0" 61pN 0 00@ 0 U3pPؠd@T`@T)R0t0 D 0P s t00pЍ  @)R0t 0 D 0P  @c p@-P@. P00CS 00 Ñ"`0St t0x 0`@x000p7@-@000 0Po Ѝ0O-P`㸀M v 0UЍ':@:@V@ V d9B  0OP Pz 05Bp@-@P`I'p@胆eH0 /p@-@DP:H0 49H00S0 1 . p@jeep@-l t0@SP Sxxtx0t H0; Sd0S0000p@!CecA- t0@SP Sxxtx0t H0; S``d0S0St t0x @x` d`0TpS S OP  0S 0@|!Ce c@-0@  R  R / R     + < R Q#e c 0; 0/O-,MP0S`0Q@`,` p内0PU WS@@hP V   +0'0>` V`p墅@,Ѝd d嗅 ` Pd V Bd 0p@Ic cG-Q-@BMp(1S@ R`  @810z>00BߍP O?@PPE}P  P Ġ Z w PE @cP  ཨ@P ⷨ@P ] pKU P@c@- @N000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`Pj Ѝp, ep@-M`P@0(@0 0`PT Ѝp, eP0/ᰍ@5B@-@aM V|q0U d40I H0`0L 0/0 4 $d>0$S-! !Q p Q>\0 0X0H>T00" "@>= ;>0 0h0t2>`P`0FSX*> 4L&>aߍ!>̍@`@Ar6B5Bz5A%@5B5B6B86BK6B@b6B@-@P ( >0S>@0ꀋA%@C-`00VM@YP) 0 Ph0pdPU0V0t  ? 00 0&R0S ,P ЍP̃@PT0SdPU i9c6B6Bp@-PH峃D0@T0pPh@d00d0c c0P/p@-P@ p^1Fx01000.%/&.%/& L NH+VDU +># +8 1|0pO-p,MT@P`P NX0mWV 41U!$1 0 Sc 8?@0P $0o<t00$  ᵫ[ 8 ,Ѝ$$吰 P1 ! V 8 0S  0 Iz0 t僁0S@d@p@T( SR8!41 0$垂 0  0S<0 S 00BQ0B03"`P`|  P0   ,`)0S SV( c@ce@bbe A-0/0040/0H0/-L/0P0/T0S000/p@-T@ $0$$@@T@U'pep@-P@܁Xp@ep@-@,PЁ 0 0 0XpeQ3#O-M  @ (R0`@PBU1# (pU< ` P``0 N@P 0U@P( 0M@P  ,G@P@  A@`0V S#0U M#ߍF#`B#PC-$M@p000 00(00@ 0 ( 0P1 0  !00 `0`1-` 0{-`P  " 4A$Ѝ8 e  C`p@p@-P@`M$ 2 "|`*Ѝpp@-@P`M< !"! z*@,Ѝp@-DMp `P@P 0P,@@00P14@P TDЍ  -@/C-p`MF"9*PP*0@S+   0'00P`3PK0  000&00`3PK0S@" @*Pp,ЍyKxdpA-P`p ?@P0 Ѝ0 du@ Q?dps@-P` ?@P 000du@ =?ЍpA-pMpP`@PE?`00\@4@80F14d@P pЍHP0S@00000 00!0$04100" `(0 `+@P {"w)@P 0`F0`@-M4q` P@P 0,00000@004@P o0S ,v+0P][_@Ѝ?@0@0$0, 00:#:D0@0(@P@)@-P !M`#4q q@P 0,00@000004>@P &@T ,-+T @Ѝ@0@0$0 00 +8+D 00, @0*@P@b G-M⨀`P p$@P @P0@0_0@@P($pY /+H0SD00 SD0 .R0.S 0t00S`280x00L0 0P060L|@P}0d``PSx08x0V +0tS00.S @_S0 .R0.Si 0W@R0T03/@PL0 `@P<U q`PU 0R'S)XD X 0S#YH 0RD@P 0 8 )0@X03/J MKЍS@@UV **0X03/ C*-U )8 :* $"@@@8 @-DMp` P@P]PP @DЍ0,00000@0/4@Pp0!0S RW# S+R@ , )@=R@, )@,)W@G-1a@3 M4q3ZP:+ 0@P, @P'T10S @ B0<00@00000/D@P (0S# ,<),(0P(@ 3Ѝ   P @RP0P0$0,( @0P0T0< P09)@P(S,<@bpePd.7B@-@T@ }eO-5LM@` $ pPt)P p `$p$P *Y LЍA8* $0000x0pYpSpWO |0S00oS  %(p0|0|p0G S*o| ` :P7 0S qV 0 (_P T `p (,D4Q (y,(Pf0((00P0(z(0P0 00 `F |0S 5$P @ 00P00/P 0P49}0 M85 0|004M80j}:Xx0S | 0|XB}0S SN}~ $0  @002 0 0   0S 0p0 0/P^+PY4| M8M( 0% 000 01 0! 0 000 |0%PV  p [+ 0 0M80 0A ;%S4|X0T0U 0 P  V6040w  00S |00 0` $P` `p-UV0 cPN  4VX600ꠍ@@Aew]=7Be7B@- 0 0 0000 wЍA-pPM@P 0@00<@@00-Dl@P PЍ(`P'0 @@0 0P.@P 0 0|@w k@T(P{0S R5|es@-P@PЍp4{` @00"K@0@004|G-@ĀĐ`0 0r PP Q Z pp 5|0| /!bR 02Z@TЍ <"9vvAQb7B@-A-3XMP @P 0p0 S:8:|:::D:l::::(:t:::, P@P,  XЍ 0 @P @$ 0 @P$ ( 0 @P  @P(  `ݝ@P( ם@P  ̝@P@ P@P@ @ ⶝@P`@ P媝@P @P@ 0000,`@ P呝@Pv @Pp  ➞P@ @Pdx` @V0+Pm@P z0M @W@Aꠍ@pe@-@M QP  ЍO-P4!MS$ ` p!)XW@1 x 0@?@0Cp 0妢<080 0(@ T )0Ѝ@PW #0O80 )PP Ƞ  P00/S S @0S@ + DHP+ B@ /  pee0B@-PX0M`p @P 0 0 0u@ Ѝ蠍@p@-@`L 0P@P @p @-PM p`9@P  04 00#0A@8Ѝ@bp@-@`L 0P@P 匝@p O-41MPl@0D`@ pT0 0P[0$0P 00 00P-U$@UT0H H00p@0 UT*0 0 0P@0 3/0P` P P@@0 3/0P 0'?0Ѝ 0B@-0 000Ѝ G-p4`l8@P.0P0S@""PZ%$@@V0S&  P ᜡt @7Ѝ @iT  q@ TPoPG-0Pဓ4q$@8+@`P Z PPQgP[봆;+$* GÆ@b0@-Mp 00000` 0h+@P7@P0`P00S@@" "@$T.}7Ѝp@-@MP `G@P U?000,@@0)4@P @Ѝp000S@@"!@PM$0s@- 4Q@P $P@`Ꭰ00ܠЍp0 0p@-M 00000P 0`*@P0 @PBЍpO-5,MpT AP> 4a$$ 9@P 0 00000 0P  000 0@P $ 8,Ѝ $0R  8$0  O:@P$00P@P#$  8@ C-p0MR`P0'%vP 0 3/@/vNT T+ du40000 000@S 6ꨲ@ R@P0/S 6@P0 y ЍLc@-p0@ @`$PP @ (0 S@ Ѝ@b@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR00 0BS` !0 !  F00S03P R30ЍpC- pሐ2P@``V`31P01 0@PP  Ѝ]0p@-0P@0P 000S 0 p@Fp-p0ASG-Pp@ `ᩙPP00S!3 T` TS @P0p@-`M 0000 0P|)@Pl@P T0P00L@$@(0'T$@P 6`Ѝp8`0p@T  [@P0 00S030h@P 0S@3:^@O-P0!M0#r`4 0000 0')@PbUPc  aY7@PW  a@PG@T0SG  @P  y@P  7P 0S-@+" ] 0$  @P  03v0X  X mv 0 P@P! 0  ?6Ѝ-@@@b@- y Ѝ@-M pP 0`(@P @P @,T @CЍ@-M@ 0P 埙ЍA-M P` 0po(@P @P@T 00 00@Ѝs@-P@P 0`00@P ]@ rЍp C-P0M4 0000p0 `'(@P  )@P6pP @Ѝ0@00@<0_&D@PE(`V@&Pw$0 00:#:T0> -: S'  S"  S0 0@ S+0  S0P00TS-sr-@,< ,P6V  00 P-0T+S S  ,<\!@P ,< ,d,P0< (@P(o,P0< (R@-@# Ѝ@@XЍ@- c Ѝ@-!  Ѝ0 cC cp@-HMP\0  1 1 01@P+XY@P$0`800 @4`0% <9@P 0$S@0S 0R@4 }@$r $ HЍp@4 $ 0P P ꠍ@@@-; 000c0 Ѝ@- 0;0 00Ѝ0 c 0c 0 00@-DM @P$P0@,P0000F%4@P 0S00,0P  P @DЍ0  ,t @P ,| 0c p0m0 ch@-0S@`@P 30P @ 0,Q@ 0P000 1/@2ЍpC-pM`2PP 02 @ 0,Q !!1/@P  Q@Ѝ@200@-MA0 0@QЍ0C-pM`2PP 02 @ 0,Q !!1/@P  cR@Ѝ@k200@-MA0 0@RЍ0C-`DM0@`) P UE@P00p,@0@e$4% p I#T#J#U#4p@P |%DЍV@ P\P@P @P @0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00P$4@P @ЍpP&@_ @-0 c Ѝ0@-MPP @@0cP 屖Ѝ00@-MPP @0cP 堖Ѝ00@- 0MP P@00@P 卖Ѝ0@00@- 00 cV Ѝ@- 00N Ѝs@-P@0` @P @ Ѝp蠍@@-P`1@P 0 pj@^_1 Ѝs@-P@0` @P T@ Ѝp訍@s@-P0` D0D0 0@P L@ Ѝp訍@@0@-0 c Ѝs@-P`i1@P0 /@1Ѝp@- 00 Ѝs@-P@0` @P @ Ѝp訍@@-P$0` L0L0 0~@P@0 3@ t Ѝp訍@@0@-000 c Ѝ@-PH0` R@P0 00@ R Ѝp蠍@@-P` 0@P @0@0Ѝp@-00 00 Ѝ@-P` 0@P 0 00@0Ѝp@-PD0` @P@0 @ Ѝp訍@@-PH0` @P0 00@ Ѝp訍@G-M0`@S11\p @ q0s)i 0s0Sp" 0PPp Ѝ0S  PP 0s<"(PP  0RP% P0UPP(<0 s` 0 s pUZ0"(00PW q P0PPꠍ@@p@-PM`0@P 0 @0@0c e@/Ѝp@- 0  0@0 TЍ@-0 cIЍC-LM@hPP l0S (eP(0 !R0 1S 0  0D S:LЍ/``0Q*!!?@B@- 00 @0 Ѝ@-P` /@P 0 @0 0@J/Ѝp0@-0  Ѝp@- 0MS@$P0` @Px0S@ @P"@P] #"@ Ѝp蠍@p@- 0MS@$PM/@P0 @ `h0S@  @P 0 #0 @.Ѝpp@-PM"/@P0L`q 0 0 t@.ЍpG-PM/@P2 0 @+ 000  0- @`@0! 0 J R! B @`pX1P0  5@.Ѝ@p@-PM.@P0L` 0 0 @_`.Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPpf.@P 0 @ 0 @@00PE@0@0S 0 00-ЍPd@-,0@341!$ V@bp@-P`Mt  w@T0@&0S00P0%"@PQЍp07@-<P H@P@K Ѝ0蠍@G- P  0@J 0S10C 000Ѝp -P 0  P `D0 0SP 0 P-PG- `p0&J 0 S10C0 -@P 0  @ PT 0S@ 0p@ST-Ѝ@@-@(qn$0S( ( (0$ @n@c@-@, 0^n,0$ @R$$ ((0n@ce0S ( #P QS//@bA-@0P0pe0{@@-@g>0@ e@o/O-P`XqXXf@0@P0SܰD܀@H@0TD0 @-g ЍO0  0S0ܰP 0DS 0 Q000Ԡ00 @ gd9f0 rPگn,00oBaf`fccgfffbp@-PP u@Ppf p@@p@-@PPpf p@p@-@PPp~f p@P)\0S\/@- P\0@PCc@-@`f@f@-\0 S0@ @0CS\0P\0@PCJ@$8Bc@-@_01010qqWPecepbcp@-P@`{c00p@xc00/0S S</ // @-@P` pt0  Ѝ0S0S@-l0  C04 $ , 0 P0 *0\b4Hb/@b]c H /@-0@ PPX@  P P @ OH0 /@-@AbH0  .?H0! "! 0 BR<:::::::90000 000 0(""'80@H0PX0`h000 0|0004;$x0| Ѝp9:: :9: P@-0C2 02@bO-pP0MࠝS萝2 `@ )Q00S  aa 0Q  R 0a0Z Z. Z  0 P0S@Y @ ЍT X  R! B @QSx!T @Q@P 0 PD@ 0QP@@PO-@0MSSPP  S PS YPЍ  R! TPp"  Q\0 P00 `S````S 0p PpP Y 1ဳ3"&  [ P!0p 000S; L13" PP[ nHP;%P#U0PP10#00 0U00 塈v`H0;H0`C 0P0p0`p 0U 0 03?oK[20SPX  0 갬@@b&p@-@P$Y@ pA-Pp0S`MS0CS"@=S @0 2 1@PX.`134110 @ PJ`TU tR`1QXx j @P 0S_ 800C00S*` Ѝ00S,0Q 0S(O0H0 @0Q@Tp>0 0 0 ? @ 00800S@@at ]c@bf@zfzfG-P,0`0Q @0@L0S% 0" MKJ   pP  0 < 0p  Y  B L0 I0 0 0 O-,@ 0!@L ( MKJP`Pp Y0FoSVY6_ 0S [ Y*_ 0`Y@ 0 F00 0  O-@2M0 2Pc0,000 00UP48<40F  L0 000 00, 4@ pP  P$RP[P; P` UQ@0@01[D00, 00@0P ydyeZ-b 1y 000$20V ,0D000PTK0S? 00S=  "  ) P  ^X00X0^ , 0P0[P0L (P @ 0&@ P -OY 1P $" Ѝ @bp@-PP@` F^X00CX0^ pPp O-,M\`ကP@`dpP0 0%!X0ЍS@@ V @PY 0 0W@0/oS" R@X ,Ѝh04100 0SO-P@1H#DM  l嬑嬡 00S`0@00 00$0040 0S410080 p0@?] "^t0  0p000 `]" ] V00S 00S @Dh0@DЍ0S  3/P0 S     ]0 00 ] ``( eC-4MT P    ` Pp0 0$ 0PX000 00# U@! T0 0C04Ѝ@-4M`L @  P  pH0 0 $ 0n@<00 04 T`4ЍA-`Pp\0  -P@0 00 @VЍ0 001/4 ep@-@`%PP `a"PP 9p0\ X00X00]A-@ M0 P0  P0唀`"gX0 Ѝp@-@`P\ 00@T p@\ @ A-P`@\ R   0 RA\ P   0 R Up G-P8M`@\`pU+ 000 00@T"P04!(@,00 0 " X  / Y 00 ( 0 D, (8Ѝ@ 0h8B@- @`wP DoP 0iP  cP s8B{8B8B8B(00S/@-@@ Pd8BO-4Md`pXP\p[ 2 00000YS@) P)@&0 00U@! P41$ P00(00 T嶖2 00 `0@ E  4Ѝ8BA-`PpX' 2-P2 00@qЍO-P-TV@Gߍ褍@@-PGM`p0 ⟀@P\0 @P 00 0@-TV@Gߍ謍@@-PGM`p0 y@P@P0@\ 000 @]-TV@GߍA-`0 Mp @P'`00 0@PppU0PV0 `F000pP P@p!00-TV@ Ѝ褍@A-`0 Mp @P'`00 0@PppU0PV0 `F000pP P@p!00-TV@ Ѝ謍@G-P M*@P)0 000 @PV0`W0 pG00 0wP P@!00-TV@ Ѝp@-PBM`0 @PP0 +@P 0  @*-TV@Bߍp褍@p@-PBM`0 @PP0  @P o0 @-TV@Bߍp謍@p@-PBM`0 j@P@P 0@M0 @Q-TV@Bߍpp@-@PnW0  .p@Wp@-@P`W00PPWpp@-`0@#2000FSPVPp0P V00p0@-P0M 0 0P@P0 03/@Ѝ0蠏@@-000 03/Ѝ伏@@-000 03/Ѝ؏@@-M0<00  3/@PЍ@@-M@000  3/@PmЍ@@-4000 03/@P\Ѝ,@0@-0M00 03/@YTP PV<0 0R 0P-VЍ0H@0 e@-000 03/Ѝd@@-000 $03/Ѝ䀐@@-000 (03/Ѝ䜐@C-0M p0@P" 0"sr! P`qV $V0 ,03/VP T 0"Y0`3UЍ``@긐@@-M@0000  3/@PЍԐ@G-M ` 0@P P 0 'V $pcVP0403/ 0` Z@@T X0P3ЍPp@@-( "!0 803/Ѝ @@-( "!0 <03/Ѝ(@@- 000 @03/ЍD@@- 000 D03/Ѝ`@0@-P0M 0 0Pl@P0 H03/@*Ѝ0|@0@-P0M 0 0PT@P0 L03/@Ѝ0蘑@@- 0 00P03/Ѝ䴑@0@-T0M0 0 P /@P0T03/@Ѝ0Б@-00$M0"!#!0 X03/$Ѝ@0@-,M\!#!@0 00P @P0\03/@,Ѝ0@0@-@0M  PP 000`03/@PU 00UT 0+ 0eUЍ0$@@-@000 d03/@PЍ@@0@-,M080\ 0<0 $0 0P @P0 h03/@b,Ѝ0\@@-M@00l0  3/@PjЍx@0@-@0M jPP g0 p03/@POU 0TT0\+Z0TЍ0蔒@@-M 0400 t03/@P+Ѝ谒@-$M0(000,0 00 x03/$Ѝ̒@@-000 |03/Ѝ@0@-P0M 0 0P@P0 03/@Ѝ0@@- 0 0003/Ѝ @@-000 03/ Ѝ<@p@-0M` 00@  00 PP 0 0@03/0P0T0SP ЍpX@7@-00P00 03/@ Ѝ0t@0@-,M!80\ 0<00@0P 00 @P003/@n,Ѝ0萓@@- 0 0003/Ѝ䬓@0@-L0M 00P @P003/@KЍ0ȓ@@-000 03/ Ѝ@@-000 03/Ѝ@@- 000 03/Ѝ@@-000 03/Ѝ8@-,M 00H0400800<00@0 0D0$00 03/,ЍT@-$M "!00 00 03/$Ѝp@0@-X$M 0 0P @P0 03/@$Ѝ0茔@@-M@000  3/@PЍ訔@0@-X$M 0 0P @P0 03/@$Ѝ0Ĕ@@-000 03/Ѝ@-$M0(000,0 00 03/$Ѝ@-$M0(000,0 00 03/$Ѝ@@- 0 0003/Ѝ4@@-(000  3/ЍP@@- 000 03/Ѝl@@-%;Bp@-P@`P00@000000 0\(0P0Pp@!e 0 //00// //0/@-@-@-@ P 0P hP @-@0$ @ f@-q A;B@-0z$0@@-0z// // 0 //0S  0S 0@-@@0S  00S  /00C S:(:(:(:(:::(:(:: 0$ /, 0 0>7@-@00P#R000U  Ѝ0@? Ѝ0URp@-0@ R R p PX `H 0PPCX0^0PSP $0PU40%V Z1 Sl0<0P0 !q0000S#000_L1M[ 80  000*80<03/P  0Rn lj(0S80S  t" R 0(0S  0R l @0?o2X0$0 V40"&0:D0D 01L0X0 000L00000,0P (0S ,Lu<L x0& (0S PL` 0P0 0R0SD 00H0D P`S,0`p @8\  0P(0SU 0$04 PXV``,0U`V Ll 00X0$ 000000040p0P (0S* t0`T00TPS 00 0$ (0 \07320@0S  0P`0 T06P0$0P `V40P0U`PR0`џP0 0`0$``00000@0S606 00P0P0娆0C00S|d0<0 0$P4 0ct0V $0U40+00 1 0@{ 05rt 0SrZsQ 0 Z3p0000000p0Pv 000 尠@0Sf <0S ቞T`d0X00S 80S8 0 P0  P /$ 401/PsPT0St ២(0Su @0 sX s600 00y %6p1g 0@ `0 0zG P00ld00 Vd001:# P `V op 0 0/  A!t3!00S V 0# . R  T P! @;*"*X S 0|000*sr1`0$ C o00080S|0"^P0 >0 0S#6  s0 80Z `s0d0|P倠`F0 $04 RS00V00S< ᘞ$ <0  Eଢ଼ 0<\) 0  Cp012t 72\ q\PU0p b5PᬠR Q\ SQQPS2< 8P<00P 00 0iP(0 0X x0 ?o2"@  D UXWY% 0@  0  P0Sr0P ,0L!+~I 0D0 0 $P "(0S@(0S0h0k lV;B@bD1O-CMD001@ @ 041$0810009309L0081 0H000L00p,0ၼ0`S L000 JH0  d0SFJW ,0S 80< 03/jvrPCߍW5812 0 SpRPP) br_r`E눐Y `H,00q0p,0<P 81 80'03/PP 000% 0$ 08 81 0SH7 $01 V$00 81 000S 00 <00@`D80 0RPP9 " R$ 0, P$ (`,r늋qt6 010 S0 0<0H0S81 000S  P0jT0 0b 0H 0E <1SP PSI0S H0  0S0000 0S 3/H0  ᠻP d0Sq00+S [7H`fIi`V`069W% ,0S 80< 03/R0 0S 00(`,S Zj h$ؿy(0P0,0T0{0`040 V `V 80` 0S4`0808`0P(0 @ pA 0(`,0 00h 0 `  01/9v0 )V. `0dS00V#6:X0\030*V 0p\000\ R X A!\X00CP1   \B?1Pa&X  R 0 R"6:PNƠ/ 0X00 000B?*AX000\0 X00X0`0X0S%( R \(` 0C,6`ßp0X p0P05/Pkp(0U0 0pPX0\(p0(0S к 0P$00 @0PD00 R Z  R R  ^`40S  %  <0 0 S 8  R0 Sh 101PT0S @`T0S p@bd;B;BHd@-0 000! Ѝ 0  /A-@0MPb 6,0F00 00ZЍD1A-@0MPb ,0F00 00AЍD1O-$0p@P`LM 0  00 000B 0 01S LЍ $&/ ^ oox1 32p00 PP000` 0o 0S (noQ([ 1 0@ & (  6,  ?(#$<8i 0(P8 R  p[q @  DPP@bG-@0(MP3 0bqFa @. 0FT0 0T0 G ᯚ0000$ 0$@ b62< RW1Q00Wrp @0(Ѝ@bO-0TMPS@$0 <Q$    $  # Q $ R0,00S$0S 08 < TЍO/8 <`#6/P TЍ0S0000C0D#D SX 0 0 00 00000" R0 0 0;;020S#`(030 $` a 0Q2! QP#Q0a po0pW` a7qp QV|QS1VaDH8 40$Pqp D8 40 ?R+`Tn10000 0`. 0Pu(0 S00 ,40\pPjx!0 00>0`00`0`F,00<0H1080<1 81!&+W2:81 0(0 000 :#: 000p 80  ,,W-00000C00 000 0C000H < 04 H]zZ>;B cbHd8:p@-@PE0 Cp@EG-P`$0@p3/@PZ@00@800 4/@P 40T00SOj0Vw Sw P$03/@P P 0S9P 0S00S@0SP 00L0D 8/PP H0U00S @@ 0W1 V5 P 0S  P 0P  0S 0S PP 0S P<0 P0 Ѝ0P P P nP@ @SSA-`Pp@ T VW PAO-P @`TU  <T 80 0 06/@-+ ЍG-销@0H?oP20p`PS V TXTYGO-DM,0000l0Ph0t( PZ@ Q`ሠ$0 3/@P0S@800@ ,0( 4/@P80V <00P p0l 5/PP<@ Pt<0Vy l880 R R<PS 4<0S 0S PR8<P PP8p@P /0寻-/5 0T0/ 0X0/O-`DM@ 00 0 刀匠00  `` pP 01s$ 0 0p0 13/P 00s0?o`2v0S  PP 0 0 DЍU P \ PU˰p  P 0 p Wʠ@SAG- P0` 00 00CS @0 00 013/ 0p@p Y 00 00S@X0`}W  /@P  |q qq 8<q|HLq|q (,0sq 0S S 00 000/0CS///p@-P@0003/Pp 0! p0 0SS 0 /S 00/p@-0` P 00CS0@003/@P 0 u0W*} .0B d 0;  0.041d 㐃+1  0)!刑刡ƒ1!0| #! 0 /#1ᐳ+0 @UX0*P 0 0@P 0 0@QX0 㸀娐娠Z@0 S: 0 0C@ÿ2<0+#! ! 0QЍ:;,nmO-Q`0"0p@P "帵 0㱵p2 S0^%> X@Pᣵ<2#!@TP0 "嗵p"1!@TP0!勵!dƒ @TΠ1#P<++! 0΂p'' ᨁ p 0p !P00Tp0&@TPp@TPpP 00 Tpq@TP0G000P0p?T @.0 @ p-. 0 'P@< 0 < 0 Ѝ:QO::mnP/G-(p$`P@ḾQ<0S00$00V (`吀?`aV $'0#$+4>P W8P< * %!  (R$0 ȴ V (00100 @ D@-0PS@`p Ϻ0 0000hV 30 $A&0@V 3 Ѝ@e"A@@-0@00$00XtPp@-@P`-յPP`䑺 jPp@-@ M30!( :@ @-0@0!80@93A-P@?| !l`Rp13 WT  T   WP  P %0SX00S 3/050X3A-@`PP p 3kᔲF3p@-0@pP2勲@73Tp0/G-Ppl@2U 1P0Dm0SG30S0 0SڤP夠UZPP )303/`2 V#V   P & 00C0V $0`0@bp@-@PPpp@ p@-@P200P 00$00lp@2O-M00pQ  (@`TA  0 v09 0o02㳼l 0U0Ѝ0 @00D0 0X 0S<0B@<>BA-0MP00p 004!l0  00 +)t@T`p00c)Ѝ0S0S#`G ( y 8ث000 y*,  y (Ӯ`P 00 0@G-@`QP||0ShcQ0qW P UP  0 @D!ek>BG-p@`PP@T:H:QqW 0P-Q@@D!ep@-HP@BA-AQP PҖP ֙PP O P`P帀PpU:APQ  R 00 0 S )0 0\ D!e c>B>BVB>BxVBP!eT!e41L0S/0@-@ QM dP g P7 ~ P0 P PЍ0 < P R jPU 03/P   P ,P cD!e&?BN?B}?BP!e?B?BO-M00P`p'd`V5 `d`@`h0 0(T( {60008000<0@@$0 00(,<08 z@ ~'Vd00Cd0  \'Ѝ  0@O-@M` 8<POĀİ0S PЍ0qW"  峮 ᷨP 0RQa Q P T@ ᜮ 噮  YPD!e?Bp@-@LP`@<0$4SS p$P 0p謝@؝@ 0`( "4`#/O-M 6~90000 0 BPP}00 $"44 8##<00$"448#x#<00p48 40 80 < 00`$ "440#4 0 0$"44 0#4 0 048 4 0 8 00 $"448S#(=0#<0P 00 P$0 R(3[ W0G"35(0* 0!0CR 0C3 S 0 V pl0P0@00S, C{ЍA 0 P  W Ġ Ƞ UU0 Ā0,   Ā,   0 0000$0PP0 #"44!0%"  PPTTXX\\``d dh hllppt1tQ0 tP tPIPx1 QP!"44!1"44!1"441 $1$Q 0RP (}0 v v  8  v(PP0 l8 000 0p5P 0 04P-RE*@BMPb@Br@B@ B|@B@BO-PpPwuM| P0p`#00 0?@P\0 LҮP R R @:wX8┎&  K,T Q b@3PX0 X0 W 4,L H@|. zG̯r|`P p A10 a<40 ! y@P∣  ,yuߍ 0v0P 0p☲s7 _P X )& 0& X܍  ⟧0 0CP060㓺*, .u *u(0, 0 0S 1!3S$ 8‰?p.0S 7 Q #?0000.[ A00 Z04 Xt P &XP0 t Xt P"X0   Q#?0000Q 00Ps 000X00 0T{j@KR8.ra,@@B AB(ABeABABAB8@`kAABBB|@BTp@- D@@PP `$PUPT$p7cA-@Pf/p<(00$ R< =: , @ #:0 40, 00`800 s00 s0 H0<0 00080X``00``m0 Ღ(0 0<0`0,0$0@000(040,0Aq04 ,0007cp@-l` dM!0 t@H0P*0;f,Pch  0@rtpbcZ>c0 6P//0 R@#00 S /Re0H0//p}@0( #&00 S /!E/00S2/კO-M`0 00000P@P 0 @@@@p Pᰀ尐@T ,eZ Ѝ T1# ᝦ@PW01 jcP0 dOP @p!e@b4!  Q / l: BBp!e$0 0!0 00 /@bxddd0S  0 00/p@-@l0PP341d00s 0/(0, 6Q 0/(0, "R0@@ p@b@-@Y 0 0R 00(0,000@ p@-P`"@P @ `T`? 0S $0CS@ R(08 8@@m p"ep@-PU @`00P`H0 P&Z pp訠@p@-@PP Pp@J p@-@P` @T $@DTP0S8 0 (@Q 0S R0@0S 8 @P Up"ep@-40@SP 4B\0,0S S 00 008@Tp`0 6/@"ep@-@P` Z 0P6 #::0t $00000@0`0mp: 0p輠@A-Pp@v3A`41d00 m0S60S50S 0S E`LPG Q 50S0 xv050@b"e;@-@CBD0S 0 H0 PЍ@>@-@,50S0500S @_@-M pPPA900@<0(0@P`41d00YqxPPPPPPPPPhPhB 00 0`S 0 ( ` 0@PЍ"eBB@-\M0000Q 0S 3/\Ѝ G-`1@p341d00p 0RPZ50Sx0550B R  00 0S#P> 0 0 0  VP{0 0000( H/o6"Q R  R   0 0 =pPP #P 0SPU  P P @bO-1DM00P`p0 <0 a0,(P$  @(P0$ 0 Vj<0400 ,00 0000a0(P 0$ @j<0400 ,0X0 0P000a0(P 0$ *jDЍBB0 c<;BBh;/Bl;BBO-QdM@0 | `dЍdЍOiQ0 00000p0 `P`W0_YPU@A @TP HY 01H0#0@DT0P Z 3 #X R+   6 4 8 < $ ( ( <0 , 8 0 D@ } RH  H m X  0AP  p J@ HrT P @D`"eO-造Mx@P`p ᾟ0`  0l ,1 0(10$10 1H@00Xe 1?o2P0SЍ"el;C-M 0P`` @0xp 00P 00 0 0@Xe?o2P0S  BP Ѝ0 c@-(@,000S S 0 1AP 0S Ѝ@qWЍp@-@P@T $@DT\TpPP 0S(@0 ,0 0UP"e(@BB;BBA-0pP@TU,w`T`1 i@DP0BBA-@dp`P0S$0C(@@] R (0S $0CS `PA"eBBp@-@P T-p\P h%@<0@ @$K 堁j p"eBBc4 c"e@-<0CT 0 !0  !@b0@- ! 0 !A-@`XpPU 00`0S 0U0  03/>"ep@-@P0 0 0 0 00 0 00  p@O-\$,M341d00# 21 2PU ' 40 "0#! ",Ѝ00030 #n`.P[ @D Y Y ,;И; ; ; ; ; ;;;;;sYB  83 @p0K\ 00 :9 0P(00S 8T 0@008 3SH L0SP0\0/000"0 |2@p d2@p  L2@p 82@p 2 @ 4 R pp9 7L=n<0C S0! 0&P 00 R u9  9 @ jP! W Y40S ,1  0000pCp(0/P0 *=(/ 80S 40S 0 @pW 0 K?pP220:00l@h 4/W P@p 2/  @bc"e"e"eG-P4,a @T@T $@DTG @@DT 0S 0S0S$$)j08P0(S KpP XT<u080p00<(@"ecO-@$M_,00@T |$Ѝ`(@DT L <0RUSL (0 0 0  H0PP9 VYl000pppG0 0 Y ``0 0V` F/ ;0 PPP# 0Sn,ޖ0 0 0 `0 0 @T @DSP0P P060S500C?o20T0 La0q P3/P20S "eMbA-@p `PBM 2SJ@ @(@0 0@S  =02 100 0 0P`5Bߍ;@-0  Q:0 0(0 0QS Q   Ѝ>;00@-AM@0 0 0 0P00! ! 0@N q;Aߍ0A-P`0@ #R-H L R)QH0 P0H0 00BS B 0000S  (  ( 0Sp p A8 :;-CM       pCߍG-P<p@|`  PPl00P(P$P,P0$008P$S( (0 J~ 0 pGB"ecp@-@,00,0PS04~0,P@8PUp`0 6/Ps@-D0@40P0`~0S  Ѝp@/Ѝp0 c080/0 c@-@P 壺P @ 㛺A-PT@HqT01x`341d0050S{0500S R00000P hP c P ^P 00P 0000{P_ RPBC"e@bO-@4M3p41`d00W50Sx{050PU :W 52CW >0W >C 0CW H4ЍOt80 S񟗂ꌯ;T;T;T;T;;\;T;T;̯;T;T;T;;,80 So꘯;T;T;;T;T;T;į;T;T;T;;7W 0W]}0S 00P7W:>p WMm0S  .Pl7W  ;CW0CW5C 7C0C87W0 H4ЍO6WE 87W >C0CWP覟 W 6WXoY 0 W0`0d(&&0䀔Wpp^|`0fVTX B06W+ #17W 6W000 RU 0 F0 0A0CS…Q|5pW $pGWP5W 000S0ST%0 R01 5:S 000 xP YY  ᘸ c9P ᐸ  P x u00D0Su4 R.PP0400 R0S 0 S P00  0*x  6:PL 0 2(00pW $pGP8s\Z0S R0` S R (`V $`FVP 0 B RP9X0 kPP+0(S'0SP PPP 7P0W S 7000(pY1X*1P$@?P 01 x1 P 0S 0 0(00,0 0000(00,000600008000S080<00S<00@0@00D04p000KWU  P0P40M |H@bwt@HpB@~B f@pBbbzB"ecoB@|B@oB@fB@{B@}f|fvtgBBfBwB0 c@BCB/P/@- ;0`( "4`# Ѝ0M0000# Ѝ/76/Q02 //000SCQ00A\$ 0\ -^0Q  Q0 8<00 00  /0\ LQ @-0 AS/0S 0 /000S000/AP/C-QP P`@A0pSS񟗗x;;;;;ȷ;D;;;;;;L;;;;;;;;̸;;ĵ;;;;;;T;<;;;L;;;;ظ;Է;;8;t;;;;\;$;;;;;;;;;;;;;;;d;0;;;;;;;;;;d; ;;;;;D;;;T;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;$;;;;;;;;;;;;ж;ض;;;0;;;;Pm@P ЍS S S PS S 0STS 80SQ4E< 0@9 0@D6 03   0@, 0@) 0@$& 0C# 04C @d 0 S)* 1 3/y0S01-\M000 0h\ЍG-PP`p@ @Tpp @0F S*10S0S  10@@DTꤺ;;̺;L;;;@`T @T  @.0S0S*30S* V@@PT 0T  T @TT T 0`ST@T´@T T0 0#3S#YA @T 0 S0 0S*@ @T*A @A0 0P@0 C @TU Y S0Y: @ V/@-@P ` pW T0 003/5@ R Q    0P  Ѓ0S@P Ѝ 0R00 0 <"el c"eG-`pP. P@N ㈐ 0SRp0 0G/ 8 00$0  @@@Gi"e"el c/@-$@  00"e2CBt cA-xP`0hp 0@TALH 0R00 0 >8/ճ"el c@- @0 0t@("ep@-:`p@PQR*Q.\  LS0CpQ A`Lф@@-@A-000pP `PpЍ@ T#E00 p 9CBA-0pS@` 0S0SA0d T[0@D0 pPU#A00 p DCBѫA$0 0!0 00 /@bxddd03 ! "/@b03 "  /@b0M0P@Ѝ/0M0P@Ѝ///////0 00  / /H@o/@- @ᘓ< 0O-`MpH @0DSVS00PЍ\ DQ 0A Q@Q ĠĐ0PU0S 4 [PP `0DSWP0S P  00C ^ R0 MCB c"e p@-@3X02@bO?$0PUp(0S 3/XP, c@-2p@-@PPp0S00P00C02@-@(vRp@-Ph@1 01  hp@C-M 0`p` @BP 0Q 00  00P 0@ 0 OoXBP@T P [060sЍG-p 0P`M !` @ P0 X 0 000000@P}X?o2P0SЍ;@-@0(@@-@0@Rt0/ B0QQ//0(P/0S -  0/"e@-<0CT 0 !s0  !@b//0@- !b 0 !p@-P@p@p@-A`50S 6PU 4 R040`0,p@2S 0C8C8_o2RU0rTcbA-P `G<0@TA00S p3/qX@, cp@-@P`03/,`Ds 0S 08 0_00 0S0(Drp@QCBbG-@d@V ,1@P"10U V`@H1U@a@?00S00 000 @pGMSUpp@QfWtD =$opW 80S  3/XppW 80S  3/XpTc, cA-@P(p `*R'7P00 0 0 -Uhb004 0  004  @0D 0 @0D he3 000SP0PP0P0A-P`p4@T  R    B :Tp03/@-K 80 ;_A cd;A-` @0 @0{8 P0p0pg 0t 0pp"0T T@ D0 ЍA"eciCBTcoCB8@d;sCB;{CB c0-DM000,00(0P0 0H0000<0$ <0< wZDЍ;CB@-0  Q ЍgAO-|0 S4|00^@S4p0`|4DM00p,`($  <0?ZP` 0,40S R=0S/ 8¯` p p Iq0@a 0(03 0p0`00p,`$  <0ZP Lx0D#DDcSS<3x0 0000@000S ~_S#S1!~_O@rPDЍO 0!<0$   ,p(`YP 0!2$ 0<0  ,p(`YP{0 00!42< $ 0,p(`80YPf0 00!1< 0'>$ 0,p(`80YPP0 00!10 ,p(`$ 80< }YP@ <0< $  00,p(`kYPg1000<0 ,p(`$  YY0PU     '. ,p(`$0 @ 0< EYPD @P1S ~?S?11~oS1O@.raP;;[DBCB, c;CB;c"e;"eCBNjACBCBCB;CBO-3DM@ l` P@ F  l妵 |D1n00,($  p<0XP@ DЍ 0!<0$   ,(@XP 0!0$ 0<0  ,(XP 0!P00H00,($ P 80< XP ; ;[DBCBCB;CB@-@PE = @ /;p@-P@W`´ Q    ɴ-.p@X   R@ @@  帴F0 <0x 8RR00R0S 0S/ 2F;;A-3P` |p,@ `CE0UPP B;;p@-@P`p0p@/A-M`~Px@ppTЍAz 4P ~x@"eTc@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@;;;;;;;X;T;l 0@o/;A-P`poD@7PUAD600S7/X@P@-@4u 00( R @@0000@ "e c@-@0b 0$S   00C0@ "e@-`pP@MM PVP@ ЍT@UP\0pWU  Y0S   .@PpPE`?@"e c0L TcO-0M05p  1PP, 0X`@"040 100  1 c$0(0`0`Ѝ\;0☇@-@#p0❇Pp@,/0A- 0 `   H0D0R@UDp DPU ?D02SH H0 or0AjPH0S D0SH0D0H0SH H0 oHp0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S NPP000 Ѝ0p@-@`P5 0 501Up0p@0 L Tc0S/ L TcA-M@`PCp0P00H DPP@&CЍA .PD@-3M@03X\pD`PP P$ 0S00P00C0+@%`D,0S 3/XPUЍ X80P, cG-VM@V/ -pX }? 0@c1 '   3"0 2Q  ! R!G 0S Q 050  l, lq 8O䁄刀 2S B  E0 2VRU DPEU RU& DU# 0ZHP j#0 RS 2 R H0 3/0,PH0 P.&U$1PU"  82P Q 01 <Vߍ40S 01Q 403/0SXP0S    H03/,Tcc c"eCB ;, c0L TcA-~`vPpU@' l0S~sPDfP@ 0 R Dcy#P 3 P 0S l#P"e;p@-@`uP@P ApA-~`1PpU@ l0S~.P3 DP@ 0 0R DQ .#P"e;p@-@`7P@P SpG-pW0S !S* 1S l Q`~`PȐUl0 S DP@~P 0SP 0 S:V` d.P` ,  D c;"ep@-@`P@P p@-@P[P@p@-@`P@P pA-`~P|w tpR@l0S~p DcP@ 00S Da"e;A-P`$V  l0Q R@DEP@@ 0S0S Y"P Q R"P  0S*p0   D";A-@p`GP@P bP/@-(0pMPL0`  @P $(0, SS  3/Ѝ\;Q/p@-P@50}/ P P* 0SC\T) S*G!A0HS$HA@0@S@  S| x!R01`0S8P P p@6030#DBz5A&DB+DBTcA-`pP40@TA80S 3/X@, cA-pP@HW`40 p0H0(0DdP@A|!P D^ 0 0R DTPL0S 5$D>"e@-@@@-@@|0/0/0/0S/  ;Tc0 R0/ c@-Pl 0R;A-0` `00R@S 0`8`0}? >aMCaaxq 8/a abbX*T! 0$ $18!0 K < 0R200 `p00S0p SV `p02P0Q:0"PSp`W !ᬈ`"0 AЍA0 cTcc"eJDBRDB@-@k@A-0P @ 0B \U R ~`lZ@dpT  S0@A9l0S ֆP ~I@"e;p@-@`mP#@P 0 8pTc@-Q@M#`@Pp`P@ Q@ 0T0 R0% 0<tJ@ЍA-0P` @ 0B \U R !~p@|T l0S oPT0 / S0@A~@"e;TcO-p0M#08PQt 6^0Q@ dhNP  03/@WNT(h?P   03/@GNTrG/P  03/90S00  P⠇ `00PPxGP  0# 3/0DgS<'SRW (]0 00000 0儷Y@ (&T X `V@` P&h~@p0Pp !X@@0``C`Ѝ(6  <"p P*S_0SCD P `ΆX` Vڐ P(@P0`F-D@ P I#h5 @ < ~X` ` 5Vڐ P'@P`F@D?@4<  ?@?@%>1>N$SP St$#8q (`PI@P0S$@P4 <P <q@*H0$3/@@P 0S-@ <PP@ 3|`|0 <N03/@P |`@ d@=0<#S 80#S %'B BS #S #S#W6 0 0 0` 0s@P* (r"S  S "S "S's |"Sx"p"S l$'a S `M BS[ BS30f P@0S-@ P[ p @0  4/@ NT0 0 (@04/@#00#  BpjR#0T00S @qnP/  03/@w0S    ݅R{ S#B%B}e Sb O!"'S s[ SX *.l=@=@&iRcQcSc@Kczixi"eTcxi "e;iiiii{iFi@ui niii@ScKcIii7iiiG-Pp~`s@|T l0 S 50S0 0ӋP80 d~\@"e;Tc0  RTc0 TcA-p`@%PP 00S0P U !@P !P  CfDBDB0 cD;\; Ll;p@-P@^40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@-4@Q`M P@1h0Q o0CQ 0Q 3QO PЍ3Q 3Q31 1}0Q0 0000 0PP0@S?P SRp @? p$`P @P3Q 0CQ 0Q2 0CQ00N2Q 0Q X0880R 30PH0@0~< !N D!0/H0L 0/QP@0D  4P#P @4qP 0?S@ Ѝ@%SPP iui vi iiiG-| Q`PpM `1Q-@WUHH#0 00 0`0p@P ލ@4T @P  0R DPp1@ 0Q D@P V14 (0V-@ 41i ih@DBC-qM@`P1  03/PNU+ 0S(  ⇃ Pp@0S    S0S  l hЍ;PpPScx0/p@-`Q@P R 0 0 0 t"7P 000SPPPP000pn*R 7PZ"0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RAA@o//1S /p@-3tP@ !P0#3 R`M3  ᅂR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PP#p0@-@0M0S0婻@P  NЍ0ϖoDBp@-Ph@@1 01  hp@I@-p0$M03PA0AS ` R R Rd ⚹/@ PR R _@ Z000 S""4400 #RH L RQH0 P0H0 00B S0 B 00 0S  (  ( 0   &T  000 @P. Q* @'0,001   00^000 000000 0 00000 00 6@P #T@$Ѝ3  K$0P0H@~`L001 "448#8S 0 < 0"448#80CS=0 0 001   300000000000t0000 00@P @10 @   N2@7@ EB@-3A0@S AS S +<2@S 3/4P@O-Q,M0 `# 21  2@P0 40S  00 " ! ",Ѝ0S2200 HpHi2X H >X0RUH0X 0 0% 00   P000 P0\AC0PP@bp@-P`@Tp 3P -P @A-0PXMP- 00 0XЍA/`@p À1#`101"4410 0CH00UL 800(080@`, 0 0 0 03/XЍ"e\00@-:PL@0 R 00 C0.APAAꫪф@ "e00@-40060000 @$0Ml00p0 200%00 %Q 0 00#010PR,R02Il0HLR0`00 P(05/D 0 ᫷ DЍ0耖<<<|@"e"EBp@-@0|0DDx0003/H^RUHH9QC<aA^ A7AA00 \0S?p@-@0TP T% T/@  p@T v  @ ^ @          R R  R @T \T P3     @      Aġ@ʡ@С@9EB@-`PH@Hj  `P%0, 0) " 3P 00 0  0 024`S 0 0B0@202H|T Ѝp`@-@HP-  _`P "@P 00CS 004`S  0 2H0C2OЍp`HF</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Sp4Pp3" p@N1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S603P pHPpp@BPpL2!4<01p0 " $"S $2p@ p@F8"Rp0S 0 0 8偄Pvpi1iii2i(#iX8i(i֡@ 2 @-$2@0$20 P$20$2/(2S /@-$2@ 0$2 P$20$2G-@p`(ᰀH(20(2p02`0H02T(Z p@2S,PYpPAU u H(20C(2,2S0S,2?02H.W & p 3/PP  0S0S0 0"p@-@Hj,2&jPU R,U 0S,2?02(20C(2HU @2S 3/(2Sa~p 0S0S0 0"PpA-@p0P` #RH L RQH0 P0H0 00BS 0 B 00T 7@@ a@0(00(00S  {0'  $ ! "$& $ "$ (?Q00@ a!060V@Pܡ@@-0S 0 P @P Ѝ0 $"$# &  $ "$  $"$# & A{0C-M 03P 0 S P0\t`0#DD0HcS$H0 0004T 0@D C5 0 T 0ß ( T0 0 S0:0 3  00łP  h忂0P<<00  W 0:00h( (0, ɏ 0(0,h0#:0# T00S FP `0#DDH$H#  3  0 0P0 0  P~0S{ `0#DDH$H  3:#:S@1T Tj & 1T (0Sh0 00C S`0 V   0:0p1T?T  zP  {1T1  T 1T1@  ,p(0T00S 0@0000@000 0 R  S  P44Ѝ "eGd|@ 5Hc݆b?c?c1O-0Q@00`pDM(00 0<0a0,$@ @@ @<@D000< 0a0 ,($@ @ @D 0$0\00T0000'>a0,0( P @< DDЍ@"e@EB` <ܝAXS࠳ࠣ_\p^ 0$0X \0@T0@ RC!PX@_<0@(00@((+@Py#ecbE  0 400 ,p$@ ` @6T00L00 ,p($@ ` @400 5<ЍFBXU"0000( $ #0 0A-@P`p- 00  Q:00 ^ Q0SA P L `0S: 0  000 @ ``A@G-r@`0T@PRz T @(@ЍU Ei Di0Y`* sR `FV T`T B-j` 0 ` @  pP@0P @  0 0j h  0 e@Q`P ] U0* PR l  R`FCo0CP 00 0 TPÐʂ$e cGFBĪ@p@-@Q`P 0 h0P @puPTp0SpPO-P0M`Q@0  IpP ` @Ѝp0 0@S 0/ Q V Q P  P PXX7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP0S$0S# RP0S000  P0SP0S 0SQPPUV~ 0 S{ p0 S00R0SpPUmf0S0 0 PZV V 00 0PO P ;PptFBA-P@s`P p @  BoPTN  lP@ 0  R?Q 0S  ? T9 R6 R@ 00PSh T0\`P R00#0 P0 QPP(0P,0P 00 0#00#0@T@۠Q ՠ  BR  \R\Q徠 0 ~Sd!0 S<婠 0S0S0 0 S0Q00 R Q࠳ RSR 兠0Q `U P0P0 RPPQ AQ   0FBGB$eFBFB0A-`pP0S s@PT 0 P 0 @6/P A-`p@0S SP@U 0 @ 0 P6/P <00S/p@-P@ 0P@  p$e cA-@`pp g( `0PX 0 0`0d0(0 0 0P0000 0$ei 0S 324 (`0V0R0S (0yS. x0x$Px 0B~S$(x00Q:xx0xp`V Ѝ@T xx`P T@@D@@P*/-/-/ 0!< 04 0 (   !/@bxddd0" O-H_M1 0$0(0!# 21 2P7@r_ߍ0`S0`P 0<<ܒ(PwUp@PPpPXP $P W 0@700SU x 0bxWPPp7@PP0 P0Sp+@Pp34 41d0L04Y x0 L@LQppRpWT0 @|P 0\L 0PR AoXQ Qa0R0t0P0S 0$ST0S 0$S0 ( 00P0QPkX0S P0X@P -Y KXX00CSꐭ 000E(P00  U  ETp帰1GS  0! R``B``0Q  F 0Pp W(0S0P0 Ѝ@@HB @A-P@`pM4 RT  NT2 0!0 qЍA-@PP`@pD0W 帋H0L P0 H0L A0 `0<0SP@0P8P0IBKIBXIBeIBpIBwIBnA</BIBIBIBA)ec!>00000 0/p@-@0@P6M00 600P :`b_$1Ѝp@p@-x P 0MS`  0S0 0 0 @T  @  0P 0Ѝp d-l 0/O-M`p8CPPM 405S0( @ VN40 S;000050< 0NZ0<0 v  N N N000\@04t0 0 00  00  9t 0 Ѝ)e@-`0  ܁00P 0 S S R 000h  屁0S4pPp  @$04/p̀@W  ⲁ0W V h⩁`  p 0ZV  h☁  ⲁ`ȀЍ)ecp@-P`PUpq@@8> @ DXx0LP0pccLBLBp@-@0@TpP P݇` ׇpc)eO-$P2M@0p@ 0D!>540@P圲H0 0X0UT @Dd0P0< d`P)P00`Vk 0S 0 X/ Rh  ,U @$04/(Z@?  , 00` 0 X S R 000h,  0SDT * @$04/@Y  ,0Y U hـP , 0ZU  hȀ ,PU 0t`h@S Y  $09/ ⬀Ѝ 妀 N)ecO-$M pp@P0 ``P 0倐hS [  $0;/@ |$Ѝ u @ ᤪ@cO- qcVQʀ !  , !p0\c@p C00  0唀0 0$ h R &@ !1c000  ! Ѝ@bxdddcG-P`pU U7 $1pc@ c0UP d0' U+  C C$0h(P 0(0$0 000 0< ӄT`00`040<0  000  0)ec0SlO-0pS4McPP`P@" P |10SW T 0 0S0U0S `` 0 oP $1h Q~000`V* 0S# 0 S S R0h  b 0S  0R ~ 0 $0;/|~L0  b00` ~ i4Ѝ/@cA-d0Pq@M0H 0S S6d1pX1p(@<  U`J< B00< <0@PᇅPĀ ~ჅhI%bp"b@Ѝ`0< 0C`00(<0S `U0P@S  0 h@}"c)ep@-HDP@`L@T403L0$u@P Lpcc@bcp@-$@@P0DL0vp@:c0L03@o/c@b0 0 0 /@-@ aO-p 0M !P``  @BP0K 0\ !i0 000000@P?o2P0SЍ=O-,`sWʀ 0! #!0     ! hPȐ@T 00C0 00 0S003/庿 oh 0!< s00 (   !@bxdddeO-dM0!P`@ y *ap1!p0p@0c00@P  { 0  p l 0 x$h 0`pl!H1 0 0,p($  `<0[ P 0 ydЍ 0!<0$   @,(pPC P 0!0$ 0<0  @,(p2 P 0!`0@0X0,(p0$ @ 80< P LB8@ =2@AD=LBA@LB MB`=CBA-Pp`>g@0S 0 0 0 ABgmP 0@p 00S 0 0R000⇋@-nop@-`$P? @P@pMBp@-@P@D0Ppp@-P`@PU`U00*U- = = = = = = = = = = = == = = = = = = = = = = = = =(= =TPp@DT@DTTp%@DT@D@DT @D@DT @D'Tp@-@`P@T`T0-*T*================PEU=============== PEUPppp@-P`@LPU`U0 *U=====`====4==D= ==$=T=h=|=@D TPpT Tp+T@DTTT*T!@DT%TTT@ T@D&@DT,@DT @D@DT#Tp@-@P@TP T0*Pppp@-@P@TPT0*T|=|=|===|=|=|=|=|=h=h=|=|=|=|=|=|=|=00CSPpp 0O-@plPDM(00 0<00,p$@ @@ @`{ 00<0 @,(p$@ @@ @l P0 0H0000,0(p$@@ @`< Z DЍMBRMB MB0B@-@oP 0 /@- n@ |n tpn hdn \ Xn PLn @@{n =-A)e =A8=FA =_A=xA=A=A@-8@nnn nnn@n)eP@- P0@ P@ ` \ XX N@P HvЍ00N@P v| =>MB)e MBXMB)eMBp@-@0P6 P 0T@@@ppMB)eG-P0M`0 0` @p5?0 P 00 0 0 p@?o2P0S 0 S$ 4 Q0Ѝ)ed 0O-DM(0 0P`! 2 ,`0800P$  @r80 <00!1 0<0 (`,P$  ^ 0'!0tqt< (`0 0 ,P$  pH 0!80 (`,P$  p70 00!08 00 (`0 0,P$ "'(` `08! 0 ,P $  p` 0 ,00 ! 0 0P($ DЍMBOB NB=MB0B@- R0R0 <*R9=(=(=(=(==(=(==(= ===(=(=(=(=(=(=(==\ \ 00SڒP \ \P00S0 80Q,00S L\00S)e R0 Rp@-0@P&* R#====$======pP@D T00SpT m.P X0P0 SpSp$00S000S)eB B  B0 / 0 0CS@00Q400S/00S 00Sd)e R0 R0* R0=H===H=H=H=H=H==H==000S/00S//)e$0000S//@)eB  B0 /00CS(00S/00S/)e 0 /)e@- ttPlp@ lhJl `\El T P@l HD;l 886l=A)e8=FA=_A=xA4=AT=A@-0@IlGl ElClAl@>l)eP@- P0@ P@ dd d0 0X _L@P HUtЍ0L@P Ht)e=MBMBNBNNB@-B B0 \ 0< 00S @jP XX0LP0SЍ$00S jP@)eMB>MBA- BM0 &00S Q Q QPሀxX kc`eV @iTIPAiTЍQiU)e 0O-P`p@DM(038 0p0 0P,`$  80<<03 0p0 ,P(`$  '~ 0hhh! 0 < ,P(`$ p 0! 38 00 00,P(`$  2 00!28 0 0,P(`$  0!2 A 08 0,P(`$  00Ÿ08A! 0 ,P (`$ 0 0 0!18 01 0 0,P(`$ | 0 0 0!18 01 0 0,P(`$ h0 0 0!T18 0P1 0 0,P(`$ T 0!1 (0 0 0P,$  ? 0! 0夰 0(0 0 4P,$ * 0 (00HH!  0 A0P,`$  DЍMBOB)e&=NBWPBNB0BNB'=NBNBNB B* 0@-M @)bP  0KP  lP 0S 0S hPЍ0h0P0S/MB>MB)e@- B 0RS l00S Q PQ @hP 440JP0SЍ)eMB>MBPs@-, P0@% P@" OJ@P Er`P ``i i i i$ЍpL@ii i$ibJ@P 8rNBNB*eOB)e|=A=FA$=_A#=AMOB@- 0yJP ЍMBMBC-MP00`0p0 0` @:0 P 00 000 0@:?o2P0S 0 Q R 00 ЍP C-MP00`0p0 0` @:0 P 00 000 0@?o2P0S 0 Q R00 ЍP 0O-@plPDM(00 0<00,p$@ @@ @`00<0 @,(p$@ @@ @P0 0H0000,0(p$@@ @`< DЍMBOBOB0B0P@- S@P0I@P <>q 44 $00?P Z8ZH Z$P Z@ Z@ x'?P Zw8Z0 ZZ* ZPZ" Z"  ?P ZZ8Z ZP & ZP|  ZPvZ Z >Pj Z78Z ZP_ & ZPY Z ZPQ Z Z >PE Z8Z Z >P5 Z8Z ZiZ Zd >P  Z7Z ZP & Z|P  Z >P Z7Z ZZ Z l>P Z7Zv ZvZp ZZj Zj @Q>@P@ꬷ@@̷@ܷ@@@ @@,@<@L@\@l@ P0C /-P, 0C C-Q`@PLM 0 6/|0 p10 0耟萟2pC0DPUQ 0#LЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@  6/  00\H0 00A00A 6/bSBф@AP/Q //  00 0  0 00 0  $0 (00, 00  40 80<0/@ @-7 0 OjcG-@`T@M PpU:0  jPp 0PES @Ѝp@P @cO-0P`@ 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@/3 P//8@-@P//8R0* \ A/Q :@/Q* @-p@-Q@ @@\@ 2\  0`LPUS 0L @PUT\00\`p^0 PC_UQ@0A#3000@010000@00000@ L\Q00@p\SQP0A0Q 0000 0@0  2 /UUUU3333 @-./ 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00. B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S @-b0o @-@oQPO-(p@@@, P`T @-`VPW:/@P WRQp@-@@P@T@ P`Q@-PPPpQPp@-``` P@-@T`PpQPA-`` p@P-W PU`@@@-(0000 0P 0@Ѝ(J=@-(0000 0P 0@Ѝ Q[R: ]^8 R  ^ 3PP0ЍP 00 Rp 0Q  P P P p`0SWp @/o"R0p@- "!A0 @P#.. "P!Q! Q Q "&" p`04`@D8<#<# "TE!1!1("$"[@-@8  /Ѝ@-@P $/@ (H/ 0"@O-@p0$M(`00 00P0$00P2 0@00 /00pc(#"$c$"0 0 0 05e3#<# 0 00# 0 *   "6f1#f;#0W 0Upi.ɠ,  .@P (, Šb,,. p  &  p'c!c!"000` 0` 0 00 0 0 P0P00$ЍPP`tP`P0 @A-pP@, $`Qn ?PU(7  08R(#)8 b. `.`4`0pPDa(!"$a$"  .0Vh c.Ѝ@R )@ bY.8 8 N.0(0G-PR: p@q?p` @g(U': . 0$ 0 @PE 0$ (P`p(4?XG?0%#?R%U  (Qt."P0 P$0m. 0$ Q0 0$  0$ @H< 0$ @ W.  0$ @H< 0$ ?XG T@-@P $A.@ (- 0"@ @@-@P @ (-. P- 0$$@0O-P dM@0000tv$0 08<00 $00(00800<0 00(00,0 000004040H0,00@0 X-y ,0,Ǡ Ɍ +W i+Y P,ɠ,0 nj0 ,P&`00 kd,40. 0p0 0#0  "#.0 "#000#?,1 "0 <3 " 0$#0(#00$(P 000#08 , < .!4 ğ ",pğn  # " Tğ$ 0!0# 08ğc> .!  ğ0 ",lȁ # "< $ 0!0#0c>,. ", lȁ # .,x# 0 ! " `3b.00,!D30 0.0# ,3lȁ00" 0#04  " b- *a) ȁ0 00#05 ( |b- (0\a(  <ȁ (0(5 ( b- ppp' pappp' 0 : #R?0V FA#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@!#@0`( a!"$,a c"/G-P`8 p#T0.@``T%0  \+ Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T*e-M Ѝp@-@ P` !LN6+ !@ApA-PP@#*`IpP @  @P [0@L0X D0XV@PHUPT@yaratcidA-0p34@0P 0PV@PP @ 0*.` 0W@P` @P0HЍ@byaratcid@-MP@@@`@pT:Ѝ Pp0P00 LVBVBc0 ~yara0 ;c0 utcid0 ;cQl/yara00;cQa/tcid00;c / /p@-@|P0PPptcidp@-@pP 0Ppploob@-@`@1@-@Z@E@-@T@Y@-@N@p@-@H@@-@B@@-@<@@-@6@@-@0@@-@*@@-@$@z@-@@@-@@@-@@@-@ @@-@@@-@@@-@@@-@@@-@@p@-@P(0P p P pgntsp@-@`P <0P p_P T OpatadA-pP X0P PM `Ҕ@P  ^ PP@gntsp@-@RP P- pp@-@P+ p@p@-@P p@???p@-@P p@000p@-@P p@p@-@P p@p@-@P p@p@-@P p@"P0/$@`kA@-``@@P^DࠓࠃTPP= P P; P^P2 P P ^*:'P0P0 P0P0P@^00P@ :^0:dd0SP O-4MX0`0\0 0@m PU000000 S SE S< P<0`0S0H00 0XP0 [H" @0@ 0pUpSpWU0 `(0<0 P, 0$p p00Sc  FS    :SK =SI *S  0S  ;0C`30 `0`0S0R3"P# Q @ `p BPE0S>03P04U *00000 H0WPPU<03 @04W   P<P00S0U01 040 S,0p 0`00S 0<S PU>03040` 0RP04Ѝ`P' P$Q BPE @ `ppR> 3P 4U * 000000 H0\W 0WP @PU 04`PU 04`0 P<0 0<0 0`0 0C P0bSH fSP L l: b0 B> >" , `  (RV 3 "R Y @p$ `F PE  R> 3P 4U *000000 H0V0PPU< 3 @ 4W` b 0B0"!0# `0` 0S0V 3 "R$ Y @p$0`F 0PE00S>03P04U *00000 H0VPPU<03 @04W` P<R00S$00 $0 00U 0 05`04`0 0C 00000Sp,0 0` R) R&Y$  @`F PEp  pR> 3P 4U *000000 H0sV0WP @cPU`04 PU`04 P<R  R$  $  U 5` 4FS,0`0p0C 0 0E 0 0S `0S6PU=03`04X` R( R%Y$  @`F PEp  pR> 3P 4U *000000 H0V0WP @PU`04PU`04`00CSY$0 @`F 0PEp00 pS>03P04U *00000 H0UWP @PU=03`04(00,0 H0UP`0PU`@0V Z0 0CV':Y$0 @`F 0PEp00 pS>03P04U *00000 H0UWP @PU#0304,0` 0PU#03`04 p(R=S3`0S* 0CS'Y @p$0`F 0PE00S>03P04U *00000 H0tUW<0 `P @ 0PU=03`04PU=03p`04`0 0CZX ` R) S'Y @p$ `F PE  R> 3P 4U *000000 H06U0WP @%PU`4p PU`40Z00=(00,0 H0UPPU`@0- `<0f ` PFS_0Z000SBSBSB00@-MB0@Ѝ0/p@-@P` Pp-@-@`P P@ Ѝ/p@-@P EPp-@-@`P P@ Ѝ/A-@`Pp P-@-@`P P@ Ѝ/00/ ;c0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 00000 00$00(0 0,0$000(040,08000<040@080D0<0H0@0L0D0P0H0T0L0X0P0\0T0`0X0d0\0h0`0l0d0p0h0t0l0x0p0|0t00x00|00000000000000000000000000000000000000;08 <T`* X40" @0)p" DP" H@"$ L"( P",  "0` `&\ 0#` .d (h p'l P%p @$t ,x !| " `& 0# . ( p' P% @$ ,࠰ !र "ਰ `&ର 0#ర0 .ര (ะ p'༰ P% @$İ ,Ȱ !̰ "а `&ᨿ 0ሰ᧿+0#0 0+ 10儐ᥟ 0#$10兠᤯0* 00)ᬟ p'0墟0 /P% /0?ጠᡯ,! 0 @$ (# 00#`/ቐ?0\0  +0`0#!>\0D0` (H00'c"##=0d 0h #00#"%#;00 (00''800 %00$*5D0$0H8%(00$.)" #2d040h  +00#"#>20 0  #00#960L0 %P00$4;1 00#  "#1,"? 10,0`!0,'#)!7&9mbቝ刐``+40 .ছ᎔̐`%&$.Đ`,`!.&t刐P%x@$\ClP`(pP妚P'ZUQP `( P&P'%Q_QP`+P%|` Y+W,` *`!੬ᆣlca`<(`p'anqሎTp,Xp!z,v ʠ! ,@ ,*ʠ ƌ) D H1 00)0 0,04D0H0 10)010, 04 1 $1D00)$0H00,(0 0 $140 0#,00,00\0d "`04 h 00#80\ 00 `0#<0 0)@00\ "0D ` 00#H0d0 "h0L 00#P0d0h0p0!T00'X00  "0\ 00#`00  "0d 00#h00`0 &l 0 0#p00@ 00#t00 0$x0 0` 0)|00& 00`0 0 0&000.00 00 " 0#00  00 " 0#0 0 00 " 0#0 00 `0 0)000&000!!0#010+00 0  0#010"0 1 1p0!0(010'01`1!0!0&000.00!`!0#010&000$ ! 0# "  ) *1Ss000 000 00$00(00,0 000$040(080,0<000@040D080H0<0L0@0P0D0T0H0X0L0\0P0`0T0d0X0h0\0l0`0p0d0t0h0x0l0|0p00t00x00|0000000000000000000000000000000000000Kߍ@p@-@-(00S0R ЍЍ/d@-@ / ?!BC! @p@-P(E@P 0P0 0p0*ep@007@-@0Ph娖000S@H<ݖT 0P F Ѝ0 +e$+e0*eA-P`0pS <@P ` ptwlT` P宖w<pF@ 墖j;c|= +e$+e0*e@- @ I 0*e@P 0R @-,0QPso//`kA 0SH^p@-P8@ P {P p@2pOPAPA-pL@P `PPj@P `-@- p$0 0P@P Ѝ@Ѝ/`݋PP  $00P V긇A@-@@ Ip@-@P@p X0R0% ⱋPP  0Q p@)p@`kAp@-@P L0R ☋PP (0Q p@pp@`kAP/ 0R /p@P/ ,0R0/0P//p@`kA\ ?o@-L2^0S0  Q 0QU0 /p@`kAP/ 0R/p@p@-@PPp 40R 6PP 0Q.p@`kAP/ 0R0P//p@`kAA-@PЍPo0 RQ R0 ` 0`pP  D0R S0 ( 4O `pP p@`kA)AA-@PЍ |0R0 p 0PԊ`P 08 S0p( O P`P p@`kA)A0P -?o42 ^0S0 S/p@P/ 00R@- 0Po/p@`kAP ?oH 2\0S 0S0QP/p@`kAfP 0R0P/p@`kAf@-$0pSM Y`PV `0P S@P 00 0P S `Ѝ  `P  OPA 0P/-P-P>P/00//p@-P0@Q 7Pp0< 0 Ppp@-P@AQpPpp@-@P` 0S <P P p@> P`pp@-P<@P /P P >P p@ pp@-@P` 0S<P P /P >P p@  P`pA-@l`lplPAQ<Q >Q &Q |P]SBSBSB@-8@lP $tP @ J@TB@-@P@<$TBp@-T@P  OPP0e@p,0 0\A-`Q@Pp pᬂ  0@0S83 /S>PEU0S0(0 H P 0B0S>300>R/R )0EV0 S -P0/S0$0(0S0$00>SP0 >R    0P(PR R H L R0->"   0L0S>300=\00SB0"S0S   0"P  C  >R0\}Pz\w<Pu0Sq !Sq0-Sl0E?o 2-R0SdXPT]0@- PP0<P8 &P @aT@mT!@pT2@;T/Q ^**lT'tP";P<tP;P>pToPsP ;P'SU00gT qTuPoPtP;P"Q@- Mo/@-IM@pP`V P0P P Iߍ 0 P  PP 0P5/0 p3/P0 0 p0 P ` 0 0P0 5/P 00D@G-@,҇PP8 p䀟䐟@@ 0B0S 23 ݇P&@<R` P   P0>SSS P@@hP @@TBTB*TBD@-IM  @00S 3/P0`JP V 6/0  0PIߍ0 03/V@ 6/T $T Tp 00P00S 3/`0@P T 4/003/003/P T 4/ pp@-P^@P PPI@p$0SP 0` P P PP  `P|P$TBAP0/A-PJM uU0`0p 0 `` Q-0 @0  4/@P T p0  vP$ 00 0 0LPU00@0@  _PJߍ0 000 003/ 0/0/@-@@ RC/A 0\R#R! R/P 0 0#/-0 S RS R RP/$0S @-6@{;c8+e=嶐8+e@-@! (M P P  J@]P(ЍHP  m!ABTB:TBp@- @P}U@p8+e@- @ ;  8+e@ 00 S 0\: P03#/S 0\ P0///p@-P0S 5] @P `?<K>@P tTLF PP I4(0?@p @;c=8+e<+eP+e@@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@@ /P/ 0R% 0  0\:R* R0:/-\: P*0  S0 :/@/ //@ @P 0R//@P 0R//@ P P0P 00  S *0/  \ ://@ P P0P 00   S *0/ɓ \ ://@0P \ P  !R0 * /-!0 ^0# %/@0P \ P  !R0 * /-!0 ^0# %/@P/ 00R!  S //@} P H0P 00   S *0/ S ://@ P H0P 00  S *0/S ://@0P 4 P  !\0# %//@0P 4 P  !\0# %//@ P D0P  0 ! /0S/0/@0P -?o42 ^0S0 S/@P/@\   JQ\//@P/D\  Q/S/Q\//@0@-@MP 0S"$ R0-S 00 0S0xSU 0000 ,0P Ѝ0 :TBAo/0 P R   //p@-`P ÃPP@pPH<@P <0 P`000U ƃ@,e@0-e$0S @-/3@娍 ;c0-eD=@- @ 㗍  @,e@G-`p@PUT` 0` 熁PT`PE¥P@-@@p@-P@@ጵvP۵pp@-P8@NP P p@`pOPA0,S<SI=H-e8.e(/e@-@f 4-e0 0C0s@-@P 0U S 0Il'=Ѝp1PP`P 0 0}P 0 0C0iPPP@,eA-p `P@P V  !V @p C-@p M`P  90P0Ѝ0  PP (0Sӂ0  P (0S$PU00  0P 0 LPYP  SP 0 PP @ A|=p@-PP `X0 RV@ⰴ @P@Vp@@p@-PP T0R^@P 8000000P00 0p@@0=$=O-`@|0S˴Ohz\>P@ῴ P pP 00 0EPP p 00C 0 0S.7@Va0 S 00RP zP P ]P P 0  03/P P P@@ Ap@-P@P 0 0 0p@[G-@P 0R@ PP`E@ 冡q1  0q 0` 00V:000@0P 00R@-0P   0/@p@-@P㿳000p@ p@-@P ,0R@P㬳@p@p@-@P L0R@P`ᙳ0S@#*f@p@p@-@Pᆳ@ճpA-@P x0RyPqp0S `ᾳVP 06`P p@p@-@P @0R@ P`M @ᚳp@ P /o00"\ R00\t/@O-@P p2 R0  bPP @MpL`- 0S g07PP :0Q>`P9/  P,U <U U` 6 Ѝ9P` `~ 8P媊,PP V>PيU `[P  PZJ! 0P 0p00000000 @! 0 0Q 0 1 p`@ ;cD=0-e4-eH-e8.e(/e@G- `@VP [V 00p 8P 0 GL0P -?o<2 ^0S00 S/@@-@P) 0R%P`90 xP  0   C!: 00C0000TRl Ѝ@0P/?o( 2\0S/00 S/@0P -?o42 ^0S0 S /@P/ 0R/@0P -?o42 ^0S0 S/@PG-@6 @`TPp P* ᾱ ự0 S @ ᯱ S 000 01 0 01 $0 0P@ @p@-P@P Pk @p0 03/P P P@0S /A-pP`_@P $Q@&0P@ A?@p@-P(s7@P 0P0 0p0e`@P 0RR @-"o//@-@0P 80e 0SpG-P`@PR  pHWW(G( 0"! 0 Pa#<`P%c?P6  P0 ` P* P P$ pGP匀W%1 ``P R0P&RP xP Wa<``= nP =iP这A`@O-`p P@Q A R;" <Q` =Qb H P Y (=P===V U*@V0 W @ " PV0 W @ ! PV U*0@PY+0 <S@D%0@<SS CR=S 1"0S 0CS230Y@ R Y ʈ(0PS@@A-pPPU@ }`PV@  ` PPQp@-@@ P`}@P`p  `P@ PT}PQPp@-@PP@PP @p@-@P D0R@00S  @P000`@P/ 0R /`@P/ 0R/`@\ ?o@-H 2^0S0 RRQ G 0 /`@p@-PP @0R  P@ [}@P / p@`@0P -?o42 ^0S0 S/`@P/@-@@T ?o 2^0STo`@@-$PMU3`P@& 00!P( 0S%    00 R}PP  00 0 xP } 0mPЍ 0R XP @T|Pp@PP pU |@@A/P/?o4 2\0S0SP//@p@-P00S $A, @U @p(;c=1ep@-,@,Pz0 0up1e@ 0Q/TB4TB@-@P 0R@@P/ 0R/@0P -?o42 ^0S0 S/@0S$0S @-0@  #//TB00C0/0 P R   //A-`P -|PP@PP4@P DppQ0 P`000U .| 1e@@-@◮@蔮PG-@" @`TPp P* . +0 SS 000 0! 0 0!@$0   @ca@p@-P@@PRps@-P@ T R {`5ЍpADAP`@ 0 0#P 00C0@@@ 1eA-p `P{@P V  !eV @p {@-@p`P 9P00 Ѝ0H  ?P (0S @0 @P A4=p@-PP T0RO{@P 8000000P00 0p@@T=H=A-P`@m0SἭAk/PPᰭ P pP 00 0 PP c 00C 0 0SL*P0 03/PPO P PA0 /p@-P0@Q S0 Q000p<Ppp@-P@P 0 0 0p@RA-@P x0R@ pPP` <@ 0 0`0V:000@@-P000p@-@P ,0R@Pì@p@p@-@P ,0R@P㱬@p@p@-@P L0R@P`ឬ0S@#*@p@p@-@Pዬ@ڬpp@-@P~000p@ˬp@-@Pq@@@pp@-@P @0R@ P`]0S 0@Ap@A-@P P0 R@p`E0@0S@ጬ 0h 0Q000c@@p@-@P <0R@ P`@ip@A-P@U `pP<:005 A 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/ R.0 \ B BѴ Bôr- B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@@t@P B@@P B@@P R@/ R/ R Ѥ ä/-\{F ,DP`pL%T\&dl't |@P`p B RR,DP`pL%T\&dl't |@P`p R/ RAn,D R L@Af,HP`pH%XX&hh'x x@P`p B RR,HP`pH%XX&hh'x x@P`p R/ RA:,H R H@A2,LP`pD%\T&ld'| t@P`p B RR,LP`pD%\T&ld'| t@P`p R/ RA,L R D@A /R Ѥ ä// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/A-@pP`P vlPp` P102 P @-@\& P QRS  T00hlLQ R S "  T Ž 00 A-PQ@p`S V @P@V!R)SP V @0C @h@OoV0@d05D?ooL\0ࠑlRV@@@PS=0B V00 W gpo0g0CpG5S?ooL| !0, Sࠑ+@ c0 5̠@  P\O_ 0SPV@ /o?o BR0  c45#̀Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/@-0TBC-`%4M 22 2`uc'('a봻<*GuQ2* ѾP%=rbnrq,e@{~c3뎑벂c_lea"t]-mwn5X4?< )@4Q% 040S#* :4$Q% 54$Q% 5Q0*s1FouUw뫁K>e/떧\qx|Xq&0  "08Sh .oseAݺR|' @3c @00@0КV {PW3PjA P?N@ce~jeh]"~0" T 000[@PpQlsX$tq:n,Ps8B88R4_Pi -0 000rs0s"( A(0( ?A3c01PUs@Ts@hV|1 #* l1 @`10dT1` P Hh/00 s000Y 0s8Q s000AD 0`Prs00)xsN^db0唀K H`s|0@bc@bbpbdlb N'dAWccl}2A]c$dAH;c@c8@SAd1AA9AceMb@]c@0A @0H@P`@p @p@@zssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846C(.}Tb̂bG G G G G G H $H  ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_=>?> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    ʚ;tn QBi j l xl l 4m <6 n p4lsllsrasrror @ @@`kA@`kA$@`kA@*@.@P1@.@`5@`kA_M9@=@P C@G@K@ZA@ O@T@P W@T@\@a@ e@a@i@a@ n@a@r@w@z@w@~@@@@@@@@pP@@@@p@@pP@@ A(A A(Ap @@p 0@@p `@@p p@@P >A@P @@P @@@P P@@- kA/@@/@ @@@@@@@@ AA @A@@@@@@0 @?A00 @?A00@?A00@?A@?A$@?A)@?A.@?A4@?A9@?A ?@`kA C@`kA I@`kA M@`kA Q@`kA U@Y@\@{@\@@ `@d@ `@h@/l@A@oo@@0/K@A@p s@@x@}@@@}@@@@@@@5A@5A@5A@5A@@@@@@@@ A@ @@ @(@@ `0@@ A@ @@ @@ @@ #@@ 0@@ P!~A@ p@@ @@ @@ A@ @@A@ @@@ @@ @@ @@ @"@&@,@&@ 0@&@04@&@@8@&@P<@&@`@@&@pD@&@H@&@L@&@P@&@T@&@X@&@\@&@b@f@k@f@ o@f@0s@f@@w@f@PqBf@`{@f@pAf@@f@@f@@f@@f@@f@@f@@f@ @@ @@A@@@ @Z@02PVA9@Y>2VAD@Y>2AVA@Y>3VA@Y>3 VA%@Y>3pA,@Y>3qA3@Y>3qA:@Y>3qAB@Y>3qAJ@Y>3AT@Y>4D [@LY>4D b@ Y>4i j@X>4`Rfr@Y>4 i x@X>4qA@Y>4TrA@Y>4TtA@Y>4TtA@Y>4TA@Y>4T A@Y>4TA@Y>4TPT@Y>4T`A @Y>5TE`A @Y>5TE`A @Y>5TE%V @Y>5TEWV @Y>5TE i@LX>5TE $i@ X>5TE0$i'@ X>5TE ,i@ X>5TE0,i'@ X>5TE .i5@W>5TE0.iC@W>5TEAiQ@ W>5TE!iX@W>5TE !i_@W>5TE)iX@W>5TE )i_@W>5TE-if@LW>5TE -i_@W>5TEAiq@V>5TEAi@V>5TEAi@V>5TEA @Y>5TE A @Y>5TE`A @Y>5TEJ`A @Y>5TEJ`A@Y>6J`A@Y>6J`A@Y>6ZK A@Y>6KPA@Y>7ApA@Y>7AA@Y>7A/A(@Y>7A?A5@Y>7AAB@Y>7A/AO@Y>7A?A\@Y>7AOAi@Y>7AAv@Y>7A/A@Y>7A?A@Y>7AOA@Y>7AA@Y>7A@A@Y>8A0A@Y>8ApA@Y>8ApA@Y>8AA@Y>8AXV@Y>`A@Y>XV@Y>?A@Y>@XV@Y> A@Y>@X/V@Y>v1B)@%@.@5@D@@@M@I@V@R@_@[@l@h@q@z@@@@@@@@@@@@@@@@@@@@'@.@4@:@@@F@L@R@X@^@d@k@r@y@@@@@@@@F@L@R@X@^@d@k@r@y@@@@.@4@@@@@@R@X@^@d@k@r@y@@@@@@@@@L@R@X@^@d@k@r@y@@@@.@4@:@@@F@L@R@X@^@d@k@r@y@@@@@4@:@@@F@L@R@X@^@d@k@r@y@@@@@@@@F@L@R@X@^@d@k@r@y@@@@@4@@@@-@>@X@^@d@k@r@y@@@@.@4@:@@@@O@X@a@d@k@r@y@@@@j@q@:@@@F@L@R@x@@@r@y@@@@@@@@F@L@R@X@^@d@k@r@y@@@@@@@@@@@@@@@@@@@@.@4@:@@@F@L@R@X@^@d@k@r@y@@@D @ @D A A &ACA YAvA AA AA AA %AEAdata_abort_handlerbadaddr_read@````` ```pmap_map_chunkb  1 AH AR A_ Az A A A A A A A A A A AES-6600 q  !Ќ!!!T!!!\!Ԃ!xAA`kA@AA`kAAA`kAAA`kAAA`kAAA`kAA AAA%A`kA6A?A`kAPAYAjAoAxAAAA`kAAAAAA`kAAA`kAAA`kAAA`kAAA`kA$A-A>ACALA]AbAkA]A|AA`kA|AA`kA|AA`kA|AA`kA|AA`kA|AA`kAAAAAAAAAAA'A8AA'A=ABAKA`kA\AeAvA{AAAAA`kAAA`kAAA`kAAA`kAAA`kAAA AAA&A@A+A`kAaA4A`kAEANA_A!cAjA{A6AA`kAAA`kA\AA`kAAA`kA\AA`kA\AA`kA\AA`kA\AA`kA`kAA`kAA`kA`kAAA`kAAA`kAAA`kAA A`kAA1A`kAABA`kAASA`kAA\A`kAAmA`kAA~A`kAAA`kA@cAA`kAAA`kAAAAAA`kAAA`kAAA`kAAA`kAA&A`kAA7AFA KATA`kAeAnA`kAeAA`kAeAA`kAeAA`kAeAA`kAeAA`kAeAA`kAeAA`kAeAA`kAeAA`kAeAA`kA@eA A`kAeA)A`kA@eA:A`kABADAUAAZA`kA_AhA`kA_AnA`kAeAA`kAeAA`kAAA`kAAAAAA`kAAAAEAA`kAAA`kAAA`kA|A A`kA|A1ABA|AGAXA|A[AXAlAuA`kAAA`kAAAAAA`kAAA`kAAA`kAAA`kAAA AAA AA%A6AA;A`kALAUAfAkAtAAkAA`kAkAAAkAAAAA`kAAA`kAA`kA`kAAA`kA|AA`kA )A2A`kA!ț!p4p4(}>5|>{>=4~>(}>=|>{>VL{>@z>Vy>x>1GA6GAdx>Xw>QGAHIA@v>u>P|u>pt>UGA_At>r>r>q>%  8  @!!@! ! #/ ''w0 g'' c0c ?HAHIA@HTFHARHAz[HAhHAzHAHA HAHA ?HAHAHAHAHAHAHAHA@HAHA@HAHAHAHAHIALA1GA6GAl IAHIAIAH3IAHIA@a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~v1B=OAAOAEOAAIOAMOAp#####p4T#4#<6 #p4usb_desc_iter_peekRARARARARARARARA SASASA(SA1SA:SABSAQSAYSAdSAlSAAusbd_fill_iface_data@@d@d@d@q @c@c@2@3@ @ @?@ "@D@Q2@e@eaQ@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@o7@O@R@T@a@c@q@}@@(@v@&@A@N@j@o7@gO@%@+@4@>@0@`1l703% țbU țbU țb9 : %mw%  2 @@ʚ;$MTA   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u    :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F    u ;u )%u&5Fu 3 4u&6F  0 1  2 5I$|I$$R$Q$P$TO$N$xJ$4J$<6H$p4<63cPPP @_$H_$V$V$DV$5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;< =>?@ABCDEOMPJQNRK _\Ai\Am\AAI\AO\AS\AW\Aw$w$x$p$p$r$ $}$ |$  % L |$Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ fc !!\!|!F  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |h$$$$$h$$X$$ʚ;$q]AMTA$t$2VZP~" `"'`{%1ʚ;$$^AMTA# # $$@$\$p$($ʚ;L$]^AMTA@ h'W W@ @EEE }WQ  k"BFFeeeZZ Z 04$$\$$dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^dʚ;$^_AMTA P@9WPurl_uno_mii_read_reg$$8$$$ $$L$url_uno_mii_write_regʚ;h$_AMTA B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn P$$$̲$,$$h$$$ʚ; $_`AMTA$u$u$x$x$Pxmue_csr_readmue_uno_tx_preparemue_uno_rx_loopmue_csr_writemue_read_otp_rawmue_eeprom_getbyte$($|$$$p$h$$$mue_chip_initmue_uno_mii_read_regmue_uno_mii_write_regmue_dataport_writeʚ;H$aAMTAF hF $$$$$$$$ $ʚ;$aAMTA$$$`$$$0$$$$`$$\$$d$$$`$$D$\$47<6PT3$ʚ;$w5AbAsysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intrgAgAgAgAhA7hA`hAhAhAhA hA hA iA iA iA"iA"iA"iAEiAEiAEiAjiAjiA!iA"iATHIS is A memory TEST pattern !)P%%o%4p%~%Do%o%p%<607p4 ##$%%%<%%%%@ %%@,%%   @ @ @  0        @*  ) 2%%%%%%%%t%%&L%X&%4%%%\%&<%x%8%@%%&|%%4%%%` &&,%&8%P%@%%%&%%%     %&%%%%(%<%%ʚ;,&pA???,&N????n@ 6????Jڧo?? ??a ?? ??Q?}-?? ??@ZC˔??I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 $?? ?D? ??  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./ʚ;f&uAexpand 32-byte kuATg&s&p&,x&g&&w&@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&l?$?]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Ql??]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH,?$?DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH,?$?DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@,??DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decapA&x&&&&\&&0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsizeAP&D&&p&X&&&ieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_updateAAAA!AA!Aieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupAb( ((H(bCP`(W(W(p@d[(b)W(W(4@d)b(W(W(,@4)0F)xE)b(W(W(p@bC}2<>}3;:~4{5#|\6,'7..8d qQ@1!|2"@ 3##6&$7/%8(&9)'0=-'?\.'(/ 0+*~1}]2}]3~4{[5|6,;7.:8-_d<> 4^eEmMqQ@1!2" 3#!4$"5%#6&$7/{%8([&9)]'0=}-\.-_'(/ 0'?~1+*`2+*`3^ 456,;7.:8d<>| /1,;`2,;`3' IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| #6/'`4~^cCeEmMqQ//rRwW??1!2@ 3#!4$"5%#6.=+(/`0[{1]}2]}3 4~^5'"8;:d\|/? bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\5$#"12< 3>!(4[")5]#@6^$+7%-8&/9'*0-=.%`bB|_pP&oO`!vV  dDlLjJ/zZ0wWaAuUiI eE ,;' cC' tTsSrR3nN4mM2\yY{xX}.:kK~'?qQ 6gG7hH8fF(, _d/^ q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>5^~sSa`zZ~}/ 02'*4^ 5 .'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ 5 12 3l#!4>"5<#6$$7%8"" &9""/'0""*----.' xX.vV_lL[cC]wW^kK!hH<7 gG>8fF=9qQ&+/f-0uU\iI/aA{ eE} oO* sS? nN(4rR)5tT-63dD:,4yY@.#$ |pP~ zZ`bB+:mM%16,-"27..'38jJ;;2 9 d .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>|  9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm ʚ;+p@۷A++p4p4+47<6PT3p4ʚ;+Aʚ;P+Aʚ;+ A     !A  !@@@@[A~AAĺAA A -A XA {A A;A.AA*AMApAA4A޼AA5$A6IA mA A A <нA ?A , A -*A MA uA A =A :ܾA A A"@A6dA$AA пA8APA##   1 @/,,@,/,,,@,/,4+,@,/,0),@, 22     * #hhu hhhFA8,4,7,kAA AA=,;,;,A@,4>,@,UAU;AU2VAU3vAU1AD,C, ,AU5AG,E, ,I,$,I, xlA{ AM,$,M,M,J,M,AAAA-A R,O,Q,}yA}A}AU,?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!AAAAAAAAAAAAAAAAAAAApAtAxA|AHALAPATAXA\A`AdAhAlAwsevent_copyout_events`,|,,8,,p4,4,<6,,p4ABCDEFGHIJKLMNOPQRSTUVWXYZt,,,p4D,44,<6,p4rasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?0b&`b&Ȱb&@E@8E@o@G@G@                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~H@I@aI@)I@2J@OJ@PJ@ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~PXF-XI-TFF-F-PNE-RRD-CEHE-ST E-NM(H-K-CLtF-0PLtF-0RED-@RRD-CEHE-ST E-SLHL-RRD-CEHE-ST E-ERTN-CEHE-ST E-;HP@N@HM@ʚ;Z-lAXdPM@0@9@,:؏@:@:8@:@:,@: @:(@:D@:|@:@:@:Б@:@:$@:@@:\@:x@:@:@:̒@:@:@:@:@:@:T@,:p@:H@:d@Xl-@ ;@pi-@,d-Ԑ@:@:`@:@: @?-<@@-X@;t@X;@:ȓ@k-@p;@]9\dN@0@9@,:؏@;@,:8@,:@,:,@; @d:(@;D@;|@L);@);@8;Б@ *;@<:$@,:@@,:\@,:x@,:@,:@,:̒@,:@,:@,:@;@\*;@;@t;T@:p@l:H@;d@Xl-@ ;@pi-@,d-Ԑ@#;@';`@:@@; @?-<@@-X@;t@X;ȓ@k-@p;@]9`dPP@0@9@:؏@D9-@d:@d:,@<:H@<:d@Xl-@ ;@pi-@,d-Ԑ@@e-@d: @d:(@d:`@:D@0;|@:@8;Б@;@<:@:$@d:@@L:\@d:x@d:@d:@L:̒@n-@g-@: @?-<@@-X@;t@X;@7-@j-ȓ@k-@p;@k-@D:@]9T@:p@l:???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ$--;-:-:updatefats,----l-p-<-IJ--D-UtU@ʚ;D-A. .. Ѕd|U@0@9@:؏@-@\-@d:,@<:H@-d@ -@ ;@-@\-Ԑ@-@- @d:(@d:`@:D@0;|@:@,;@8;Б@;@-@:$@-@@d:\@-x@D-@4-@d:̒@-@D:@: @-<@H-X@;t@X;@|-@-ȓ@-@p;@-@-@]9T@:p@l:AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z$H.|G.$H.G.nfs_sillyworker,K.XK.K.: @ i@i@h@h@h@h@h@h@jh@Nh@2h@h@g@g@g@g@g@lg@`g@Vg@Lg@@g@ ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  l@Pk@i@ʚ;.7Bdi@0@9@,:؏@:@:8@:@:,@: @:(@:D@:|@:@:@:Б@:@:$@:@@:\@:x@:@:@:̒@:@:@:@:@:@:T@,:p@:H@.d@.@ ;@0.@.Ԑ@.@.`@:@/ @N.<@\O.X@;t@.@:ȓ@(.@p;@,:dXk@0@9@,:؏@;@,:8@,:@,:,@; @d:(@;D@;|@L);@);@8;Б@ *;@<:$@,:@@,:\@,:x@,:@,:@,:̒@,:@,:@,:@;@\*;@;@t;T@:p@l:H@.d@.@ ;@0.@.Ԑ@.@h.`@:@@; @N.<@\O.X@;t@.ȓ@(.@p;@]9dl@0@9@:؏@.@\/@T\/,@.H@/d@.@ ;@0.@.Ԑ@8.@ - @d:(@d:`@:D@0;|@:@I.@8;Б@;@/@:$@|/@@.\@/x@|/@.@s/̒@`.@p.@: @N.<@\O.X@;t@.@.@<.ȓ@(.@p;@.@.@,:T@ .p@l:ffs_mapsearchffs_nodealloccgffs_freefile_commonffs_blkfree_commonffs_blkallocffs_blkfreeffs_realloccgffs_blkfree_snapffs_freefileffs_freefile_snapffs_isblockffs_isfreeblockffs_clrblockffs_setblock@p@@p@@p@@o@        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?00:0:ffs_newvnodeffs_reload0h0!08/p;00D0 ffs_syncu@s@r@ʚ;^0AA,dr@0@9@,:؏@:@:8@:@:,@: @:(@:D@:|@:@:@:Б@:@:$@:@@:\@:x@:@:@:̒@:@:@:@:@:@:T@,:p@:H@0d@ ;@0@0@ 0Ԑ@80@l0`@:@t0 @0<@80X@;t@X;@0@0ȓ@|0@p;@0@]94@0@,0@|0l@40@`0P@0@d:@d:Ĕ@d:0ds@0@9@,:؏@;@,:8@,:@,:,@; @d:(@;D@;|@L);@);@8;Б@ *;@<:$@,:@@,:\@,:x@,:@,:@,:̒@,:@,:@,:@;@\*;@;@t;T@:p@l:H@0d@ ;@0@0@ 0Ԑ@P0@0`@:@0 @0<@80X@;t@X;ȓ@|0@p;@]94@0@,0@|0l@40@`0P@0@d:@d:Ĕ@d:4du@0@9@:؏@0@08@0@0,@`0H@0d@ ;@0@0@ 0Ԑ@Ћ0@0 @d:(@d:D@0;`@:|@:@,;@8;Б@;@t0@:$@0@@D0\@t0x@0@,0@0̒@0@ 0@: @0<@80X@;t@X;@0@0ȓ@|0@p;@0@0@]9T@:p@l:4@0@,0@|0l@40@`0P@0@d:@d:Ĕ@d:w@ʚ;80MBBA@dw@0@9@:؏@,:@,:@,:,@0H@0d@,:@,:@,:@,:Ԑ@,:@,: @d:(@d:D@0;|@,:@8;Б@,:@@;@,:$@,:@@,:\@,:x@,:@,:@,:̒@,:@,:@,: @h0<@Ț0X@;t@X;@0@0ȓ@80@p;@,:@,:@]9p@;ufs_inactiveufs_dircompactufs_dirgrow00X0000 0\000ʚ;\0A ...t11T 11uao_put1 D(14'1`'1(1uvm_km_suballoc Y1d1d1uvm_unmap_removevmmapbsyty@y@0{@y@uvm_page_physloaduvm_physseg_unplugswap_offswstrategysw_reg_strategyuvm_swap_initswap_on44\,2,2p447<6PT3p4(2p4t42p4p4p4J2J2I2I2H2ʚ;\S2TAʚ;T2bANetBSDʚ;0d2Aʚ;u2AsAAAMA\AA,@A#7$wx@g`8@Gdeadcvʚ;H2vA4444247<6PT3p42p4p4p4p447<6PT3p4<<< 33\63filt_timertouchYBx4x48L3<3dK3J3M3DH3`B3H3>3N3p<3D>3l<3>34=3N3C3>30A3 K3K3N3P<3N3P<3X<3C3$c3>3exec_initA3BAAAAAassert_sleepablemodule_builtin_addʚ;Amodule_start_unload_threadmutex_vector_enterself~@~@~@~@(@@(@@~@systemdrvctl@]c]c@@ @@ rw_vector_entercrashme_sysctl_forwardercrashme_mutex_recursionselfdebug_crashmecrashme_removeAD 0  pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) P4$44\sysctl_lookuphj5todr_gettimetodr_settimeBB BBVBacl_posix1e_mode_to_permconfig_devdeleteconfig_finalize_mountroot`kA BBbdevsw_attachcdevsw_attachopendiskBBB B(B0B8&B@1BP<B`GBpRB]BhBsB~BB@BBBBBBBB B@B 666P66p464P6<66p4pr_phinpage_checkpr_rmpagepool_initpr_item_linkedlist_getpool_do_putpr_item_bitmap_indexpr_item_bitmap_put0123456789abcdef0123456789ABCDEF|/-\P7L7vmem_rehash_startB7D7R7O7HE7U7O7O7ʚ;HR7&Bhd7c78d7b7_&Btg7 f7Pc73e7d7d7c7tb7k7hk7s7j7l7L7777777707'B33337ܒ7733ʚ;T7W'BselectXpoll(B77737778777H7X7H7"(Bp73 737h7 777@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@7$877ttyoutttyinttybgttyopnttycls)B)B)B)B)B)B)B G8DG8F8p>8(L8M8N80=8P8?8=8=8<607p4HJ8=8,@8\B8P84=8D8<6HF8p4p4p4p4p4p447<6PT3p4_844_8^8^84]8<6]8p4j sockaddr_copyWARNING: mclpool limit reached; increase kern.mbuf.nmbclustersm_prependm_copy_internalm_pulldownm_copypacket4 c@8\8X888О88Ȟ8888@88؞88 8(808888 c<@49 @ c@49 @ c=@49 @8t8`88|88 8`888,B833338p833ʚ;L8,Bp88p8d808808,8Asbcreatecontrol1-B$-B+-B-B4-B<-B -BE-BX%90$9D,9.9'9,9 9!9#94%999< 9( 9"99D894!9(o9(o9T@|@@@@@@6B6B7B 7B7B7B$7Bk;B4B 4B4B4B#4B*4B24B;4BE4BM4BU4B_4Bi4Bp4By4B4B4B4B4B4B4B4B4B4B4B4B4B4B4B5B5B5B5B 5B(5B05B:5B?5BD5B AI5BN5BS5BY5B_5B @` A7BMBBAlA7B7B7B9T99 vcache_reclaimvrelelholdrelelvcache_make_anonvwakeup@d:D::|:|:ą::}:3::;B(@ ;B @;B@ :B@ :B@ :B@ :B@ :B@ :B@ :B@ :Bؗ@ :BЗ@ :Bȗ@:B@|:B@r:B@h:B@_:B@R:B@G:B@>:B@ 4:B@+:Bx@ :Bl@ :B`@  :B L@ :BD@ 9B8@ 9B0@ 9B(@ 9B @ 9B@!9B@"9B@#9B@$9B@%9B@&9B@'z9B@(m9Bؖ@)`9BЖ@*T9BȖ@+G9B@,:9B@--9B@."9B@/9B@0 9B@18B@ 28B@38B@48Bx@58Bp@68Bh@0@@@؏@@@,@H@d@@@@Ԑ@@ @(@D@`@|@@@Б@@@$@@@\@x@@@̒@@@ @<@X@t@@@ȓ@@@@8@T@p@@@Ĕ@@@@4@P@l@H0BT@0 e\@0@<:@]9@:؏@ػ:,@:H@<:Ԑ@:@ : @d:(@d:`@<:D@:|@:$@4:@@4:\@\:@H:@<:@<: @$:<@<:X@L;t@;@D:@:ȓ@ؼ:@p;@<:T@:p@::\: :D:4 e@0@9@:؏@L:@,:@,:,@:H@:d@(;@ ;@(;@(;Ԑ@$:@: @d:(@d:D@:|@,:@:@8;Б@,:@<:@,:$@,:@@,:\@,:x@,:@,:@,:̒@,:@,:@,: @`:<@<:X@;t@X;@h:@,:ȓ@:@p;@:@D:@<:p@;genfs_suspendctl:::::,:genfs_can_access_acl_posix1e@ @@ @ @ʚ; ;;Blayer_bypass@!e@0@9@:؏@;@,:@,:,@;H@;d@(;@(;@(;@(;Ԑ@#;@'; @d:(@;`@:D@;|@L);@);@8;Б@ *;@@;@<:$@,:@@,:\@,:x@,:@,:@,:̒@,:@,:@,: @;<@;X@;t@X;@;@\*;ȓ@;@p;@;@t;@]9T@:p@l:devclsdeviocdevoutdevindevwaitdeviodevopnʚ;6;bADU;J;DZ;;A2IчH B|nQn- q+ BZIчHA|nQn- q+ASFU0eC쬵AIчHSBIчH=B-чH@BB-чH=BSFH0eC@BS'@ )ѸDBB*1@ )ѸLBB1x )ѸQBB3Dh&YBB=rGy=iG}^BB|nQn- q+eBB4v;4Hx;Tw;{;{; |;47<6PT3p4Hx;Tw;4v; |;p4tt;p4~;4;;$~;47~;PT3p4;; ;;Ă;4;<6$;p4;;\;p4p4p4p447<6PT3p4BB;;L;3;;;0;3_bpf_mtap_softint_initʚ;;BB'CBʚ;;'CBifaddrpref_ioctld n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jnd_set_timerqAR<FBR<FBPT<FBTA@RB@g@@@@@د@@Я@W@ȯ@@@=@@;BA@d@@@@dLA@@@VA@VA|@WAt@XAl@z\Ad@t]A\@'^AT@`^AL@a_AD@_A<@b`A4@aA,@bA$@8b bbbb\b0bb؜bb|bPbb bbbbpbXb$bЂbbbbbbȃbbXbPb(bbbbDbb0bbВbbxbbb|bpbbdb bbbb8b`b4bbܨbbbXb,bbԧbb|bPbb b4A4ARBRBIAAA;ACACAPBRBXARBVArPAVAzPAVAQA@RBjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGSB BSBSB@BSBSBAASBSBSBlAxASB@BSB^BBYBB=B@BBSBASBSBSBSBSB=BSBDBBLBBQBBeBB`kA  gnts= == ==0*e SB A =/TB$=4TB$=A=@=:TBP=OPA=t==rbmn==8===P+e(GTBtcid$= =p=<== ===x= yekd=h= =@,e PTB(/eYTB8.e<bTBH-e,jTBatad= ==ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/0erTBloobp=P=x=yara=x==|=`= 1e {TBstrtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALLNetBSD 10.0 (INSTALL) #0: Thu Mar 28 08:33:33 UTC 2024 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL @(#)NetBSD 10.0 (INSTALL) #0: Thu Mar 28 08:33:33 UTC 2024 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL 10.0NetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partitionbad sector table I/O errorbad sector table corrupted: I2C controller unable to attach PXA I2C controller pxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoopunable to acquire bus. error=%d output write failed. error=%d : GPIO controller ioexp%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDzlcdstdw100lcd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctlcouldn't register event handler zkbd: pseudo power management module zapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-aquiet-q-v-x%s: curaddr %#lx not in range%s: mix PRE and POST%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)scsiverboseperiphprinterprocessorwormcdromscanneropticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storagetapescsipi_dtype: impossible device typescxsplunable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer %02x DEFERRED ERROR, key = 0x%x , requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data =Sense Error Code 0x%x at block no. %d (decimal)request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedsearch returned equalverify miscompareunknown error keyscsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter %s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d), 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueingtagged queueing ATA illegal length indicationATA volume overflowATA command abortedunknown error code %d %s(%s:%d:%d): wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_scsipi_request %s:%d:%d wdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: PIO mode %d rejected, falling back to PIO mode 3 %s:%d:%d: %s error (0x%x) wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out atapiscsibusdetscsinitq: SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed timeout-info target %d lun %d: <%s, %s, %s> %s %s%sLUN %016llx ignored waiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X GENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCORACLEBlockVolumeIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA scsibusscsibus at %s channel %dscsi_subr drive %d: <%s, %s, %s> %s %s: %d targets atapibus at %sALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.02Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25atapibusread_cd_capacity: extra large block size %u found - limiting to 2kByte optical mediacd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct MMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d NEC CD-ROM DRIVE:260cache synchronization failed no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectorsdrive offlineunformatted media%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutchannel resetrequeue, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASrecalsetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x atacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %swd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't create task thread "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setsdmmc_select_card: error %dcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x SD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%dcan't execute SD tuning can't get SD status: %d write-protected Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostNot supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d lcd_free on active screen Stray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacunable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendunknown error codepower management disabledinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedno APM presentreal mode interface already connectedno pending eventsunable to enter requested stateAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-EthernetDYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciausbevtusbrhxfer: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hcusbtask-drunable to create task thread: %s usb_create_event_thread taskusb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s usb at %spre 1.01.13.03.1usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usbdetusb_detach_waitold: didn't detach %s: bad descriptor %s: descriptor length too small %s: descriptor length too large subclassprotovendor-idproduct-idvendor-stringproduct-stringserialnumberusbififusbdevifusbverbose port %d configuration %d interface %dvendor %4.4xproduct %4.4x%x.%02x%s (0x%04x) %s (0x%04x), class %d/%d, rev , addr %dusbdly%s: bad descriptor: too short %s: bad descriptor: too long %s: bad descriptor: iface desc %s: no desc found usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbpipecbusbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDwatchdog timeout open rx/tx pipes failed: %s tx list init failed rx list init failed usb error on intr: %s usb errors on rx: %s rxeof: too large transfer (%u > %u) usb error on tx: %s Ethernet address %s usbnethub not fully initialised, but child deleted?illegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d multiple%s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint uhubexcannot open interrupt pipe port %d power on failed, %s uroothubuhubuhid at %s reportid %duhidev%s, iclass %d/%d could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidev_intr: bad repid %d unexpected normal completion of async xfer under lock: input=%d, output=%d, feature=%d uhidreauhid%s: was console keyboard multiple key code arrayskey codes not on byte boundarykey code size != 8too many Variable keysbad modifier sizeattach failed, %s This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). ukbdusing %s over %s quirk init failed endpoint not found %u/%u/%u %s: Get Max Lun failed: %s unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers command protocol=%#x not supported bus attach failed %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s ATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumassumass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cb%s: reset failed failed to set configuration, err=%s getting interface handle failed couldn't get endpoint descriptor %d missing endpoint %s: EEPROM read timed out if_aueno union descriptor no data interface setting alternate interface failed unexpected endpoint could not find data bulk in could not find data bulk out faking address if_cdcecouldn't get ep %d %s: read MAC address failed if_cue%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s loading firmware failed could not read Ethernet descriptor if_kue%s: %s: bad register %04x failed to get interface, err=%s couldn't get endpoint %d if_urlmedia change failed read PHY failed can't read rxmodefailed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axe%s: reg = %#x: %s %s: packet length %d too long%s: packet length %u too short %s: rx_cmd_a: %#x %s: invalid packet length %d %s: not ready %s: timed out LAN7500LAN7800failed to set configuration: %s failed to get interface handle: %s failed to get ep %hhd failed to find endpoints %s: PHY not ready failed to initialize chip %s id %#x rev %#x mac-addressfailed to read MAC address if_mueif_udavunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors %s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x detect auto increment bug, try again wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC tx buffer allocation failed %s: interface not running timeout in alloc %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration %s: NIC memory corrupt - invalid packet length %d device enable failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %dtimeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifotl16c750ns8250 or ns16450, no fifons16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTDesignWare APB UART, no fifois_consoleforce_consolecan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1timeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardlRoot hubOHCI root hubohci_setintr: 0 interval %s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted ohciabt2ohci_device_isoc_abort: early return WARNING: addr 0x%08lx not found , legacy supportohciabtohcixferOHCI version %llu.%llu%s unsupported OHCI revision SMM does not respond, resetting reset timeout %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedaes: self-test failed: %s AES self-tests failedaes: %s AES is busted%s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredreboot if timer expiresswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handledmgttoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u ibss???? %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country infokey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) bcast/mcastmcast/dstunspec/srcsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d addr 0x%x%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' : I2C bus i2c-no-indirect-configi2c-child-devicescookiecookietypecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %si2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvmspplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: Tried to unplug unknown range ractx%s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfdfilefiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleteextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: built-in module %s can't find builtin dependency `%s'built-in module %s prerequisite %s failed, error %dbuilt-in module %s failed its MODULE_CMD_INIT, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEunload requested for '%s' (%s)module `%s' not foundmodule `%s' busy (%d refs)cannot unload built-in secmodel module `%s'could not unload module `%s' error=%dunloaded module `%s'module `%s' declined to be auto-unloaded error=%d%s: builtin module "%s" init failed: %dmod_unld/stand/%s/%d.%d/modulesbuiltin %s failed: %d moduleautounload_unsafeautotimemodunload%s: %dmodule `%s' pushed by boot loader already existsduplicate bootlist entry for module `%s'unable to load `%s' pushed by boot loader, error %dunable to fetch_info for `%s' pushed by boot loader, error %ddependentuse -f to reinstate builtin module `%s'%s module `%s' already loadedout of memory for `%s'cannot fetch info for `%s', error %dmodule `%s' has invalid class %dmodule `%s' built for `%d', system `%d'forced load, system may be unstableincompatible module class %d for `%s' (wanted %d)dependency name mismatch (`%s' != `%s')module with name `%s' already loadedcircular dependency detected for `%s'required module name `%s' longer than %dself-dependency detected for `%s'recursive load failed for `%s' (`%s' required), error %dunable to affix module `%s', error %dmodule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %drecursive load causes duplicate module `%s'module `%s' loaded successfullyAutoload for `%s' requested by pid %d (%s), status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for %skern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexmutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s Powering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s plimitplpstatsplcurprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lockrwlock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicesigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=%s%lluswap dumps on %sparsediskuse one of: %s[a-%c] none halt reboot md0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_locksetrunnable: lwp %p state was %dWARNING: negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%utstileturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceWARNING: power management not supported config_attach: allocation of device softc failedFound %s (root)%s at %sroot device %s not configured waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_destroynist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generatecpu_topology_init: asymmetric & SMT?? ureadc: non-positive residureadc: non-positive iovcntdevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and partition table is fullno raw partition and disk reports bad geometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpusetkcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %u%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u %s: size %u, align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p pool item size %zu too large, use a custom allocator(null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclocvxchicvcrosscallunicastxcallxcall/%uaio_process: invalid operation code posix_aioaio_listio_maxaio_maxaioworkaiodoneaio_jobs_poolaio_lio_poolefdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s compat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d not a controlling terminal empty foreground process group found only zombie processes no foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatninnoutcanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestednamecachenamecache_statsncpurgecwdidirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkstimestamp_precisionpnbufpllf_findoverlap: defaultlockfnamei_simple_convert_flags: bogus sflags chrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dot%s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system failedunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... VT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADfiledelaydirdelaymetadelayinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvcachevnode cache hash%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvdrainwt%s: holdcnt vp %pvdrainrt%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlinvalid specfs vnode type: %dspec_read typespec_write typespeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged UPDOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lx%s: can't handle af%d %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us rn_delete: couldn't find our annotation radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsusermountuser_set_cpu_affinityhardlink_check_uidhardlink_check_gidorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempviocongpioirqcttyphysconptcqmsofconstunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseulptraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuswskbddevuhidbususbuspcmciabuswsemuldisplaydevapmdevifi2cbusreportiddriveconfigurationproductchannellungpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p radixnodeunusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3%ju%#jx%#jopropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0x%s: getifname%s: getifaddrsaddress:link%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tag?NONEAES-CCMPWEP40TKIPWEP104AES-OCB...SIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA> >>>>?w???@ ?+?2?e?9?B? T?> <\?o?|?????? ?@? @@/@@P@i@<n@@t@{@@@@<@@@@@%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrwuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedforceroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s (%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmallocbnorripbgensbextattbnojolietbnocasetransbrrcaseinsEE3E2LBEBE EB BE*B@BC CCC!C&C-C usage: %s [-o options] special node egjo:r%s on %sdevrdonlysympermrumpgetargsextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a relative path.using "%s" instead.EE3E2LBEBE EB BEE F|@*FFF@Z5'FB@/Fo:specified device does not match mounted devicemount table fullincorrect super block%s on %s: %suserquotagroupquotarwsuidunionhiddenautomountednfs4aclsposix1eaclsreloadatimedevmtimesoftdepextattrbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorEE3E2LBEBE EB BE|@*B@usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath getmntoptsGsl9Uu:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacEE3E2LBEBE EB BEZ5*B@:NNNN N@NNNNNNO @MMMOMMM M@recvrpcrpc_getportrpc_callsendrecvConflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%crsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimerintrnfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s%s: can't read disk label; disk type must be specified%s partition type is not `%s'VWUWWW X7XMXXXXXX.YAYbYYYYY(Z]ZZZZWTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()[SKC;3+#usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /tmp/option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered oldNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptywarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d seekI%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYJbݛ=iÜ 5cMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbatalkchangeexpirehopcountinet6lockrestmonitormtunetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspechw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worlddpswpriority=nfsmntpt=blkOut of memoryempty mountpoint%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytes1M-blocksGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpfetch_ftpjd3 ***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciiWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230505Version: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTmoreMLSD is not supported by the remote server. pageroutput to local-file:Can't execute `%s'Can't fork a subshell; try again laterusernamePASS %sLogin failed. Account: Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". rcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpasshttps_proxyno_proxyrpromptsslnoverifyaccountappendbellbyecdupchmodcrdisconnectepsvepsv4epsv6featuresfgetformgethelpidlelcdlpagelpwdmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodtimemputmsendnewernlistnmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesndbufstructsuniquetenexthrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)ftp_proxyretrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s Writing HTTP requestImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. %s:No control connection for command Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STORproxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandsentlocal: %s %s: not a plain file. APPEReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ?Ambiguous command. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEactiveUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sFTPANONPASShttp_proxyPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. MDTMREST STREAMTVFS Remote system type is %.*s. unixlinux215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): login@USER %sPassword: Login failedACCT %sAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamNetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzj0jjS- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data9D`3Cannot allocate memoryLESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESliCOLUMNScokrklkukdkPkNkh@7kDhcxndadbpcticlcmsomdvbbc|^ crsrNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE/dev/nullHOME.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]& There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~\LESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ %*s Line numbers turned offCalculating line numbers/dev/tty (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadshifttildequoteswindowmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE%lu \abfrtv disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for on[set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowednonebad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dlink downunsupported speed %ldConnect failedescapeparityphonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberhdraecbetbdchfesprdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zero%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busyPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsforceframesizehostphonesraiseraisecharrcrecremotescripttabexpandverbSHELLechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalecholeparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-iGջPX8"_hʑ"ud3ȣ"~d3 """û"ڻ"ɒ"0"d3"'d3"1d3":B̏"O>"V] "gd3p"q"zGː""̤"ȓ"""ϼ׼""0"d3" d3"*"6"Gd3"R`"r0"~d3/"d3."collectf0z`NAME=L޴ƷηԷطp~  ,<>      !"   !"    !"#$%&'()  ]M1L]mݷ L޴ƷηԷطp~  ,<abreg;7 e -Qu-!#qL޴ƷηԷطp~  ,<p=CpG----------------------------------- - --------------------   !"@//tmp/usr/var    "" ""QZaju Details for index GPT part - L>0ηO~ By5iMuQa=Mۇe 51EۛɈ)iM͈L) .9@G !SFH0eC9SFU0eCHah!IdontNeedEFI)(s*K>;|nQn- q++|nQn- q+:D|nQn- q+QZ|nQn- q+kv|nQn- q+<=rGy=iG}.;Mt?mWC 3KOOyD<#*=(3Dh&\ M}--чH-чHZIчH6IчHIIчHT2IчHLoS'@ )Ѹ@|*1@ )Ѹ 1x )ѸGp=\GPGII/;wY}9e Sy-U=1!P WjA /bin/kshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages/sbin/halt -q/bin/sh -i -E/sbin/reboot -q <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noexecnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeNoneOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 10.0 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalFilesystemMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.0 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.0 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.0 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.0 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.0 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.0 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionendblock sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: IN, (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPEmachinezaurusxfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orghttp hostcdn.NetBSD.orgftp dirpub/NetBSD/NetBSD-10.0ftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mountdist postfix.tgzdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %stmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etc/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF /sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*unknown%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/%sCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %sudf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigdkctl%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICkern-C700etccompgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%zu%llu - %llu %s, %sFATNTFS a-%c %c---%c-%c%c: %s %s %s %s %s%s %s %s%s %s %s %s/targetroot/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD10/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sYESs,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c/dev/r%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%*s : %s%*s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%llu%s (%llu)%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %s%s_%lli@%lliStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headerv7sysvv71kv8lfsotherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmfsvmwresvbioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsLinux datalinux-raidLinux RAIDlinux-swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition9 ***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading input%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB"/ -%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limit%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap???refusedunknown qtype truncated no address %s(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s failed to get receiving packet informationinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 addresscontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2`dhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optiondefault_configread_config$b$c$d$ef$g_hij$k$l)m$n%o$p| q*r$s$$tu)v$wvx$z$y$A$B %CD%EF%G%%H I/%J9%K@%LMI%NO%OX%Pe%Qm%St%Ty%U%V%W%X%Z1%4%6%%z$|%~%}%%% &&+&)&2&0&7&?&D&J&P&V&6?Y"e&n&)*="v&~&&&&&&&&&&/!'&&&&&$&$'AT AT R R rt_new0SS SS rt_buildrt_deleteR R f&)))))r$);%&B%)&)make_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_opensockets_os+++,,,if_initrtif_ifa ( PT@P HEPT$ @CD@DCread_leasedhcp_openbpflog_dhcp<5G5S5b5k5dhcp_bindw5355+35]. 5dhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceSTOPNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d timed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningkillwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUID%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurloption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptdebugenvreconfigurereleaseleasetimerebindpersistentinforminform6timeoutwaitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigure(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deletedif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsedownPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: SIOCGIFALIASbridgefwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\BHI Ha Hy &H ,H 2H 8H >H DH JH) PHA VHY BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~GHT<\D HT@dDHH H&H,H2H8H>HDH JH@PHVHHFDHrH$s Hhs&Hs,Hs2H4t8Hxt>HtDHuJHDuPHuVHutc/etc/group/etc/master.passwd: (malloc) Error in munmap(): AJjhPUPuVvXxZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitASCIIUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist