08P9i'&<  '9i1P''`'2 29i'&P@@<@T 08P9i'&<  '9i1P''`'2 29i'&P@@<@TU 9i`'2y?A9i9i9iQ$f 9i9i9iRA9i9i9iXA9i9i9iYA9i9i9iZA9i9i9i_A9i9i9i%A9i9i9i&A9i9i9i(A9i9i9i)A9i9i9i*9i9i9i/altroot/standA9i9i9i,C9i9i9i-A9i9i9i.A9i9i9imJ<9i9i9i`hpxXm9i9i9i[\A9i9i9i$9i9i9i$>9i9i9i$9i9i9i$s9i9i9i$ 9i9i9i $9i9i9iA9i9i9i'A9i9i9i/A9i9i9i0A9i9i9iA9i9i9i$Q9i9i9i8@HPX`hpx$9i9i9i1 $9i9i9i$9i9i9i$9i9i9i6$9i9i9i7$9i9i9i$9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iB\{h cg$YI?˧~O<0,a> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi  ... . .. catchgrpchiochmod cp dd df ed ln lsmkdir mt mv pax pwdrcmd rm shsttysync . ..MAKEDEVand round # up to a multiple of 32 (needed for mfs, not needed for tmpfs). ninode=$(( (ninode + 2 + 31) / 32 * 32 )) # Try tmpfs; if that fails try mfs. # # For tmpfs, allocate 16KB and 512 byte per node. # Actual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"}  . .. cgdgroup master.passwd netconfig protocols rcservicesELF4D4 (@@z-z-@ss%%`t ,,%%NetBSDAPaXUSR&ffffUVS!-_!Ƭ%9s 9r[^]UWVS,Ú_!]P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*tE9ǍvuUWVSE+]!E@@9s{*;9r[^_]UWVS+é]!E u &M 1ME @E %t/tu(nj%9s 9rEt E$,$Ǭ%9s 9rp$yED$E D$E @$$%MD$ D$ D$$1ɉL$脛$X[$SWD\!5u1ƃ5tЃtD$l_[SW[!4uYƃ4t|$D<$kt?t<$ktЃ_[UWVShhhp& 1t:PYxOvhp&j XZ3h=hp& hp&j j%UEU MsMU HE]UVS1ۋtVP'ZYu ķC܍e[^]US<Phhp&hp&hs CtsPhhp&joUWVSE tuh~URhc@5&f t5&h7ju.M.E.WVSQRP5&hGME t.RPhn( u5&h|1e[^_]U5&ΓXUjhc 5& t5&hj01USRj EPSh xU:t ShjҬ]UPEU Ph JtPhEEEPhc5& t5&hj蕬1UWVSSuE H1ۃv>PWZYtCݠuދݤEhDWZY1tFEEPhc5&i t5&hj1e[^_]US u Sh j貫]UVS1tSPZYtFSh#j|e[^]UWVS ]u} Sh } ~Sh1}{EFE} t!vM9Mt66EE1EEEK>tt,uh1}}}}}E뺉t9WuhjlU9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E4ŀ5&hl "}t}uuu1ۉ]EuM9~VQuhjfk]lS4 EYu h4jH1}E1҉Uuĉu܋UUMM]]}}Ph c5& u EX@1}WuM 5&hRjEuPE4ŀhbCE rhj{$^ElU9U| &h &hXZCtCPh_Xj ^CtCPCPh CtC"PSh Cts؋C4ŀhs C$PhZZYu XE\1e[^_]UEě&]UE&]UhVjKUhlj<Uhj-UhjUE E EE]Uhjjjuh­ؚ&ܚ&Uhjjjuh藭&&Uhjjjuhl̛&Л&UhjjjuhA&&Ujjjjuh&&Ujjjjuhx&|&&&&u(Ujjjjuh赬x&|&&u(Ujjjjuh 胬&&UjjjjuhZ0%u jUWVSux&1|&&1&>W蒄XuWh'j=SY_u ShTjxxuShg]hjjhEP3uu뺋&#H t uh P&WPZ_&t/#=t &&tt hX&ƒtuh<t?%t4!t$t & &hj٢&e[^_]UVSК&uX&d&&&h&l&;x&|&rgjd&&h&l&&&X=5&u𡴛&E &)EU}t 13A}uke[^]Ë&& t h&l&UhҹhjUUhйhjUUSË@4URs(PZYts$hjS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@uy8uK ]USQ9s S$ ZSPEP ƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y hEj&C4WPs(Xe[^_]UWVS]uVh&j脃C4uu s(P(8jVjb$8؍e[^_]UWVS`&}t h&l& x&|&EUEUEU}uH& t?11ҋ}9׋u} ytEU&&E&& t(jRP5&&P Bu@u 5&hNIuSh`&Ɖ 19|4 u5&hr%8t5&hj諝11&E & tKE8& <&5|&5x&QPy0&4&&&1ɉ & &58&=<&9}u;9uu6E9|&u E9x&t&&|&&l&&9}u9utT&t%=؛&u؛&5&hXZ&t5&hjp)u}h&l&+EUEUh&l&=x& |&9}Er }ME EtURd&)P5`& h&`&d& ؚ&ܚ& t8&&&&SQRPpv ujhgbj! e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQܚ& ؚ&t/jhj# ܚ& ؚ&tjhj jEP7hi]eƉߋE׉ptiD&%@&ƉߡH&׋pt)ptZYt puDžp1t5&5&5&5&5 &5&5&5&h6jd]S,S$Sj~(&,& t7ƃ_0 tQRPhbjdSS$Sj}$ &$& t7ƃ_0 tQRPh{jdSSc$Sjx}$0&4& t7ƃ_0 tQRPhjdS?S$Sj0}$ 8&<&iቍhltpRPOtƉ׍xPjhtp/uWVxPhlSQhjd]S$Sz$Sj| eY[^_]a&Uuޒ jUWVS&&5̛& Л&&u3jRP5ț&ԛ&P B@;1S0%v[H0%S5&5ț&ԛ&P$ t&u:5ě&hjq&uNu<)u&hjt5ě&hqO!XZe[^_]UWVS&& &u?j x&|&%x&RP5&&P B@4tAfEEEPhm5&&P tS5&hjy11;5&&5x&5`&5&&P$ ~fEEEPhm5&&P @t;5&&s>5x&5`&h`& ;|&C;x&7벍e[^_]UWVSƉ׉ˡ&҃Pj hWVRuVrKVSh (e[^_]UWVStÉ׃= &t%tPhh Vzh PV =0&ssVPhs$s sssshFm0sxsh@V VX1e[^]Uh&tlP9Zy6 0 P5@&hhp&~h"@>1h&@&tPX5@&& 1҉@&YX1X&`&d&1Uh&t*P謶@&ZtP 5@& 1@&ZYu誶Ujh&h&72 yjD&D&H&D&1@&@=uUSUE l&@&l&M@&Ћ] Ӊ)~@&@[]Ã06w $1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1&2&&@ujjh&h&N thh=Y^&&&&`&)&󤢋&1&2&&@ujjh&h&]N thhg=XZSjjh&e[^_]UWVSƉӀ:0Bhi<XZGu̹@)1󪍅1 CuA uyjSVZ e[^_]UWS1|&&&1jM:P誌ZY1{&Cue[_]UWVS&9|&1ɉ |&ujjh&虹5&=&jjh&h&GL thhQ;XZ1ۊ&2&&Cu5&=&u,_u&v7hVuP#Y^#~hzh:XZ th&=&~|&P|&&e[^_]US]=|&uU ]&1|&=&x|&P|&&[]U=|&uU&1|&=&xU|&]UWVS hfY18]E }=&u>؍}01҉U"ܻ]BuʀEt@9uSD Ythh|9XZe[^_]US&&9&&RP ZYu[0 Ph9hp&fh 9&H&ua&tjtJj]&& &u &ųu١&P&&M 1]UWVSSU&=&CE;U tM&119~149u1ɉs19~H &9E~@1Aˉt&X[^_]UVS5&&&19| t!&H<u &1[^]UWVSfEp E}u.h5П&_Z]tjEP_ Y^uD1GhR^_FP&Zy }Ou PP x. E uh:؟&| zf%̐&Ѓu-hR8ZYuu h6X넋&jEP [_bE &&9&=}\SRK ZYu[A0@ Ph9hp&襶hI6&H&&tjj&& &u &uΨuً&EHП&П&8lx #xtދ&PRRe yɍe[^_]U&1&&&&5& 1҉&&H&Yu&tjtjUWVSPП& t u h5X 6ƅu П&8u@П&S5t&Ë=t&X9=p&|^SYt=ğ&tj jsPEcUjjjRVI ;EtGSZyh1e[^_]Ë &Q &y ;0&| t&J &Uh&PDXZUWVS u1ۉ߃=̟&tVI NyV4XHF `=& ĝ&9^&؁}U|WQz ZYU=&ĝ& &u&tjtjĝ&u ğ&C1 mCE &9&؁}ULQM5ĝ& ZYMUuX0 Ph9hp&/h2&H&t &/t1 &ĝ& &u& u ĝ& KF @t.504 Ph9hp&虲h=2ttĝ& &}ĝ&8=ğ&t=&te[^_]UWVSu VE=&ğ&E血&E1ۉ&ğ&X=̟&t5&11҉UuiEZUU&5ĝ&YUt(EEtBD&PPjAƒ u- &t C&tjtj &u &uݨuEVu9uuHtg}tIuğ&=&tEu~hp&h&;ğ&Y^=&u3B=&uğ&dğ&=&tJE ğ&uhp&h8i;XZğ&t!=&t9uuu$&Cu &19uu=&=&M ğ&=̟&t1ҍe[^_]UWVS];!uh݁CP&XZS h݁Pkǃ u$y0x PShhp&ܯhJJu WYXyh;!u7W(Zy4-0, PShhp&萯ha4/Wǃ=&uVhhp&` &+E e[^_]UWVSu] }9tU=̟&t VP*VP4ZYy0薿0 Ph9hp&hy.C1e[^_]UWVSQu VJ[=̟&tW1ۅtW;uRWNZuZW95&u=ğ&t =&u BRUPu xËUF?륃=̟&tuX؍e[^_]UWVSPu]>!uhEFP$Y_V u Pmƒ u${0z PVhhp&ޭhRuSRUǃ Uyl>!u7R&Zy4'0& PVhhp&芭h.-R ǃ=&uWhhp&Z tE)؍X؍e[^_]UWVSW11 Đ&yh&^u&P&s=ԟ& ؟&9&؁}U|WQP ZYUu[C0B Ph9hp&觬hK,&H&&tj j =ԟ&؟& &u &uΨu١؟&uğ&1ۉ߉ u|&؟&0؟&П&u̐&@t?~0} Phhp&h+f%̐&1П&-f̐&9t{t ؟&؟&П&މe[^_]UWVSWП&C{ u)ÃEП&:TRPx Y^tE̝&ȝ&9&ށ}VR _ZuZ茻0 Ph9hp&h*&H&t1&tj tj 5̝&ȝ& &u &uҨu١ȝ&5П&ljD s} us*Ext؟&M| th)YoE̝&ȝ&9~P&߁}WR YZ=̝&ȝ& &u&"%ȝ&25؟&NjM}t/s2PR_Ztȝ&D } +s#̝& ȝ&9|R&؁}tVQ ZYM5̝&ȝ& &u&uxȝ&Me[^_]UWVSQ]utuh<XZ} 9EueF95<%}h&hc53^XP^w<\u7\t.ˆUPhyZYUtF-/B000CL r1e[^_]UEH!&EPhht@j x$Efv@%Efv<%U=l&uEt&E p&t&p&9~ 1;&~h='XUWVSSu &}t69&+=&=&=&t1C~ Ku"=&tn&u=&t[uSPEZYtI=ğ&Mtj jqP;jjjWu; t9&HhY&X؍e[^_]UWVSP]U u h.&XU19&~BPSYX%KM&uSwP(x?]9tWZu̸1e[^_]UE &DBuh%XP<|&u&E&1UE&DBt|&EhR%XUWVS&&П&EDJ@t t E@П&޹П&0U?& } $}^@П& &П&8f|y@t t@П&܃tQi18j hП&5П&%Ǎ v>8"uhoVA^t-u18UBQ@u^t -uօuh$^ܴ1ۉj hП&5П&c%Í v豴8"unt@П&&.j&_t|%1Ƀ/QP_ZYtП&M:+@П& FPП&@PX.t(@П&l&;u & p&&9Et9&}؍e[^_]US1l&&p&t&p&xLl&t&p&П& ;tK,tF l&ʃ~l&p&IuAt&H l&˃~l&Iu J П&:;v&l9tt&t1[]UVS&11Å t]9&u 1ۉ&J@։t&[^]UVSuj{ Zu+蠲0 Ph9hp&h!FV CS FC؍e[^]UME 19tx\uHPQZY1҅‰UWVS=&ujEH!&&PjhEh/ykh|{^tZP[=wJ@ P Yt:WP=XZ|3/t 3/D3hSX5&jhESjUM=&tI &QU=&ujEH!&jh&UWVSE&1ۃ=&u-9t =؟&| t8f%̐&=П&?u1П&BП&: u)u ?.u tԍ4&WZu# &uo&tj=t[j&t PTCXPPj0à t9u& &&u른e[^_]UWVSSup&Z;&|1ۡt&x&@&9t9u SEWáp&ZYUSWjq/ u &t$195&~FPVjB/ u)ϋ&tj&jSS<[t<\t.RiZÅu!h" { uh]-[1C뵉) &=&9&Ё}UtVW軱 ZYUu[讏0譼 Ph9hp&h&H&t&tj2\j 5&& &u &uΨu١&5П&ljП&=ğ&tj jRPe[^_]USП&< u h XH< u=&u$htXJ П&R t8u ӡ&PKXu1&t=h&u PzX9j> &Yu(`0_ Ph9hp&}hhK1҉h&5&S5& ƒ &t+h'h`&PR`5&Q 1&R]UWVSП&PП&M&1ۀx%u}M8HuuП&h[s9}nП&PП&& П&\PП&&2< &=&} П&U8u&ف}|Wu ZY=&& &O&tj7jm8uCHП&B=&du f%̐&1؟&| u6/& &9&؁}tVQ8 ZYuV.0- Ph9hp&{h6&H&j&U5&& &u&&&&e[^_]UVSVu] 1П& u 1ۉ&U П&< Uu 1w8uA П&П&JπwE)1ɉj hП&5П& v8"uhoV1Zgu@П&늸e[^]UWVS 5&]&=&}+&;&a&M 9}y;M)9 ڋEE&}RUuE ZYUu]807 Ph9hp&yh@&H&t '&tjtj&& &U&uΨDϋ &M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW&}RUu ZYU&& &u&t &M9u}EMELE B19uu)d9|T&ځ}tVuz ZY45&& &u&_b&Cw}9|T&ځ}tVu ZY5&& &u&&؍e[^_]UWVS] Sװ^|=ğ&tj jsPlCjPju 1ɉ E&}t9U3 9&ށ}V5&ͨ _Zu[Æ0³ Ph9hp&'vh&H&b&tjGJj5&& &u &uΨuك=ğ&tjj   &NjEpSP-  9~U&΁}V5&褧 ZY5&& &u&=ğ&tjj S6 &Nj󤋅  ?u9Ћ)ȉË ؍x&9<t t tjPju0 o&=}tV5&~ Y_5&& &u&~+ uEthTZDžW=ğ&tjj S &Nj󤋅 &f u1e[^_]UWVS&t&H&1ۉ]1p&+t&9U졄&@&Pmuu PuƃU&PP[Z&3E&1SwYu' &&tjtsj&t PۭFZPPjƃ t9]u &u &uuE&G&E  EuhXE tu RRK x1e[^_]UWVS&E䡀&E=L%t =H%uhNYm=&t &j&&E=&ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń=&t聺L%&EL%H%&EH% &u&tjt j`1e[^_]UWVS&&Ht7k X< u'ʣ&B0Z9tSe;S蹥 ZY1&&L%&H%e[^_]US&9&}Pk& &EuCk& &u C&P&k &ZY]d&j Ph&k tP跬 Ph9hp&oh5&ߤ 1&&1]UPhhp&nje &Q &y ;0&| t&J &Uh&PQqXZUWVSօt%ˀ9u RPhRPhk uqRPhk `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5& UhPhhp&mjYdUWVSf@8tXu1P}1҉hW3Nà }8#)tSWV% 룍e[^_]UWVS} 5&fDž<^f}1҉hPjà t[(}8}8u }1ۉhW9Vf8uFt"SVW[ yF|8#u5|1ɉjjPQ @u|8thj1h)+jWjbfDž=&t fDž9DžjRj fDž9fDž9&jSV @u|8tJfu ft>(@ufDž=&u#K,&@tftfDžftR@u KfDžCe[^_]UWVSQ}u VW\[ZÅuzjj& XZu haj>0;s jEPWƃ ?tE8thhj/z8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMu讚 ZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPLY_}ËBt1Uje^L$qUWSQ&-&wȡ&ڞw ]]5ԡ&5С&hja 5ܡ&5ء&h,jI 5&5&hDj. 5&5&h\j 5ġ&5&htj 5̡&5ȡ&hj E$hjΤ EPP$hj躤 =&t>u&1 uj]eY[_]aÃ=&tUE Puj UWVS}u _Phj7 3ܛ  &B9tT &e[^_]UWVS$ ]5&t(Vj$V 0Y^ugh j0Pu   yWBjp4$跒 0ZtWVP輄 u WhQ5jj0։( y0h5"jju ։ƃ C Wh Vƒ jjW‰ Vh _Xuh]j踢 [^jh h R(y R+ Y߉R Zt-w1ҁbt#bt!tu h1 Њ Јt u hjYu V5ƅ/ t jZV8 jZVPw5 djjP7& $&0tS SQPR(&,7kPv Ɖ4We 8t t10hj \9s1BFu hj 1e[^_]UWVS\]ƍ}ZE5(,a&V&0, 4! 8 EPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xPD1RPuut5%9ΉЋt}"Q_85%VPh/e[^_]UWVSP] AEH1RPuuƉMt1׋C|1׋ujQ1RP<t2uPhj E01RPuu‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =&EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$hP5&^Ãt#EUSjPV0Ht h" XSTX&&E1С&ԡ&E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu9E E~1҉ t1EUWVRP9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh>3REЃP2‹EЋ^_9t"ERQuuPh}jƚ E؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,Puj Y^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuugPuuhj2 t E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,Pu~ E_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPhj E]E]E Eu&&EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWVPuuShj^ E}8LEiEe[^_]UWVS uEPF VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h5j覒 N1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRPFVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW2'}EEPhEƒyEqRPhUjH xhj,3W&}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPhp1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em}&&ȡ&ȡ&EЋUء&ܡ&ẺEMEPhǃ yNQWPh0FPhǃ yNQWPhj[ 1eY[^_]aÍL$qUWVSQ9q$&&,(&,&?1&&1&&1h8VW- ta#DtNJC91&뷃b$D0&&C&C4&u591ծ&e591.(&R591谮$&@&/591菮& &591n&X91&hp&hIYX&)lj80!hp&hXZ=&xhQ!=&x 8u5&t hjtjj)hkՌ h+jj [_@u hjj hk訌 hj.T00h&@Pג@ uh8t|j/S ZYÅu@  &׉hjShjSj$8 &P{ &1urhJj] jD&؉8hDj 803PyP3hij W5&OG9= &=&tf95 &~W&4FX烽(ta1(,,9 & &_=&tj D&xrP&0j&dh1҉ldPh &à t$n]8:hj{11ۃ= &*6, &,4@lXRjPjjT($tPhXP :8zJt&Z JZ04z($J 04zh P&1С&ԡ&8Y_9t4VZyPhjPhj螉 3‰.Ju lxtH'‰`R840Ph tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRP1ډ߭ $ܝ0v7ء& 40& <0[10=4&pݝt{\PS+ ݅y+؉Phj菇 jPh( \`+EU5&9Ɖ 9jSuZY@݅u؉NPh (&ܝp ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhljP8D8P PuPhGY[# 1҉D<50&$&8Hȉ9r09rÉ014#840Ph`k840Ph`j蹄 04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPhPDPh8&SW(~LFD\`HP\Ph8&W\DHY, X049Ѹ4}u014"80Php1ۉ898r;D\`j\Ph8&W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPh DPh8&SW|$~FL,NY8&D8t8&011҉VPh#K=98~k,0D$Aۉ7<1߭߭&&ȡ&ȡ&ء&ܡ&1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP f1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ= &t 1P8&k,8 $98p 9~Љt$DPShSpPhÃPPJQSPhhj ~ #tV":t&Phj} ,+ePhj} , E$) 048<11ۅt9 ks F(tȃ0tBE;Pdr,9u:s (tvRPYY09us,9uihc (_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WVb^_Ɖ׋E t1 $DH 9|(gk [ (E9s@(ERPWV0,h<(k  袋9.}*WV0,hkj2s (j fk,VE0]\)Hu E1ҋ] 1ҋ] t1RPWVkDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =&h jl Y^wM t1WVSPE(=DH9}bk,4_$S[ G(Zj4>03k P4t0$hFjk MH=&tRP0,hijk EHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh E bRPj@8tGpBuS^ E`&%Xe[^_]ÍL$qUQ X&T&5P&5%(EM MuQQ$RPh"Q%MɍaUS]CtS P S tSPSCr s ] ZS] \&X]USEPsH) H&L& @&Hu0d&Z[9u |&u' |&uhfjP4BPQ X4CXZ@]UWVSu EEE#%`&P& \&M11ɅtJA9~ʳ9M}#tP&hzhhh,-}9x4u }9x(u9p$t버tP&e[^_]UWVS]uuu SO trNj@thhh1GGWX9w(~6Gthhhh,wVw 3 G [^WY@&%;\&X=t&u =l&uBGWux&GWtPp&WGtG4WPZWX\&j@j2 Vj2 G _4E UG$W(G,W0wE #%G8`&tz8GC GtWP { _ Ge[^_]USEM Puhhh4hR+P ʉPHPPP s E]XPs2H H&L&@&1ɉH h&Hh&.1ۉXt x&Hx& p&Hp&P4JH8`&9t!tXYX tAP]UWVSUu }uWVRcËECUtX&RT&EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=%Y,A0Éa,ڋyY I4 s RPWSQ RPWSQ e[^_]US]C%CSjS]1]UE UMQ1]Uj. UU P&PYtHJ &@ &UWVS] &C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdoW CaW ${sMW ]e[^_];W UWVSuE EEEE%&1҅9su}K}9y,u^}9y(uVK0ts4q4s4 &K0ts0q4&&C4&=&~ttpRZg{$u{uCuڋ[0n=&~ tRkX&&t$;3uEE EEuCe[^_][؉؍e[^_]UW1&&&11҉&_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE%K,ϋS0c,ʋ{s K4 es RPWVQ9Cu CC17RPWVQ uh5UX YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RP~Y_}UVSӋEU tt RPMY^CSt RP8Y^CS e[^]USËt-w1Ɂbt#bt!thbRh91 Ȋ ЈS^Z19tPQh1g Ћ]Uuu jUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus 8) C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPlY[L(ștșe[_]UWSvhshh h"ÉЊӃttRPY[LXștșe[_]UWVSvhshh"h!ƉӉȊʃt$uҁTXe[^_]UWVS vhhhh+!ƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPHYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8j" ËEEC1CC"_C_C h1C C$hj! Ehj! M쉁j`j! MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmERJ EpdGJ u?J S9J EE싀}@u jR^_}E UG(W,}x0xdEtFVtRPkYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u&EE %&S0tK0J4&&C4&C(tS(P,&C,&މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hhhqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhhhh6@]9~ ]B뫋EEP E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh}t/EEtP1uuRPh辧]9]tSuuuh6蟧uu] SY[9t$PRuuhnsuC 1҉U uC XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRP߭MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhwtC M苉9t.CM苉p9t$1SQ1RPWVh蠤C(S,C S$]9UrSPWVh rWVh(^ ~}t5EtC(S,C S$9Uu9EtPuhO EUjuuWVSuEE؃uju [X }t$EtC(C PWVhp辣}hhhhMEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP_EuuWVL9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPh臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}thh&Y^tCpStCHuRPuuEU}t hfKZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhF&6EtM}`d)RPh  tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j E1҉PEMA][A[A [1ۉY Y$XZ}t.hjG ËE쉃P^_ u =%ƉE} t hBI[1ɉM%EPjh WVu*hj ËEp }쉻PP P jPXZtS Su%}URjh  t1RPuhj* EEp }}M쉏PP P jPW^_utCHSLC419|} tMhxHY@Et} t#hgHZu uuS9u u9 X S9 X]=t S9 XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjV Ɖ_tCtP0 ^tCtP  FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h|SXZ؍e[^_]UE Puj% UWVS]FHljL1RPuu JEUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h@ u~ 1RPuu 蘡tDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuޡ€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhXZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhXZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhB_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu\Ɖ׀}Mt1׋C|1׋URju1RPQtPuhd Ep 1RPuu輔t֋F Ft:_vkk փ~t*uuh? tFVC(S,FC vkBHMQjPjjRt PhXZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhZYEP tu}rz}zP4PR:X17&t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]US蔛PPhkhp&Hhp&h|%CtsPhyhp&jUSSE] t$uhsZY¸tr1EEPhvd5Ķ& @u35&h"jH]UWVSPu }t}~^hcSwY_DžtFh݁Sd_Zt)hESSZYthSB[_t뫿}}uh&vZYuUEPhud5Ķ& @u65&h"jwe[^_]US}tQ,Shzd@5Ķ& @u5&hj+jhh&%s 5&5 Ķ&@u5&hj,&&VWS5Ķ&e[^_]U05&h"jUSS}tE XhS/ZYthSZYuEEPhwd5Ķ& @uE ]UQ}trEPhd@5Ķ& @uE O5&huXZUS &&t &1Ӊȉ[]UWVSӋ}"&uƍ&u(PpPP?P*PpPP?PPJE 7 u9tN7k?9[^_]1&x@uUWVS։ˋ=0& 4&11~B? ʋE[^_]U0&?4&jh>RP=vu8&UWVSQ5&Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ &1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉M0&4&ÉEE1RPWV҇E)Ɖ1UQh.XZ}Ut4&H9u0&H9u u9rBRWhI e[^_]U塨%=&tvPhR5D&5@&5L&5H&5P&h[ 5,&5(&50&54&58&hl5&h\ PhIhR%H&L&5%5D&5@&QRP5P&h ,hN%4&0&5,&5(&QRP58&hb 5 &5$&h UWVSQƉ1ۉjEPVra >u#ËE8u8"u w܉1e[^_]USJP$PhPhPhPShhp&,jUWVSEM %9uh5% hjًEEUMjؙ]!É]]!Ӊ]uuWkBuAtV%%=PuR 3P5&R  9%uNE!5&}e[^_]UWVSEUϋE Et EU@uSh\XZff=Ut+=&t fuuSh`ff=u%Cth 2fLJ_f=Ut1=&u Sh/Y^&tShgXZj(VPD x0XŃ~X r&t\fLJᵃVe[^_]UWVS9&u&5&> 1Xƃ"&e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEEEtE11}=%E4&0&U1҉U܉E1ɉMԹEM]̋ERPSQaPE؋UEUuuRPDRPuuȋE؋UEUuuRP RPE؋UEUuuRPRPuh],"uuuuuuuh9 h&jdh&i u hjNhkh&Y[&U슀&< <$u z Ћ &DQu<-7j EPh&Ɖ׋EEhPEЃEPhuƟ tuhu诟 t L =%Ήʋ5$&11WVSQ詀ƉuhuJ ui $&ω%$&Ɖω uEt5 &1Et &1Et &1)Et &1)׋E؋]؉E]hkSYZÉ]; t,h&Zƀ&uh&hO 9uE|E9Ɖ]}.uuuuWVhuȋ}u}e[^_]g_USE Pu苸h8Đ&HĐ& yh&_Y&P&؃ t9@t* Đ&y h&-Z&P&8 u hj衞1Y]UWVSEM䡘%E@u h>jk%EӍEƉωؙ!M!EjuuuBu @u%%uhuPh nR5&PV 9%uVjuu5%XBu@t&K!Nju5%R5% 9%ue[^_]UWVSRá&u ƀA Mz΍& S}8PR  & e[^_]UWVSEыEU u1+ˀ &1ۉƉ)߉u}};=&}=&VEUEUE9&&}=&t Ev&KiE9t 5&tމ&ʅu+ &9UE}M1E܋E9E܋U}t0}t}utsƆj{ȃ[^_]UWVS EӋEEh&@Ph&E 5&t hj袛EU9E|E9u|础&] }) VRP!5&31fǂU }u@ &5&֋M)}CsKSCPKSs FSj&Ee[^_]UWVSE}u&"&ƒ<1IE E#֋EU EUEUE9@&D&M`&19Et\tSMM1ۉ]]9ً]M}3M9MM }=&]@uEr&˃t & &t!=&>&1hj &[^u hj,fǀUE裘&EU &&EU&&&ytbt]t E^&QHu&<=&/h>Ygv&=&&;&KxZ 5&t1;EM |9UE}=&t`룅&E 9&u;]t~&H&1+]9~ Fu%uF PPRT & * &1RPEU &+E&XZEU &&EU&& ]3Ѝe[^_]UWVSË@S t+5@&=D&9u9t hY]sǹ󥉍1󫍍@u'C CuRhNXZߋe[^_]Ã=&u x t"1UWVS|ÉסT&tPP Yj/SΡ^ZuS5%h)hT&j S*xT&YT&u hjϕjPT{XZy5T&hM[^xPS(ZY@tMuи 9E} 5T&h/T 5T&hF?h h &Sz 9t5T&h|Mf=&Ut5T&h]_Y^S{XSx{Z tje[^_]UWVSÃ= &u1Ҹy &f=&u1f=ܼ&I؁= &t#&`& &ܼ&f&f^&Ut&1^&u[^_]UWVS á&fE4&0&8&`&11t#f}u&&t9r $uɡ&E &19E~+f:uzti 9t@Ћ &t=&uaf}u&! 9*=&tu7hY= &t f=ܼ&u/hh@XZ= &tT&!9T&=&tPh*_XPhZYt 1= & = &uLyt{1j &tr&!9tSP5T&hA=&t1~f=&u3 &5T&hZYu& ote[^_]UWVS(ÉEU EUE؉uF=&Ee[^_]Q11ɉD11ɉt<u ȉhjhhP8BtPQRhw fu1k t Phh;WVhh =%RPSQVpPhY[=&u" &9u1ۉ)11ɉj-j)pXZttC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾`&19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu h E Et}u9}E}}u &$&1RPuubu 9tۃ}u E9uuujjR|EUEPuhhh&jdh&5u hjh&h[vEHƀ&t'& t9EEHPh&h$袺 uh&EP: uċ}ȋEEă}t6juuWVUċE&uD<=&1EjuuWVUċEu=&tKt$|=&us=&t Phj[P]juuWVUċEt)/juuWVUċEu}t }tPhjс}uf} E U u }EfukE } 1E}t Dm:}ta}tE &1 &&9u19tuugZY &UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P& =&u=&<t &(hHYtfu'uEPkE }P莌 =&9=&t hlZu&}ft=&hH[E̊@EċE̊XEčE@‰8&p1WVjjjE1ɡ4&p1WVjjjÃ(Uă?1ɋ50&1WVjjj^}̊MO_U? ˆWGEĊ_EčG‰8&p1WVjjjE(1ɡ4&p1WVjjjËUă?1ɋ50&1WVjjj}̊MO_U? ˆW(} &uKye[^_]UVSá&u hX1ۃ=&u Sh{訵Y^jjڸ`&CXZu҃=&u=&thX1L=&thCu Sh]NY^g &RP1҉8XZ=&tC&9&A=&~hc5&j5&5&RP 믅<f=&th^hj薴[&t=h肴&Y=uhx"k PhSXZ h EXhgbMX=&nPhY[=&&PPh j=&t>u Sh߳XZ9&} h X; &RP1҉u Sh衳Y^jjڸ`&XZe[^]UWVS ˋDž t Dž @uh%3ZYߍ1jh>S&5 t 1/9Cu苅9Cus Pjs ;Cuă=&t.{ t(s$s shG{e[^_]UVSPE%;%u*=&u!URhmdP y hQ@2X`&11@uhB=&u111H &~ ف &@uhw2^E&01C;&}. &&&@@uSh12Y[1҉U%;%u*=&u!URhmdP y hQ@1Xe[^]ËU2]Phyhp&j螪UWVS|E|x&wShhp&誳jaS EZuh(|ƉjRPu芩9u9th jSuuB^ 9t"|thh Xj1EEfU}EEEEPЃ<]1E ÉEE|ƉuR~EEE_}t V PSE4@h 觯*&fEEE&&19E~WtL9u.;u&}JPaR@&4@h<tuu u@뤃1\3 9sR@E9E~WtM9rϋU9sэPaR@&4@hjʮ }9sf}wfE@f*&}E4@h臮Y[n}tGaPE4@hd } t}t}u$EEfEEEfEE4&uEE]9E@ƒt<u+ExمuuEEZEEu9uuK XEe[^_] &yUh&j XZá&P& UEU 19s f3P]UERPZYUSBHBy;B| X RQ蕲XZ]UWVSQ]u uhS误F fw4hPhS舯 FPjhStFPjhSc Sh`:XZFXt Sh9Y_FXt Sh9XZFXt Sh9Y_Sj *v(hSv,hS v0hSv8hS׮v4hSɮ$vS6EXZEE FEe[^_]UVSSPPVu ujVSh~ʀ,@uL@t!t"*0) Z2tHPShwjnj+UVS]u VSYZu Shjn;/t"Sh"XZu E e[^] e[^]UMRPhhp&j蹟UVSPh݁PQ[^t,PjPuVXVt jP3TZYSKXe[^]UWVS EEu EE}]EEE1҉4& 1ɉ 8&@&hXVu΄ NtJb$1=@&@&D&<&8&뗡914&jWh@5915 u hjrmP YYH&J&4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjPTXZt1h9}P˯ZY uċ2jWSh}@uLt!t"0 ^2tHPShwjkt%@u=8&p&8&_8&MDžb=@&tDžx4&t [dP=H&t Iq=D&t {=<&t 1ۉXPDihbh)j kSh~hVju hajjj/G PvZYt| Sh~hVtj/C P>vZYt| XjsUVS]u VSgYZu Shj7j;/t"ShjXZu E e[^]Se[^]UMPhhp&Jj@UWVS]u1 11҉t11ɉphu uv athg$591`CpX591!CtXDžp591XCxXDžt뀃K|wK|njVh591¤ u hjhPn X<&P;UtU tu4uVEptFuxPV!Y_@t#ECpJtuUxPV!_Z@u8Vh jGohxPV!ZY@tuECpECttu E%Cxe[^_]UWVS SVpPtWu uhWpShDy,@uSVhjGgr@t@1RPhhSG Sh &(j蚘USP]jEPS"U :9uySu h-jg]US]S۲ Zt@ heSZY]US]S謷 Zt@ hSsZY]USP]jEPSV"U 9t :uy Sh?jf]UVS]u VSYZu Shjf;/t"ShĴXZu E e[^]魴e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RP 7Y^CSt RP6Y^CS e[^]UWVSӋEU ΃tt RP6Y^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]tËUWVSEUˋuE FUU tJ$1EE ~uJ1EE ~<$ffCRVڋE E CRVڋE uEE }t>}tWWVv5Y^Ɖuue5YYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5`&=d&}t M U JpD1HӉ5`&=d&}tCS}t#RPj4YYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuhsh,h"hm}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWV%<1҃t0119s#hU3+ZRP;PH0jjjjXSËP`F߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PChV7ZYthVhi( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydh'^_PDžDžt9t h&Y9~Wth&XZ.DžDž9|ċ9|<t h(&Xh5&h9HDžy(hw%^_uqh YI;rhw%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t PhG$Y^Ht2{{ @D0{{@D#Zt⋅9t Ph#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Wh "XZHd 1t1\{ChX\Clg{ OtIh,hp&7D8ljPh]hp& t@t)1L@t31#LC LClC XkT,PxuxtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtp.ct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Whnhp&O 9Huhp&hXZdѽPh dt$hZhp&׊OPh7 v$tpPhˇ^_j Y@uhhXZ+1߭ڍP ,WW$h2eHuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|PYBu@uj0i Php tu `duCPODž1v 1񉅰 t1 t19u9t hT_ tG ?9|$ tj jhq$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@h詰 Yu jjH@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WV\^_Ɖ׉ t19s=Pd/D ]j踮 ƉX P藮 YP| FZ@HRjPjjt PhN>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ Dž@Dž1py_<҃D 9sh5&h" Ft Pt#u?RPY^f*uGɉf1VfN@ tBhhhqfFu=@ A)G G p 6p<uGG9rhhhhZ)9rhhhՉϋ)1󪊓t@@tf)thh hhLP4PRAH‰ljX1OtVjR1RPQytPjh66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=&u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPhr3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t Ph/^_A |tVC@SDs8{8tGpBu虞 E&%Xe[^_]ÍL$qUQ &&5&5%(EM MuQQ$RPh"eMɍaUS]CtS P S tSPSCr s ZS &X]USEPsH) && &Hu0&Z[9u &u' &uhfj-P4BPQ X4CXZ@]UWVSu EEE#%&& &M11ɅtJA9~ʳ9M}#t&hzhhhrm}9x4u }9x(u9p$t버t&e[^_]UWVS]uuu SO trNj@thhh1GGWX9w(~6GthhhhlwVw Ks G [^WY&%;&X= &u =&uBGWu&GWtP&WGtG4WPZWX&j@j_r VjUr G _4E UG$W(G,W0wE #%G8&tz8GC GtWP { _ Ge[^_]USEM Puhhh4hkP ʉPHPPP s E]XPs2H &&&1ɉH &H&.1ۉXt &H& &H&P4JH8&9t!tXYX tAP]UWVSUu }uWVRcËECUt&R&EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=%Y,A0Éa,ڋyY I4 s RPWSQ RPWSQe[^_]US]C%CSjS]1]UE UMQ1]Ujn UU P,&PYtHJ ,&@ ,&UWVS] (&C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd赗 C觗 ${s蓗 ]e[^_]遗 UWVSuE EEEE%@&1҅9su}K}9y,u^}9y(uVK0ts4q4s4 @&K0ts0q4@&@&C4$&=(&~ttpRZg{$u{uCuڋ[0n=(&~ tRkX &,&t$;3uEE EEuCe[^_][؉؍e[^_]UW1(&@&@&11҉,&_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE%K,ϋS0c,ʋ{s K4 es RPWVQ9Cu CC17RPWVQuh5蛘 YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPY_}UVSӋEU tt RPY^CSt RP~Y^CS e[^]USËt-w1Ɂbt#bt!thbRh91 Ȋ ЈSZ19tPQh1Z Ћ]Uuu :<jTUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus ~i C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPY[L(ștșe[_]UWSvhshh hVbÉЊӃttRPIY[LXștșe[_]UWVSvhshh"haƉӉȊʃt$uҁTXe[^_]UWVS vhhhhqaƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jMb ËEEC1CCCzC '1C C$hjb Ehjb M쉁j`ja MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE蘊 Epd荊 u腊 S EE싀}@u jR^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u(&EE %@&S0tK0J4@&@&C4@&C(tS(P,@&C,@&މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hhhqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhhhh|X@]9~ ]B뫋EEP+^ E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh}t/EEtP1uuRPh{]9]tSuuuh6\uu] SY[9t$PRuuhn0u؃ 1҉U uƃ XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRP% MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhwtC M苉9t.CM苉p9t$1SQ1RPWVh]C(S,C S$]9UrSPWVh /WVh( ~}t5EtC(S,C S$9Uu9EtPuhO EUjuuWVSuEE؃uju [X }t$EtC(C PWVhp{}hhhhPEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP EuuWV 9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVA 9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhDEuE‰9u+|vEL։A9u9u V9s9sE]Ã}thDh&a!Y^tCpStCHuRPuuEU}t h謋ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhD&6EtM}`d)RPh  tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8jR E1҉PEMAAsA 1ۉY Y$XZ}t.hjR ËE쉃P^_ u =%ƉE} t hB[1ɉM%EPjh WVu*hjR ËEp }쉻PP P jPXZtS Su%}URjh  t1RPuhjpQ EEp }}M쉏PP P jPW^_utCHSLC419|} tMhẍY@Et} t#h譈Zu uuS9u uz X S z X]=t Sy XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjO Ɖ_tCtPvO ^tCtPPO FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h;SXZ؍e[^_]UE Puj% UWVS]FHljL1RPuu EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h@ u~ 1RPuu tDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu$ €}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhXZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhXZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhB_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu Ɖ׀}Mt1׋C|1׋URju1RPQtPuhd Ep 1RPuu t֋F Ft:_vkk փ~t*uuh? tFVC(S,FC vkBHMQjPjjRt PhXZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhZYEP tu}rz}zP4PR:X17D&t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP  e[^]UWtBRBR t RPY_}ÊtBRtUWRPY_}ËBht1UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh$h hh6UVSuE H$X(1y9)tNp1SQRP  e[^]UVSuE H$X(1y9)tNp1SQRPL  e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh$, E|BD1H)CNjEahE@ EDžp%pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPhrE‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWVܿ ‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPhrkE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWV C0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<u&@&&E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPhr‹EEp E @0E܉F uMMЉF <u v0E@4uPu# E܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉OơH&L&Nu"h%hhXhet5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^ZuL ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h%jLE Xu9utpE MAP9q4uX&\& y(xh&l& `&d&A%AQE@p&t&EY눋EP&W~Z} 1e[^_]UWVS<] E@(E؃} G,u1uȃ{1ɉMȃ{E9C(rC,}t-wSu"XZEtEPt@pEЉUvӋE@HEEԋEYE؋E u1 t1EE}P{}̍OKu؋uЋ}ԉ t1WVR8}̉CPP}M؃1ҀMt)}}9s6H 1B׋}d}9sH 1qBC EsE̋E#u1 t1EE)C(C,}K S$u,C,E Ɖ1u)EЉD1E,C,EƉ1u)EЋUԉD1T11EH&L&EUE@(E؃} G,uFSSXZCt SVfcXSPvCfcY[&U9Pu(Ce[^_]UWVS=&th&hVFTY[f&j_,B jjOEU表&&RPOEU5 &5&TOƉXZuuCOEUuu}OEUE9EEEZE;&E &sff&j+7Bm [E;&E &rj9&uA95& &rA- &S9u&9(& &9ƉsQWVrXYuUhCPXURUPhEhp&UfbWV2NƉ׃9uM11 WVXYuUhC5PYURUPRAUfbXZ9&t A_WVde[^_]UWVSjjY[t<Ã=&th&hoFRXZCtSPLfc_X[u=&th&h~FoR[^1;5&&WV!ZYuыXtCtNPPc xu StjSjjPPAOfc[룍e[^_]UWVS=&th&hFQXZ1;5&&sJWVaYXt3fCƒfS{ufCf{t hFSOXZ[Ƀ릍e[^_]UVSuVZuVhFhp&` 1Suu YXt 9t@uu hFM {u}t hFSOXZ19e[^]UWVƉjhRPf `'t9xu9pte^_]UPhFC7ZY8u"hGhNG5&hqGhp&j@UVS@fC$'=~B ')fD'5H'jhh@'{Ht %Z1$'5$'CPS@'Pdr5 'C$' e[^]USjjj0+CC]UWVSƉӉ9tR)yShGhp& j%RP6蚺^thF P6Zo F e[^_]áD't#UPju u芖Ht %iUWVS =&uu 9uEffthB1ƒ=$'t fjEPW襕WYf E{1;] }ߋW ('=$'ut'?t"GGȉffWttG%)Wu9rG9=&th&hGMXZGt=&th&hGMYXG&O9st+PQhGh&=&th&j XZ?te[^_]USjh %|m Y[th  Zu S>n Y11҉P]UWVSX=&th&h HL^_5&5&5&h)Hhh %追&߃WhXIhp&׼ &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃShBhV8V^NjP ѡ@'a5@'kƃt(@hgbP ZYu)5@'CYu*LShzIhp&ܻ 7ShzIhp&ǻ FhMPYZu5@'Z1ShIhp&莻 @'Ƅ=FVvhPShIhp&>:hPS{1RPSVH @';5@'Bơ@'Xae[^_]UWVSuS_X؉8/u@1Ҿ1h[P.XZۋtm;thlu1WP ѡ@'S"^5@'Yt@9uVSBPd uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3e X]] UWVST=&th&hIFD[^& nVUX=&E}tPuPuSf uSf EZY~/9jPuSjSh#KhQ5&ˡ &&MU)Q tSYPhOQ5&蕡 4Q=8&t8&h&Ph&5&h`Q5&^h&hQ5&I$5&hQ+XZ&@ @t hQjf]UWVS} u=&tWh(Rh& EE]99ru4=&Q;]uPh?Rh&萠 {CPCPhS*hRQ=&t R3C4,%hMRh&0t}t?SHK))PDPPCPWwQuSHK))PDPPCPuwQ<SHK))PDPPCPW"wQ荀@:{NhrRPQZYt hRP:ZYtJt%uCDPjWvy R?CDPu{ZYRCDPjWy R@{atNt)CDPjWx R?CDPuxzZYRCDPjW?y R@t=&t/RhbRh& =&th&hR(YX=&th&j XZe[^_]á8%x=!'ti0UPI XUWVS @*'}tt=hR]%[15"'5!'t=& 11ɉ1"'5@*'tj&Yh&  =&A=&tSXhS0 ZYy*Z0Y PShOYhp&轂puWS:2 uSQ2 uI0=Ehhih jVEPSjJ E Et EPS` Y^EPST XZ=&uuuWh)S`=&tShXh& =&tSX=&u4hhS- !' yD0C PShkY=&th`' 'PYuW5!'z0 u5!'0 &Ehhih ~jVEPS5!'(=&u=&tNqEPh`' 'P Sƃ tV:URP '0hYh&vӋE EtEP5!'z/ XZEP5!'i/ ^X=&tuuuWhSu5!'/ ZY5!', Xe[^_]UVS E(&EEEf&=&t=&Tt hW[hWY=!'uh!'' Z0!'EP? ËEXE8t185P&hYY^Uv"_E-EF&9ӋU9uu&HtX5P&hYBXZ݃=&u;& EEUPE0ű MUUEЉE^XA&& uE&1ۉ&$M u9t5P&hYZY11!'e[^]US|=&th&hYa ZY=!'tjjh@&' =@*'t 18%@jjh@&') 8%y&ݎ0ܻ Ph@&'hhp&<~&&B(&'@*' & &'9~ D@1ۉ(&' =!'t RQZYRQ58%( <0; PhYYt!hhZPh3Zhp&}j;t &$&'=&tPhSZh&W} &TuF (&' "' "'&&.uhp&hjZvhp&hZ[X=@*'tB=&%Sk8"' "'11 "'=uI)У<"'=&u =&tu&&&&&&&&EPhgb(ZYy#ތ0ݹ PhZhp&B|jrE荐w<%<%PtPhZhp& |jr= &t hp&hZR&u,=&t5"'h[Th&{ hZX=&thp&h[SjMr&&=('u&]UE Puhp&L UVS]u =&u0VS( ZYy#請0誸 PVSh?[hp& {=&tVShd[h&ze[^]UVSu&u8jjhVQy"<0; PVhu[hp&z%=&uVh[h&zz ؍e[^]UWVQM1y;5&&s!WVZYt xt@uωeY^_]UWVQM1y9s!WVZYt xt@uωeY^_]US]h]Ch`*'ԍ`*'XZCth[h`*'1 YXC th[h`*'0 XZCth[h`*'0 YXCth[h`*'0 XZCth[h`*'0 YXC@th[h`*'0 XZa*']UWVSQMS=Zt$1tH &r11Sh[hp&x eY[^_]USuh[hp&xhp&lR&HQPy PmpY J t&Hy PJpZ J: t&@ t1yt nw1y]UE Puhp& =&u(hDr5&h^XZt5&h^Y[z&tSh^Pq z&tSh^Pq ztSh^5&q zsSh^5&q zsSh^5&dq zsSh^5&Eq 5&j MXZ&@ @t hQj6e[^]Uh^j6UWVSQÍ|jEP5l2' Ht h^jP6E< u Fe[^_]F9uh^HSh%_=h^j6UWVS$֍jPwPDtSh" 貀W^Fu1ۉp2'92ω؍e[^]UVS u Vh_j]ShSgq$S5l2'x Vu5l2'i (e[^]USPu uh_jP]S1hڸJc]USU x.Ruh_hSgڸ_]ËUEPh_iXZffUSPh_hp&khp&h_P% CtsPhyhp&nkhp&h"`@%XZ CtsPhyhp&6khp&hJ`jaUWVS]} t~C7hcVsYZt:h݁VsYZt-hEVsYZt#hVs^Zt1 @uh&wsZYt|1j}Wjj56'^e?E? EEEPWS56'$e[^_]US}thjEPjj56']?w52'h{`3gXZE@uP52'h`g yP52'h`f }yP52'h`f ]UWVS(}tE 0iб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V56'e[^_]UWS}t!]U1E5jh'jjjS56'e[_]UWVS ]} t~7hcV~qYZt:h݁VmqYZt0hEV\qYZt#hVKq^Zt뮾 1uh&wqZYt|1j}Wjj56'e?E EfEEEPWS56'$e[^_]U }tjEPjj56'UЃu52'h&adXZGtP52'h=ad EtP52'hWakd }yP52'hwaGd UW}t5U1jh'jjjR56'}UWS}t]U1Ejh0ujjjS56'e[_]UWS}t]U1EEjh0ujjjS56'Se[_]UWS}tY]U1Ejh'jjjS56'e[_]UWS}t]U1EEjh'jjjS56'e[_]UWS}t]U1Ejh'jjjS56'ne[_]UWS}tt]U1Ejh'jjjS56'#e[_]UWVS] }~j PW56'K Rt$Nuj@EPjW0Phaj*j$pPjj56'rEЃf=t RhaaXZ91׹󪉍,ƅ8fEf;} 14zj 0P3rƒ 08t3hajs)D,ƅGʉLj Vj56'ƅ914}t1"jhask uƅ5jhtj4Pj8P56'<ha`h& =[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`56'X @u hbj(E<u 52'hb<u52'h-bhp&b ~<tP52'h@bhp&b_Pu󥀽_y-`9CShab_h& < j iRZ<hib[_Xe[^_]UWVSE] hD Zu hxbjU'1󪍕 19}J jQhi ujQhbi u#Fuobu 4jVh_0ki ÅtIjVhbUi u'jVhb3i uƅ7fDžjh0uhj P56'ƅp9؍t hbSztY_uu"-hS XZthbS Y_hbS XZhbS Y_u hbSy XZS52'52'52'52'h c ]@tAtif@ffh-cSsY_o`f@ffhJcSosXZ(/f@ffhcS>sY_m!u hchZEVh_G\Sh<\X4S׃X9uEe[^_]骔 e[^_]UVS ] }t3h$VgZYthѣVgZYu E'j EPVE U:uy 3hcTsh$VQgZYthѣV@gZYu E-j EPVCE U:uyshcj|#EPhU56'S t hcj#e[^]UVS ] }t3h$VfZYthѣVfZYu E'j EPVE U:uy 3hcTsh$V^fZYthѣVMfZYu E-j EPVPE U:uyshcj"EPhU56'R t hcj"e[^]USUBBPJ R PhdY uEd]Sh(dYXZ]UP}E 0EEPhQ56'CRt h.dj!U}tqjhQ 56'R t h9dj!U}tGgt[tPQhxgVSxOf@PhgVS]O1ۉ؍e[^_]UWVS]}hpVjSzPhgiP{vThgVPY {yj hg>PXZ,C@tPhg&PYX,C t PhhPXZCȅt Ph&hOYX{w j O_CȅtPPh9hO S C h:VhShOC t PhfhOXZhpPjSuj NXu'tPh{hYOj sN W;} } <;u GVhh!OYXujhhOXZjhhN^X>9tR;U }MuRlhhNZY1ɋlhlPhNhAlBXXh蘕Xe[^_]UWVS] }uhhcN^X1C9~D3PhhGNFZYj \MX}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`uuF @u hbjEtU2'<uRh <uRhhp&AP #<u jSRPRhhp&PjFe[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@UPhhp&VNj EUh3,bUWVSÉ֡$8'P$8'uhh 7'ZY_ 8'hGhUhWIhEWc _ZuhGPh[j J<' u.h 7'Phth{Mhh 7'Phh{[M1X9ډ}Dh<'? $h)M <'tWPjh8'V?;9}~ڃ<. uP<ؙPhȀLh@8' YuRh1jRY[j^ 1<$1$jQXZh)XZ?e[^_]Ujh@8'貫 U=<'u h.<XjBUSh.&h1jmQh1jaQh1jUQh1jIQ$hhh. xVj"h;P h<'3>j PS jhGS (h8'iP$h8'S{ S ]UPhIhp&aKjBUWVSы&:֍RD{@u1ҊBuT8t9s &DY@tJB[^_]UVSËHuPs8tIS8kC4`9s `R諀 1s0s4s8X{Xu1ɉKXCXtP臀 Z1CXe[^]UVSu] EPu366Fx9s)e[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|Shj EPFEEEEPhhj EPEUfT ȃ&DJu.D=uURP U_Ce} t EPYuhFXZe[^_]UWVSS1}11#tAEtSWh̓PmSh?P\ @u hDhԃ5W }YCu}u#hEZuhDhكjEe[^_]UhރPhPhPhPhPh0PhPhp&H8j`?UPh?5%H@' t5@'Ph5%fHE Pu5%L@' USÅtNXA'twRtF @'tiX0莅 Ph@?'hQHA' @'u=@'u2j> @'t#IX0H Ph@?'h tŋ]UWVSEEEEujj}WjVP @u"e[^_]ËEƒUt Phj Pt ZtjjWPVu誁 @u ]=@'u5%uh  e[^_]UWVSWE}u =@'R˃=@'t>=@'u3{=@'tNu%"u25%Rh >@' .h&jWS{u"Rh?W>@'XY~7j d=^@'~"@'~uى؍e[^_]it1RE rGK=@'tUPhh=YXUt2=@'uUPh=XZUB9|SWhS*= NuEe[^_]=E e[^_]<e[^_]UVS]=@'t EhSHY^uEEYcP1҉jEPS EUE 9u%Suh =@'jW68uP8u̸]1PSEPuVuuy @u1t =@'1@' @'u}u}tPjUEPj UENY^tF@' @'u}u}tjjMUEzjj UEXZe[^]UWVS]=@'t 'EEN18jjEPEPuux @uuhЅkjPSo W@ u%Suhe =@'xj4j uV |WRN8u|1PSEPxPuux @u1Ft =@'x|t1p@' @'tpjxUEY^?URV~ EPVhjduV8pPUEG$tk@' @'tjj|UE~XZEURt EPthjd]S8jPًUE$e[^_]UWVS(%8@?'t f='/='@?'SV ZYuVh=' e[^_]É)@E̍EӉljDPh='z h[h='k uUWVS`Eh='@ZE1]M;>r2jPRUݗ Utj@uVRP V3h WGjEPjh='RUp UuE Eu1}u+E9Eu#/tj@uVRP V3hjGQ1EEe[^_]UWVSEUE5@'$ˋ @'@' u'A' @'h@?'h)[^=@'tu*jtHu!u05%uh 7 *h&jSu Hu"uh?7XZ=@'~(j 6Y I~I~uڋEe[^_]1v{9}E0Phh27FYXt WhS7XZE e[^_]*6e[^_]UVS]EjjEPuVuut @u Be}t Shgj @' @'tjIY2=@'u Sh?6XZuuuuuhd6e[^]UWVS]uEEU E$EA' @'=@'J@' @'t}jjEPjuV7s @tdMt]QMe XtMMMjjEPWuVs @tM;Mt WKn _j@?'PY}e[^_]*n }tuh@?'h = t)tu*Sh uShbShSh:SXZe[^_]UVS]E jjEPuVuuBr @ul} t Shgj EUEU @' @'tj cXP @'u EP)P5%Sh4&IuRPht4 uRPh`4e[^]UVS ]EjjEPuVuumq @u}t ShgjA @' @'tjE=@'u5%Sh 3 EU=@'h RPvz t PzXuuh3 e[^]UWVS,EE̋}uu<=A't3EjjEPEPhE܍Pk((U܉UȉMQM(c XۋMЋUuwuM1BH(jjURPVWp @uCEԋU܋M؃t (9t$9uދẺE1uhgj 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh%uhjUR0UUС@' @'t7j(EY(}t GE܃t9]e[^_]dj =@'uuh?1XZv$v vvvvv vv6h1,뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|PhX|<Dž|tW` XuJHxjjxPVphm @ut9xt Shgj l%EpujjڍE_X=A't=19|Wh%ShjUR. jjUE{G ŋ=@' =@'t jQ=@'u Sh?/Y[|~+t4Wh/G9|~ hT/Zj .Xue[^_] h e[^_]ÍL$qUVSQ$A QEjjMQuVRPl @u}t ShgjZ @' @'tjYd=@'u Sh?.XZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$h.eY[^]aUWVS@]=@'t Dž SXuhThj 1hzR Y^SA18jPSh? u.1A8"uSh9t8uShj 9tҀ8úw܉ hzji 1PSPVuuj @u1t =@'1ǡ@' @'tW EZ)AP4<$PUEVe tV@' @'tj EvX1PA4$PًUES/e e[^_]UWVStx|h@?'3l@?'$='3Yh='h)ȉl)ȉ='u@?'u|uH1ۋx9t担tgbuRPhPPC뿃} t~|P%xwRPh PP|PgbxwRPhPPU Dž|%|%Ã=@'( =@'th='h?*XZh='h@?'h+* EHv hh5<4,h5*_X}uC|@0|psPh@x*Y^P|p4hK`* |p@h\J*|0 A'XZpt 6hhh A'phhgh A'\zppu/hWh A'4hhph A' 揃zƀt2hWh A'hhzh A'zs2hWh A'hhh A'z s2hWh A'hhh A'yz s2hWh A'Uhhh A'Az s2hWh A'hhh A' z s2hWh A'hhh A'z s2hWh A'hhcMh A'zs2hWh A'uhhh A'azs2hWh A'=hhh A')zs2hWh A'hhh A'zt7Vh j V&hWh A'hVh A'(h A'|p%Phˆ%'|@H t Phӈ '_X|p(h݈&j & }r=@'=A'u }|xXDž1DžtxTpj`SPPWt}c @pu\t|@9uߋ|@(9uΉdQpV ^dtNjp󤋅|@XPwPN^ Y|XX=A'uTE tN|@XpHv9} |pUE"<=@'uh@?'h?2%XZ|@XPvhP%lX}|ps E z-UEÃ}tP@uj-e Ph@?'hj"s u|xtjh='h@?'|@@uojjPjxta @uDA' @'=@'h@?'h|@@EH{$@|xt|@8d uq=@':t.s j|xtjh='h@?'S A' @'=@'h@?'h)J#tx\=@'j|@4p\S _+jjPRpx@Pt_ @pt*|p`t7|@4`&R [ ^K58 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQTQ ZPtރ NjTCXpsRWZ X1@'d1ۋ|;X4,F\sA' @'t%xQuujPtC`jjPSxtl^ @jjjjPSxt6^ @UjjDžjjVSxt] @uI38 u3P XjjVSxt] @u jٺ@?'|c^_9SX [DžjjPSxtD] @tgjjٺ@?'|^uO Yuh@?'h:5%" KjjPSxt\ @u jڸ@?'*SX XZhƀ='lƀ@?'e[^_]UWVSƉLH@'j=PE_ZƅTt9sx?u @ƅTGh VrY[.t%%8| 8Vs tG=^jhS) P` F<=t:%M  T=@'u h]s 41Dž81ɉh 1ۉtpƅY1j,T%_ZƅtF1ۉH1DžL1<1ۅkj=V[ZÉluhVr)ZYu09@llhVJ)ZYu D1j,SZYDt @DhnV )ZYHt;OHunPTh~, =@'ju/010jlPSD.-u F0j PV x;3ue[^]UVS@Ë5O'=X%tjtSv<ZYuFl6j j5SHFS$PFShΈP֏O'5O'F Phj@]SSfe[^]USQtP^k=XO'uS; Z]UVSÉu=XO'u VS< ZYe[^]UWVS׉΋]Uu E E!UuUt[^_]USt<0„!1=XO'uS9 Z]UWVSLEӋu>h%V ZY)ƒ?EljDUhbbSP0 EUDEj URPEU:*u%jjWSRPEP,tEuj>ur E9hbbSV0 e[^_]9`%t3UVSRPjuV`%e[^]#`O't úO'=B'uO'UWVSƉӊ>uuVB'HtB1TO'hp5B'VK/ =TO'1҉TO'hp5B'S,/ 9=TO'~؍e[^_]UWVS,E9PO'B''}]6SPY^y#B'B'B'=LO'u O' LO'S Z=X=&wAKw2if0[nRf0D=,w$==!f0=Xf0=KwJ=w$==` f0 =%f0 ===f0wf0lf0af0Vf0Kf0@f0 5f0 *f0 f0f0 f0EۣB'EݣB'EܣB'eẼEfE1E O' 5' Sj5'( EPO'e[^_]USEPhht@j> 1ۅu E]u+h-eaZtPeB'XrT~B'h(5aYtPeZyB'B'1ɉ \%=B' B'tB'0h8`ZtP]eB'[D~B'h3`YtP-eZyB'B'=B' B'P]UPUEN'1J$@ (U@UClyUeOUFUIۍULэUOǍUR뽍UU!u,UX uN'N'N'1UVSPh}_P_ZYX%h_[uB1ɉ XO'PhF'2 [^Ht XO' t XO'AxB'B'B'B'jQB'\O'y1B'B'B'B'B'B'B'B'~1҉}'EB'UZt0Uu|O'UuxO'UrB'U`u[tO'UEulpO'=\~'t8=4B'u/UYlO'UhO'=lO'u1hO'lO'=hO'u hO'U6O't8uB'O'UO'=B'tt8uB'O'U&^O't8uB'O'GU/O't 8u O'1҉B'EPhhhO'O'GEP5O'5O'hO'O'/Z EP5O'5O'hO'O'=OEP5O'5O'hO'O' U?"UuO'K3t O'3U O'tހ8tٍUb4ÅuO'8t&jjPs3 PuwuV.DEÒO'UңÅt =\%uO':t+B'HPjR3 PuuVDEqYO'U46uqO'UÅuUR…u=B'uÉO';u Z'e[^]ËB'tO'nB'pO'^=dO'tg=X~'t = B'uMU=}'t=~'uB'xO'=~'uB'hO'1҉dO']1dO'á`B't 1=dO'úO'B'O'O'O'USc=X~'t = B'ul=~'u<B'lO'flO'8thO'8t=\O'uB'=~'uB'|O'!=}'tdO'=l~'t9B'~j CX]6]Uuj5O'0 =t~'uO'8t B'Ã=x~'uUjlXËB'O'qO'bUWVSu M1+uAM]-}tue[^_]USÅthpPQZYu ǒtEPEPS tt<`Ux˒Ux< ˒Ux ђUxܒ]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]U帒pO'O'O'|O'm1`O']UE t  &@t]USuZù¡O'ڡO'ڡO'=}'ttS蘯2XڡO'`O']US=}'t`O'u ]SJX]US]SZ3`O't]]]UuZu Y9Ã=X%tUhXúO'UWVSu}]E Et#jYu7u21ۉ] EjYut$RPyZYtRPjZYuÉE1ɉM E t9Et'hÃu1҉U t EE.vOԺu Y 1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E EHe[^_]@O'B@@@ 9uUS]t=h%tjh\XZh%]Ã=@%UWVSO'@@ˁ1 }1119މM}Z O'9t+9xu"9puUpP5@%袢 UхtjhqFXZ뛍e[^_]Ë O'…t8=O'u/US@t`11Ҁu 0@4@[]UWVS$O'$@(@u9t9pu9Hu,@;Ps D15~'%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=8~'t @td%x; @~QMh j( ZYMu 18~'0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x ExO'$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@]Bu@ujh[^&O'M]艈@@h%Ft*Th%=*u:Vt3st!dt1k1uUE 0e[^]UVS hj$ h+DhP'o hxP'e hlP'[ h`P'Q P'XP'P'\P'xP'PP'|P'TP'lP'HP'pP'LP'`P'@P'dP'DP'h0D1[<=:tjh:?j FWZPÃ$%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=O'tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=O'u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U@P'E1uNHP'Ev¸u6&E^u =d~'t%ED]U@P'E#1uNPP'E¸u60&Eu =d~'u%E]UE=O'tE]P']USQ]uhhP'w?SSZt'؃@PCYu@Sh(S5P'SZt. S YtS5P'j hP'L"yEP'SEPEXZP']UXP'E¸uH%E]UU 1}Du% ]UWVSSEIuRfP~^X[RVZY1uEV Xt SOY-hR'jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRh|V:hNJ:Sh^PQOucjhfV=Oǃ u.hs:Sh^POu0Sh]V O Sh^PNEW Ete[^_]UVSh9P9ZYu3h*VlZY1t=hQVWY[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPV]Y[{%=eh݁VV GShV #jhV  1҉p1ShW t t u@hWYZhWYZhWYZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UEQ'U Q't@]UWVSSuE 8=}'u ^9uO tu QMqZYMuGCQ3 W- _Xu s CZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]áQ't);4&t!UjhR'PQ'@ UWVS]=O'u3Q'=Q'Q'Q'uPQ'Q'ÀuQ'%=ua%=tSSHQ'%uF Q'AQ'Q'9~1!PhQ'ZYu(1Q'K1=Q'4LQ'15Q'=Q't1ۉQ'UU1;L&u PS_/EZYKHA$}e,+1Q'#1=Q'15Q'Q'tQ'8 1ۉQ'Q'=R'vx u-x Q'=R'w1ɉ Q' Q'5Q'GZq1Q'Q'8\<1Q'I1Q'E1Q':41Q')91=Q'Q'=R'v6x u0Q'=R'x Z߀x IQ'=R'w15Q'1ۉQ'Q'8 uQ'8 oQ'oZQ'Y1ɉ Q'=Q'=h&yQ'-R'h&_h&[} t9s RUVhR' Uuω_1Q'ItVhR'Q'R'XZQ'8=Q't }Q'tPF 15Q'_.=EP&[¡Q'u=Q'R'R'u"zQ'tމU&U; u C9re&Ed&E11ɉMR'9t)9s"RUuV Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\Q'Q'tP XjQ')@P,Q'Q')RSPQ'0e&8uCSm<XuSAQ'_WAQ'W Y[Q'Q't{}t1Q'PhQ'o-1ҋE7_ZQ'E%Q'Q'9Q'sQ'u,15Q'Q'/]1ۉQ'Ku5Q'DY.Q'=R'v d&8Huh(Zu[1Q'vQ'e[^_],e[^_]UVSQM1uuR'EQЀ w[jjjj uuuVtjhʙY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1Q'9Q'|R'áQ't @@@ Ã=BEZ'Ry XE=@u$HZ't t7tut g ]UVS=\%u=X~'t = B'ut/LB'PB'u ujjj5TB'RPV pZ'u)=\%u^5l~'O'l~'1ɉ O'-5l~'O'l~'1҉O'u H5zY6Y5l~'O'e[^]U]UWVSt e9ZƉׅu‰['['O'='u0t;5['['}jjjG 1O''ld8e[^_]UWVSQE)ơDZ'uDZ'DZ'ǁt#t1 2ux%DZ'Su5DZ'áDZ'ƒDZ'@Z' t;x- st jk1j1Ztjh蹱ZYtV1VJ)Xe[^_]USVáHZ'$N   tw #58Z'jCP7tW6%I/f5$Z'S5(Z'5,Z'q1,Z'?E48Z'؋]`DZ'DZ'PS5<+u C< uhB'tPZ;u 1hB'ShB'X58Z'jPCP=t71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉Z'YYuZ' ыuUS]t CPX]UPKPEEUWVS<DZ'B'@HB'e=HZ't1HZ'18Z'S u݃=\%u yhK5h&jYO =HZ't)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $j1ɺ97 8Z'191;8Z'^  Sq?@j1ɺ;4Y u lpSrj1ɺ%[Ze4 t u.Sp_eZ'j &% j1ɺț^8Z'19WSXt1E9EsWQMS_ZHMt QXYKEPU8EtWZt W>YWEP.XZ}tE)}+} MJx҃u̓@tAu=}' =}'B$}mu;B'}Rj#;kZ'XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e=}' =}'B!5B'V9}Pj#RjZ'XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]U塬Z'Z'|Z'rZ']gUM UZ'y1E E՛]7]UM UZ'y1E E] ]UWVStVk_u `|$WXZtu h[VhWSP}tjS; Y^y SZPL< X؍e[^_]Uh|ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'\B'<%tXB'tRP蟔Y^CGjCŚXZutKH݀u=9us8Ft38Ft1 \B'<%t XB'tQPS腣S?ÃCFe[^_]UWVS]S^u1jjjS8Bu@thVS9 ~ˍ19=O't)RP芨ZYu FSW_XSjW]ƒ =0~'u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=G Sh1P,Vt'YWN Y>u VZ SX؍e[^_]UWVS}1ۃ=u#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=}'u2=O'Pk$]'RPWVcWV4Ɖ׃ - ~'uWVcY[uu}䡔'Eu藊t ub EUcuu3uuEUEU9uE'$ uuP&EU ~ÉEf=~'Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃ'g} t}uS*(EƉ׃}s}t$ ]'_E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉U'襅t u`Ɖ1X~' ~'uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=~'t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&= ~'tM\RPj =$ Mj}!SQ{&uu+z^=~'tMWVuuRPEU$=P~'t;}t5 u't t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1= ]'jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=}'uk$]'9EE}11軁 ~'uEU)juuRP蹁EURPǃ[^y=P~'tLۂւ t u, u'<ͅ u@)蔂'訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃ'Ex u5#Å^IJ  ]'MCEă=~'XmRPSO!Eă J…u = ]'~1҉X~'uȉ}E=~'u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=~'t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=~'t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5H%=L%΂Hw t5P%=T%e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S= ~'Ee[^_]3rWVEZYt1ۉ] Ee[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuEB')HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPhjW eΠ5j PWO‹ 9u\Z'Ze[^_]Ëx]';p]'~~p]' ]' t]'‰x]'US\^'X\^']'^'[]É19&t @uUP`iYtB'tB'tB'tB'UWVS$]'UjS蜖EjS葖}tUuuۚYXtP5]'} ljE5]'5]'蠚5]'蕚E]'E]'$]'XZ1e[^_]UWVSÉ։9$]'~]']'< +t[^_]UWVS׉ˋ5]'V]'Љ[^_]M=}'tt*ttt t XÃ=0~'u[USjm5P]'05ZYǒt:t1ɺNC=]'t<t1ɺ*C]UhD讽P]'PYZt P]'hU艽L]'PƽYZt L]'fjh=U]'jh,U]'$]'h]'h]'ނh]'Ԃh]'ʂ h]'轂1]'ZU1}]á]']'U]'1\^'1]'9]'~"]']']'1ɉ ]'@1x]'t]'p]']'l]'h]'<]'d]'`]'H]']']']']']'h]'(h]'h]'h]' h]'1҉]'UWV=<~'uu uƉXZ11~' }'u=<~'u u$ZYt]'@=~'tʺ@b P%T%~'ut79MM |-M9 H%L%U |]'@x@]'c B}'9\^'H1Ҹ WVY^1 tj uVRP;FVeƃ1}')9~1Ҹ G19tD=G1Ҹ \^'x]'e^_]á~'t}'=<~'u }'DUS]'9]'~$]'<u]'Ph]'€XZCԡ]']'\^'x]']UWVS]u }Eu@0tjxYEe[^_]d=O'tW~Z=O'tw/P'x_uSQ~[ۃ]'~K1S|YuSWV~_ZV]'t2dZYu]']'DV c_tW]'uVb^ƒt B'V]'tcZYt tB'tB'tB'Ӊ؍e[^_]UWVSEUMЃth]'} u)}u#=]'MH]'}tuEPjEU RPu ugu=}'t[]'tR E['['ut;UE }EU ['['H]'u=H]'tr1ۉH]'1D=H]'uf=H]'uJ8u u1ɺZYG9{Ft]'1k à]'ك}u E1O]' ]' E1~RjEPy ]'1҅~ ]'TRPuu&Ã=0~'u}u9EEEE55x]'+5]'Ee;5B''EPv_ ]'9]'uY=]'u=]'uEU ]']'1=]'~+9=]'~]'81ɺGh]'w|Ym19}E81ɋUG ]'9]'|1}uEPh]'|XZ]'9]'~Չ19]'~=]'   ]'<<@B)5]']']'9 ]'}1ɋ}' JKݸe[^_]UWVSƉP^`[=0~'t<x]'+]';B'~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ198]'~ @]'t 8]')C1[^_]UWVu} =0~'uWV1ZY ie^_]á]',]'x]'(]'á,]']'(]'x]'UU1wR5P]'+ZYUS]1w%SZ1uS5L]'y+ZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6) 9tu!ـuJ) u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} l]'E졘]'=0~'uuS]'Zt ]'1l]']'dSPEZYtJHWVM^_]'xt ]'Sh]' yWVMZY5]' 1]'Sh]'xh]'k]' ]'Pdyh]'x]'@}]'2]' ]'9]'}%h]'xX]']'= ]'9=]'| ]']'؉ESjEP8tU$ t9r)ډh]'w5]'B1=]'[^0}'t d~'u"uu} U]' p]'~@9]'| ]'|t ]'D0tu u. u#uWV11ҸJt1Jutq]'ЉERj]S*sƃ ]'E9s=)У]'RjSsNj]']'?4WtVL)x]'~뫣l]'m}]']'=O'ul]'PapY]' ]' M9u3_u(t M:h]'t E)M Ma_uM]'UK_uFM@t>SrZt h]'E)]']'PoSPYtE u1l]' }'t =d~'uuu} U x]'+\^'4& ['~9|0&)ș); ['}s$[')WVgU ZYu K=O'tw.PmYtu} U؍e[^_]=O't+=0~'t"SqZtSarWV WVMUmZYe[^_]UWVS]u }`]'t4 u ti5\]'5X]'1ZYt 1`]' }'t =d~'uVuR=<]'`]' 5X]'=\]'10]'4]'_@8]'1ۉ<]'i뷃=O'tH=<]' 8]'@]' (=O't<]'un8]'@]'ÀuWV1҉ZY%=u+%=tSl<]'50]'=4]'_1%ul 8]'A8]'@]'9Ph@]''l[^50]'=4]'th@]'lWV@]'. 08]'1ɉ <]'<0]'4]'P8]'1҉<]'8]'=O'uufe[^_]Ã=<]'~U0]'4]'1҉<]']1UWVSQu} EE`]'tt t5\]'5X]'1^XZ]'tl=}'tcB';x]'p]'x]'t]']'Q}'B'D;x]'~ }'=}'uB';x]'~1N=]'tx]'@B'9}Թ Qۃ=B'tt =B'u =0~'u 11Ҹ *=B't&}t 1Ҹ 1Ҹ11ҡ]'e[^_]UVS]]' ]'ށ9]'~tu ډ@[^]UE]'E ^']USEM =d]'t)=~'tu ~JH1҉ ;\^'9~^']']')Ћ]']'[]d]'1]'UWVSQSMQyq uu RPG\ZYuh[ƒt1ۃ tt 't[8$]'H9UUt Z]'[C뮋 ]'t ]'teY[^_]UWVSQMQyq 19| RP[ZYu$]'X]'D]E t$'u}tjU$]'Et ,ZL]'UL$]'T1;]'r H$]'E)K]'Uz11҅t ]'ىt $]'eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQjPhUt!SMQPEEP*E1jRjVE)E뜉+E)Ѝe[^_]UVS ]'1 ]'SutFjjP t ]'@11ҡ]': ]'e[^]UWVS5B'B'j:Y119=B'~ !AtRP x]'9}G؉5B'19|)e[^_]UVSu E!y=VQY@ w>uV&S8`XZ1jjVM u뾍e[^]UE1҅x &]=w't&w'tUSJZ P+JZ HX[]Ã=p^'y-U=<~'u Z'1<~'jhA5ZYáp^'xW@dp^'UWV1ɉ p^'5h^'=l^',9Ɖ}jh5p^'XZe^_]ø^' @=@w'u1@w'w'^'t^'`w'w'w'w'w'1҉w'w'w'w'w'1ɉ w'UWVS EE} MEEw'w't"C 9Ku}9{u E9C֋sw't^'t w' 1t^'ЉpHMH MHxC;4-=t^'u`w'PHE8}w't'Xp9ډ} EӉEEډÈ}tEt^'t^'@B [^_]ÍL$qUWVSQQEU=<~'t E]!@u 111]9؋]ع5w'w'tF U9V}}6E9F uE9Fu N^*h^'l^'1=p^'w'~t-uF"Hh(V(h( TEj舦C'j9jWjB Ej by u$ Xh#Xu>h:tu R5_UVXtˋURUQHÉ<$GHL$QMt5蔻WPURhMQS5? Wy_urVZ5YSV Sxj( u` u jVj8}t&u'h'X,j &u& VCZ'u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jhhES YXujhߤ,XZFh&S&h&A%j 8jUjj XG}u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuV輺 jj Fj`Ujs7BZ'jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw kw'GPw'kw'1|''t'|'#tUEEPh**YX1ÉUS.w$tX|''^\B'w'1w'w'w'w'tPuX1w'w'mNt jhgB'K \B' w'w'w'w'jhw'{/\B'w'w'Y[뉉txux ujh 5)XZ1]UVSw'1۰#4t'5t C'Ca1ɉNF FFFtPuZ1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5\B'sS CKCtPxtZ1Cw'e[^]UEt*xu x u]?@ @w']U Pu]jEP-UEYYut@ \B' |'|'|'E|'|'tPsZ1|'w'UWVSPEf=|'uJ=|'uA=|'u8\B'|'1|'|'$~'|'|'tPWs_15|'{u#jPs蓾Cs-s1ɉKs {SC;\B'u RWV UP號ZUte[^_]UQMt\B'9Ptjh&XZP@ UVS]u \B'1k9w'u$9w'u9w'uPa~#4t P'@5u1҉[^]UU19w'uǀw'ǀw'=u]UWVSu薾[1w't:PPV,E uEw'w'q1҉w'YSqXue[^_]Ã=}'UWVSu h9u;w' C Suu|'ue[^_]j }WRP` su sʽXh*VpDZYtVWsPh/uP;UWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=B'E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtPipY1Cu,CZe[^_]USE] =tS_,,B'XLt1ۉ] E`u=@%x1ɉM Et^S*á,B'ZtPoXS茫P軦,B'So5,B'K]s@=@%y1ɉM E]J#,B'EEPh4#XZ]0B'#&x$Ujh@BRPB'RP$~'USEtzE 8.MU u4@E QhnNRY#& }t jh}QhnNRC }t jhk$~'#&a#&y$~'EEPhӥ>Phj ]Sq4SM=~P|0uD]EPh"XZ]á#&x$Ujh@BRPB'RPh~'USEtzE 8.MU u4@E Qh-R<#& }t jh"}Qh-R& }t jh:k~'#&a#&y~'EEPhP>Phj ]ST3S0<~P|0uD]EPhl XZ]US] }u!jSŽYZt]EPh XZ]US] }u!jS^YZt]EPh XZ]UWVSUE t tP(|'^w=}'E}'*}'*tRGYEEPh^XZ]UEtHw1E Ev]8B']U}u=}'u]g.]Q.]UEu=}' M}']UEu*=}'~!EEPh }'XZUEu*=}'~!EEPh}'XZUEu#=}'t=\B'to5Bu @u]]UUE t#u?#&^u2@t+#&!#&PJFEEPh@ US E1ɉ }' }'E 8,t)EPh\E P }t jh3}'E 8,uf@E EPh\E P{ }tjhXZ7}'05}'5}'h j]S(]܍EPh/u]UVSE] J1 RD+~vQQ r/d~Q wG$x* t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPhL1CSPh}'Y}'E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPhgXZe[^]ø= ~'u=}' 1=}'á(~' B'+}'UWVS }8uMEPhzY[1bÉUP/$@PƋUXZt=}'t <\u {t C<$ut PWZYtFFC؍e[^_]U@uPhj*h }'C&PRhj*h }'+& }'UuBPhh`}'`}'UU1t 1BS]UU(4t B tB]U}ou<¸`u1]1=}'U}'.EEPhzKZYUWVSu ]E0`_18-u@JЀ v#tuKuEPh&j uP yu˅tӉuEPhY[뾅t1҉t؍e[^_]UWVSM}'tFPtu)QjP_XD}'ZjPEP 15}'1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7%Z9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]UhMzYtP~Z~#&øU =~'u[h~'~ ZtL1~'EEEEjEPj% M9 't'_k~'';EMMEEE=~'t=`^'t=}'u#&=~'tuPjEPm EufE=O'u);>#&9u '&P\Xʃ=}'t ƒftըu1ɉ ~'uu u 1҉~'=O'u&u~'@~'~Fj.Y<1҉~'y!$/8m/8#_M9 'tu1 ~'Ujh~'I} UQEPYEUUWVS.0[u"É4$"|$WVuh"WP؍e[^_]US]S[ZuSh]h~'讠 ~']ÍL$qUWVSQ Yq AQEU}WRPq1 ˉE؉UM܋EuƉeWuuRPԻ u؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEP XZUS#&'t,#&'Sh'5#& 9t Z']UE#&]Ã=~'t 1~'s U=#&'r|#&P#&M1~'E]UVSP't Z'E1~'EPSXZt'u> E~'Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRP K}Њg u؃}yC-^Su.XZeY[^_]aTUVS]1)EM}IguyA-NQu P.XZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%~'e[^_]US5à Hw ot tSRX]UWVSu} ~'ouWV"XZE e[^_]$=}'u`~hB'WVh#&nB'\B1s9B' Z'e[^_]@UEU E Ex]UVS]u .uu ]e[^]#&P-ZE E؍e[^]KUS]tu uR4=YZtg=B' Z'j ZQuj>X؋]UWVS]uE %=@~'t >t:S^$PKfPjjjjSPwf$9twV6JXnjjb1=@'1҃=4B' PSW_pÃtWI_}t-jh[^tP 6IZY>1؍e[^_]US]tP 3IZY1]U1}]UWVS|}ue( u V[E E@~'x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu§ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$E<:N<%<.uFu RPY[ +!@ *u5\B'蜋_vG9^.1u؍U؉ƋU؍C<6$t+  ,'1Jk ]'RY19}' B'{9)ISQRP? [u  u11ERP[_19r B'+ }'ISQRP 1(B'N5\B'5\B'P5\B'PDwS? x(t u(5\B'pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ@'wt,'1&t E;5\B'KZtP X@=,'@'@'e[^_]U5#&USh~'=}'t¡#&u 'PE1҉dB']U5#&*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tP;Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH @~'@'13CPD;1ɉK^։UR% Z9Us&RUjEP!PP<Utܺ1҉S @~'t @'SuWV>ƒx6Ct P:1CZV @$jCVP{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]M'uU5D'Z1=H'UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} Ul'9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5L'jjWuE)PV5H'5D'$'e[^_]1D'H'L'T'UVS=Z't 5'}uuf'1ۃ=B'uDSgYuu CB'H9RPSjY wyr5'e[^]UWVSP%ET%E@u }H%EܡL%EH%L%P%T%=B'u e[^_]=Z't11B'H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v 4V4ZY1CCC ''''e[^_]Uhl'XUS]D'#t-=l'ujhžXZ]1=''E]Uh\''XUVSu] t1ٸ\'t;pX[^]UWVSEUE|E xB'p$lB'h5$~'uX'tXsmSo+Zjj1CCCj y]e[^_]/+X'CX'Z'e[^_]U€u1=X'1]UWVS4''EU血''E܉UtE؋M܋]MjEPjujuuu $''u}u܉}Mut}9Nju|M܉]E܋URP ZY''9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EU裈''E܋Uࣀ'',jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1'=}'u]]USj5L&#ZYt8jٸD'Xx =}'u='uS1]U=P'u @~'@'D'L']xUWVSU EEt :CM@tE3L' s+jhEu jhž=}'=~'=}'1ɉ 'MMM1ƉӃu]5$~'+PXZe n=}'=~'jh_XE:jx^@='@1ۉ'.1EPMD'Zx}' ~' j1'#X=}'t =~'TƉp~'u}tpB'xu }@u}uQB'HEP5$~'X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=B'}W؃&MxuƉYjZGMEPjEPjuujjE Mt=}'t =~'tZ}~TJEu2EUutjEU9u9t5$~'RPy =}'t =~'tjFXEe[^_]Uhj 'XZ=~'t.Uhj 'XZ=~'tUE]Uhj 'jjm=~'tU}tOhjaYX=AZYq. STYuNZ<lj4$2$L9QZVh$Pi9tVXh݁W\ W f;?SDYSDjjщ‰#&#&P#&' VhP  th='t&tV^ XGP$_t u Ƅ@t V [ u& u&DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBV] Zt1'''%#&#&t''1e[^_]US#&h/SZYuwh5SZY¸t_h<SZY¸tGhBSZY¸t/h*SZY¸tjS跎 ZYxP苏 X1]UZu E ‹E2ttHu jhHjhUjhnXZÍL$qUWVSQ 'p x tWV虛ƉY[jj1EUXZ'uBEPEPWVNE؉U܃E EtEU}u}ujh=Y[=<~'tuuuu誗=0~'tEUju4P4ESj:jEPuuS"4(eEuSXZEЅu u؋}eY[^_]aUWVS' ']11~1t2#&t AFKމt ' '[^_]UWVS' ']11~1tr#&t IFK݉t ' '[^_]á'á'Ë'tUrIZøUjD ZujhQ ZYyjP ZYxU']øURSjEP5'hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPZ1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV M9u"9uu uEZYe[^_]UjuUjh'V= UE='t&uf=|(&tE]'@]]UVSP'1=0'ud'1(hAjXZhAjY[h'}< ^tTjjXZjjY[h!^'u '15|(&='t j[P ֋5T'$&t,PVZYu'8@1ۉ'Z8,t@8u݋8tH5X'R'PZY'@8tSXh݁5D'r^Xuc5D'h?1Y[S$S5d'I& BP5'&P^ZtbShV NhP#^Zu @׀8 uSYοhkP#ZYt @׀8 uSXh8t%8,t8 t@Ћ8tH5X'R'PY^'t SZ@'P 6Pe[^]UD'jjXZUhj~8'XZU!@'jh '_9 &Q &y ;0&| t&J &Uh&PXZUWVSREƈEj}W5d'$ f=(&tk18'5(& jW5d'T jj =8't.V]"Ph| Ktjh'5d'# 럍e[^_]USQh[jjVjjM| .~Åt4EP8 Z9u< hjj jj]jjjj(&j/SJ څtPjRS hp&h=chj hp&h=ch)j USQjh(5|' f=\(&t#<(&;tS$S5t' jh5t'ց jEP5h'ł }nu5<(&h4XZ]USPjP]ShF; t=<'u)(&S肰 Zy ShLZYhX]US]j5X'輂 SP t Sh`pXZhewjUS(&t$;tS$S5d' j` jUS(&j/S葷 ZYPujuhRS ]UWVSUu 1Ɋt< uB< tЊt* xt t9tA8uˉ[^_]9tAW|$wUWVS$}EԋO_,$&uVRPSQix M؉M 0$&VSQRPKx Ɖ׋]؉]4$&RPWV=z ƉEuhXZTu&tO t'Ee[^_]g_1HssP4 $&RhnOuUWVS]S$S5d' 1ۉ@'jh-5|' jhx'5h' ƅ jP5d'W jP5d' =0'!Ѓ uh'jjK h '3 $3jXZjRY1=@'u=jP5d'9 =0'҃J"=@'u)uRyY_uՊ< ttJ< uf=|(&tFVhwXZ)9='&:WPu } 9th{_@'VPu O} 9t h{^f=|(&t$jLQ+$Ph h 'jj jhx'5t'| SjDXZu ~ Ye[^_]UVS hVhZ P [thwÅyhYhVh t&g~ \~ j S} A~ h3j x5|'&Vjj ] P1 Z~<9u6jê } j Vhjte[^]UWVS]ujh-5|'{ 1D'hjEh'jj jhx'5h'I| t@t PFXd'f=(&tjURP| P jBZ _XjOEU^111ɉMKy!SEZ=D'MuCPE=D')uf= )&tm[ƃT )& ufuE 6 u, fu'f=l(&tj ^EEu ft EPY} tf= )&0f=|(&tGWhwQXZf=(&18'5(& XjEP5d'z =8'=D't jΠ X,=0'#E (&9uj襠 X< tf= )&uj Y} u*j}MƉSujf=|(&u>E tPE Z+u}f= )&t WVhWVh jhx'5t'x h 'jj e[^_]h)X UWVSEhVhF 'jh-5|'|x jjjjh'jj (jhx'5h'Gy sà yhX11ft#j?LƉXP- Y~G9uAj5d' j jjIjj@V Vh.jf=|(&tjK)RPh@ejhx'5t'w h 'jj> jj jjXZe[^_]UWVSE[hVh 4jh-5|'w jjqjjhh'jj跿 (jhx'5h'w +rà yh)X11st#jJƉXP, Y~T9uNj5d'聥 j5d't j諜 jjjj$VVh.jf=|(&tj_J)RPh@jhx'5t'v h 'jj̾ jjf jjZXZe[^_]US,]S5d'7hu 'u M e 'Sj5d'U h 'jjG ]US,]S5d'ɭhulEu %ESj5d' ]UShShJ S'E'&[tE'&jh5|'t U(&tU(&5(&t5(&5(&t5(&f=\(&t_(&t$(&f=(&thhuY%)&t%)&,)&'5)&t5)&jZE)&t$E)&f=L)&thhX]Ujh{t 5d'jS jhzt 5d'˿US]Q1urjP&u XZ]US]CStu RZYt1]UVSEhYPZYtP臢 ^yhoG[PhdhPg ƅul(&uQt $t Xx Zt $t 1ɉ $PhSS j5u*h'lFXt X~t X1kt $h '4s à Dt XP' Y9u tthp&hlRXZ댅yhW9ExuPh{uPhhp& Cƃ ''8 u = 'vH@ 'e[^]USErjPh'h uxh'hhPor \'yh'h`ZY?hSh t h' X5|'&5\'S ]UVSjPh'h] h`'h'PY[vEe[^] Hu `'d'5d'hhPq Ãy5d'hXZ+5`'hhVhSVe[^]UEjPh'h uXh'gh݁P? uh'hXZ)j5'&P f=(&ud'Ed| UVSjPh'h h`'h'PY[vEe[^] `'Hud'Rh݁Pà uVhIXZ@d'f=(&tPh3Ph;hVVhS e[^]Uhp&hiOjcUWVS}<1ۉX'l'8'%1u~11Ejh %&hu u ='uhp&hNjt&`'FtrE96/ kU DЉE8'뉃a$. nEtPt=91WYvh^Z?9591jh 2V jh%2V hcVb^Zƅhjˆ 91hH{S9ZYkhb5S$ZYLhcSY[Åh뫡91X'91P'Em=l't hs91j/RUYZUt l'5Rhhl' EPjhjjjj5918'U P591hR! 'tehtM,'0''='1vldZR&E)t8HuR}t h=KE h.RUYZUtP'",'0''h%jh%jh%jh%jx 58'hbj h'h'u hg@u hvjh&諠 EXZtKthH{ hb5hc Xt 1N11҃='1(&L)&='&1ۉ|(&='t ,)&=,'t58'' Yu.t hj=,'u"58' Zt58'hj膅 e[^_]U'jh'M U4hJj.EXZu2EZt1'=,'u!ujYX='h' Zu(j 茐 ='$uj ZYd'jd Yd'yuh&=XZ'Y='LjP XYd'tPk Yd'!URP=XZ='uM@EPj5d'z jh t 5d'襴 jjYX1}UWVSS]='uh藣Yu hj܃ hzZt8/t PJXx&&|&&Sht&&EPƃ 1=l't6l'X'<','10'=8'u'8'%;/u%l'jShY_t4't t u!hShvXZ hh_j4&&9u QRP &&Euڃ=8'u h8'hzP @u 8'%h4'hu @u 4'=0'y150'=l'u\)j:hIu虿 1҅‰0'l'uShL"t%=X'uX'=P'u Shdj j:h}u? '=,'u3X't0'tR5l'GZY,'<'j:hxu޾ t (&j:hu达 t (&j:hu螾 t L'&j:h3u~ t1L'&j:hqWua t \(&j:h}uA t l(&j:h?"u! t |(&j:hu t1|(&j:hau t (&j:hVuĽ t1(&j:hu觽 t  )&j:h}u臽 t )&j:hug t'j:h,CuJ t L)&='u 'h&&=$'u $'`&&('t Ph2|^_ 't Ph)fY['t PhߩPXZ't Ph:_Xh'hHu\ @u15'h 'h&u< @u1ۉ 'h'h}u @u ' l''''tj,S܊ZYt@l''؍e[^_]USbPhhp&>Shhp&.jU=t'tht'htj jU Đ&yh&ϰZuj&P&=0'҃ !Ujj<'hq jh' Uh 'jj. Uh'jj U E E1ɉ <'hj薽EXZjj舽EYXuhZXZh'2 YtnE sujKYXuj?XZ=<'uXE M9Hh&袯ZtU < tU EE9sE @E Đ&xˡ&P&UE Mtt @8u1]UWVSu`'`'FVtI)~@t8u\Q ^@P u f^?봈@`'[^_]UEP^vP'^?<tP@Q'R' P'Q'P']UVSEPhֳXZ@$&;t[Ct =T'uG'&PPh裳sC <Ƀ*PZVQPhw 렍e[^]UVS,u]S5d'bVSm VS'm EԀ€Uԃ='t̃Ef=L)&tMẼeewfEf=(&t %‰USj5d'B e[^]UVSuU ]=0'tSRV\_ y@19t `' @8u hEe[^] 3e[^]UVSP'&EÉT'@$&t68u-Fu#EPPhSV1%tك 8]tjEP5d' Íe[^]UVS<)&t8u#L'tPT[uU\L'<)&Y<)&hcSV^Zu0'10'hb5S/ZY…t[hSY^tVhFmS ^ZtNhH{SZYtShhp&hp&融1Ҿ11Ҿ 1Ɋ%&1 !`'Aue[^]Uf=\(&t'tPXjUjhx'5l'@] jhx'5p'.^ UWVSjW5p' ^ ފ< uf=\(&u"0U)څ~CCjW5p'] ǡ'tPV_9u1ۉ\(&ƅy0h V 'ZYu ƅnƅy\(&jP5l'\\ e[^_]1f=L'&L'&UWVSjj茷jj胷hjwhjkx'fDžd'fDž 1ۉjjP\ ~Ft=jhx'5x'\ ~$x'!S 9X<uY8C L{ t VW荸ZYtAEPuWTYVWWC Zu h Xc9s ts tC Ke[^_]UVSá'H!vd3VY''Swt^' &H &x&&P& 'P'"~;0&}h&j _XZf{ u<@' &H &y;0&|&P&!h&j!^X3h舫Y[{Vhy'C ^ZtaP;'s VhL>Vh?'C Y[t'PP賲'$h  ='"~1'hq Ze[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]hѣSе^_ug@'&; CteE0ƅUB@t0YXTu/Fhp&j lXZe[^]UWVSf~&fuURhht@P Pu fEfth\ 1 [ =tIt>UQM誩Y9MU~ /QRh hp&认ÃThp&j 諻XZe[^_]UMPPPhthp&ow't@th'XjuUhth/ hqh芪̗'UWVSSt Éֺ 1 "hh/ hhUu :u!USP׬ZYUu='e[^_]VSh蚷`jbUEuhh/ hh@0h\1UEuhh/ hh販@0h&1UEuhht/ hh|@0h 1UMuhh0 jThI11f3A@=uUVSEu ]uhh0 j`uhh0 jaht0ffPh趟fPh袟fe[^]Åt$1ɀ8u"UJRPRP! 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4@1 yZYt4G (uhChZhhp&E D1 E24@1 h]Rhp&C uhp&j _X<sR@8t54V @W訥$WV VEP MU1e#sj@HEP7 susuh裝uh4薝uhA艝uhL|uhWoU$19D1 t@ uRho 4@1 hc?[^}tEPh{)ZYh0)uuh謳X,01e[^_]UWVS]uhh01 h{uhh01 hhƥ11{ uhh01 hWVhPsO u s h=ts h,ZY1=߶xt uh躲Xʍuu-WVhPsN us hEv노"=thPs hRS^e[^_]UWVSSljUQ^t#u uSuW[N Ãu VZHWI u uSVWxN 9uSuVg u VXV]벉؍e[^_]UWVS@]uhh 1 h8C@uhh 1 h9h{ uhh 1 h:߃uhh 1 h;ŋuhh 1 h<뤋1ɿ 9lj}Ph99|CƁ t!Ph记 1jjh V M = tS h fUtts hr蜙_X1jjPL 9u 9t-uRhPRh> tu@ku hMu hm󥍵ѶxԶx9t PRh`3u h7j[ Vh:iP1 1@uCPh{XZW-B e[^_]UWSÍ1Dž7hhhh h͒h8轒hV譒hv蝒 h芒jX uɋDH<1DžDž?ڋD1DžL`jDVd\hKҏh&Pl Vh:iHc @u)Kt&j.h&lj ΢1҉ 8t. h_jW ~hXhh@ _@v Dž@k@L19@EWhzY^t41 hΎXZhŽX19s~D3 PЍFXh, C PCPCPCPCPCPhy s hiKSCkVkVPQRPhD$sDhU4hz*s@ t hXt hXh, SH^7t tt% ntPh踍ZYGLe[^_]Ë &Q &y ;0&|< t&J &Uh&PCZYU2PPhhp&bj'W|$wUWSˉ1҉'M]m (h}fU fUm]mURp pSQh-&0hhp&$e[_]g_UWVS]E }܍p(}p4EPS Y^tShXZe[^_]UWVSPu} FM% FVFt5RPWF7 à tFɘ1ۃ8t/h-&h[XRPh-&M6 à tŁftvW7 ZYt#/vh-&96 ZYu}u2}u$h-&hY[}te='u\VlU1҉UtRW6 ZY@uT8-tRh-&67 ZY@u"~lth-&h0[XuVh-&VZYt؍e[^_]UWVS'dt2h-&h-&Ep4 d h-&!jjEp1 ` @Euph_X-xP='t ' 't 5't2} F='u:xPh-&[^@} 1ۃ='h-&hhp&Đ&HĐ& yh&}Y&P&0 t+@t( Đ&y h&}Z&P&Ѓ߃Yt`1 _(,h-&h!g`1 DždWxPh-&[^@t1E%=tEjhGPhh-&B0 à uA 5'uh-&hkh-&GPhh-&0 ÃtNjOGXW\X\t;X\E@hDžl-&X\ptX \TX9и\T<0XPjj`jjPj0TjwXPH X1ɉX\vRLP)TPS~- L9th-&hXXZDžd:)։1X\='tX\hoPTY^EphXZ='Džd1X\t~hh'`- ƃ ~KVh'S, 9th-&뎉X\='tX\htP`d. XX='u`M. XM='t#S`D Y^th-&hXZ`. ^du S. [z'dtSWLZYd='um} tgG t^'9GuTxPScY^th-&hiXZDžd$E9Gu'#G%PSg0 Y^uS[- Zth-&h[^Džd='tWh-&9ZYde[^_]UVS]hVs+ u sh9'Ƅ} t'h-&Zth-&hF[^.h-&V{- ZYtVhQ١'t jsPZYe[^]US]} th-&JZt h-&hFsh-&- ZYth-&h]ZY't1E ]]i]US]} th-&Zt h-&hF$s$s sh-&V th-&hhZY't1E ]]]U(PPhrhp&YjvU(PPhhp&9juUWVS|Ӊ΃=(u\=(tR|Y_u%=@u"Y|hXZt#h|VEv =vQZVSY_u%=@t=(u^VS_ZuQ%=@u?VN ^u趎?XPSh)hSz=΃=(=(|8/uVPZYti|hUhSWVuW{K t=|Ph)hWuyVW@t|hO_XVSZY=(S|=^_uS|h  j/|] ZY|tpj/S] Y_xt@xxVۅ_Zt=(|)~=(ix)؉t=9|u fDž.Nj|ƄPR ZYkx9Íu fDž.׉ދt󤋅tƄxPR^_|9;x9 ;p=(h&TUShhp&|{Đ&HĐ&yFh&Ds_H=(=(uS|-( ZY=(u&P&0t- t( Đ&y h&rY&P&΃߃Ythp&h =(t%=@uSfQ SZu4=(C1=( PSj|j\( tS=(u1#|(PShuw޸e[^_]UE TET]UE MQTU TE]UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]鋂[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_][^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_]鄁[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_][^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_]}[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_][^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]DZ[^_]USU EAHtRSHtG t uF u:] M[]9t=T(uyDutJt] M[]%(1 []UWVS(UL( X( $(01d@DHLP4TX\x|hlEE8jj h SQj]SA @u hjB, ShcXZ=5(FډWVRP =\(tRPQc e[^_]Ë &Q &y ;0&| t&J &Uh&PhXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPX(tvv RhbÃ=$(=`(tBjj hv\vXjUR @Uu hj* RWhMbà L (AF`VdEUQRuu =\(tRPWQaÃ<( 8(Et*=H(tU]Ã=(u=(tF%=@u FaÉ؍e[^_]W|$wUWVSEUEPV EZuEEC u=,(tECu}EUE؉U܋=(} (ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut'C  CtNV [[^]UWVS(]j&((X=(uEԃ}Eԋ@ ẼM AqP=X(tvv s h_=$(F`VdẺUЃ=`(tBjj h RPj}W @u hj( Wsh_ K (AEUЉMMuuRP {=\(tRPWQA_EPvV Eԋxvs$EPh_=d(u7s,h^ wsh^ =h(twsh@^ F%= u9N % 1RPs4%1RPs0h^dVXN\=`(t3jj hQRj}W @Ws(hF^ "{(=\(tQRWP"^=t(tF(V,= (tF@VDF4V8[<( 8(Et"=H(tMUF=(u=(t@uZF%=uE@ Eԋ@ 뗋,1&tXSh0j@$1&(8[)Ht u hjh jܛXZe[^]Ã=|(<=(1&/UWV5&wh>j薛XZ=((u6~OfEEEPhm501&= y(~uz1=(]xl15(5h(~SuOjjj501&<xFjWVRP )WV501&<x(1&"1ɉ (=(1& hmhj蓚XZ1e^_]ÃUWVSPE1҉P1;EE (1&(jjj501& <Ɖ׃xtEU =(uX(] \(9É}EjRP501&;y%+Vh0jК(1& )}W =(t1e[^_]ÍL$qUWVQ1y(1&I(u9h9jjj501& ;y(rUh00j (1&)y11҃=,1&~h]ZjRP501&:Uh~x(19}oMQRPWV U Uthj茘XZjfEEEPhm501&: yuTVh0jC'(1&1eY^_]aUWVS&=5&tp&P+5ȭ(=̭(X u1=8[)=5&Oh WV5d(5`(0 RPVhhW3?5d(5`(hhV?0WVhhV>}}t^=(tU5(5(hhV>Vh(h hV>(VvG$Vj =5&ubhT(1WVRP1 RPVhhV4>V5T(h"hP>0h h(l(`(d(WVRP RPVhhR=5l(5h(hhtW=05d(5`(hhV=RWV5T(,1&HP8[)0h3hPT=8}uV5Z)h"SAA%V F$Vj }*e[^_]Ã=01&y1T(((UP[) Z)t@=(u7=Z)t Z)5Z)hd5Z)@5Z)n=ܭ(tGh(501&"ZYu1(%=u \( X(u5ԭ(_1ܭ(X=5&w= [)t 1&~ jP YX501&7 1&Z~jURPz [) Z)t.=(u%5Z)hqb 1Z)5Z) 01&( (u 1T(1((=8[)t,1&[) Z)t̃=Z)tZ)J1Z)=8[)tg5Z)hUHZYuQ`(d( tjhRP jh5l(5h( RPh5Z)>j5Z)1T(ZYUVS ShZ)j y8Oh0jݓ jSj y Oh0j豓 5|(=$1&B 5(6=[)u5Z)h[Xԭ(hD1&S/GZYjh<1&SGZYU(C,1&uPSh覑h4PShY蓑hz艑5&whhh[5Z)hWhMhCh?9h SRxhgbSXFZYu5|((1&5Z)hb1Z)[^|tFu=Y ZYu+G/tZuQh(hjj膍95X(h`(V|@ /t#h`(CSVh(hjjK1e[^_]HyUPj :XZËJ UWVSE8[)xt 23y gy-8[)P,x8[)@0Ej蛵E܉UX=,[)tjyh(+a^th(4Ztjh(\ZYHtE=[)uh(3Xt,h(tp^Hth(fY1P(PvuEjj5( E y,5(4GVh`0j؋h(g1jh($\XZy EPh(=/h(hg =(/u(~<uh(;$h(h( t EPh(.h(g =Z)tuh(/ZYxċ[)t5Z)J~Puuh(6Ph("8Z)^XT(h(EYuyVh(X.XZt5=[)t=Z)tZ)a1Z)Vh(!.[^EPuh(8[)PDVh(-=[)t=Z)tZ)1ɉ Z)xMEU19|<(@(19}RP^ZyRPuY[xWt 8[)P4jhZ)j =[)tm]11e[^_]Uhh`(1Z YZuDhz0j} h`(9ZX(1Uur Z@tDh0j< US]S Z@ukDSh0j][UWVS|uu V躲_Z@uS/Dt< tNu3D8xPV?ZY@tE%=@u1C8؍e[^_]UWVy 8[)PHx8[)P xj,ƉX)P(Pw8URPh(8[)P@ uˋEU<(@(RPAYXh(WZh(g\Yh(iVZjh(XZYuE=(/u(8uh("7$h(h( h&WVh(2$&@tBh0jA '<(@(D(H(RPbZYH8[)P(jhZ)j PU 1e^_]UWVS4y 8[)PHx8[)P x"ixj~ƉX=|Z)t-55&% [tAh0jq =,[)tbcyY|1ɉlP(PwMpRPh(8[)P@ u!pt<(@(RPBY[th(UZt<(@(D(H(h(GZZu؃=([)txPh(裯Y[t[)  [)tkxPh([ZuT [)=[)t/t/(9EE(|/(9EE(|Wu(9EE(h(SYjh(dU[Zt0h(`<(@(D(H(RP  =(/u(5uh(>4$h(h( Z) Z)tgxPh({ZYuP=Z)t4=Z)t(9EE(|+(9EE(|S(9EE([)t1Z)J~PWVh(~/Ph(1Z)[X(t@t=Z)uPY=x5&t1P( wlPh( XZ h(@!Ylu_<(@(D(H(RPXZy h(^X=[)"=Z)Z)1Z)=Z)uSlh( Y[y;5Z)Z<(@(D(H(RPh(p^pPRhh(8[)P@à =Z)hu Rh(XZ=[)t=Z)tZ) 1Z)u!pt<(@(RP\ZY( x55&X8[)P(jhZ)j e$P 1e[^_]UWVS8[)x 8[)t!9t30hj葀ZPHx8[)P x=[)u8[)X t ^y^x[) Z)tW5Z)h5Z)+Z) 2h(UZt.<(@(D(H(RP$ ^_Ht#t=[)t4h(d_y#8[)P(Ɖ$]WVZYyuth(c^^yơ[) Z)t"=Z)t5Z)hqb-1Z)ZY+ÃujhZ)j' ؍e[^_]U=[)u y \y8[)PHx1]]UWVS Džlh 5Z)W " = w u}/t 5Z)hDh4~/t/CFtP5Z)YZy"Z):Shb0jK=|%=@t5Z)hj&~ @YA%ma=,[)u )؉h%'2\yDžlh(BSZth(&Zt[)  [)u#h(%h(XZY )P1=(/(PV  9hsh(hj3}tPW&ZYu [)=[)t:t:(9(W(9(u(9(jh(NZYy'jhZ)j 7`% 1ith(,YYSWh(O xݡZ) Z)u+=[)5Z)h(O*Z)XZ}tPh(YZu=Z)t;=Z)t(9(|(9((9(]T(=$[)t h( h(Y+P(tE t@wpPh(YZ h(Zh(WXjj5( l y8(d37dRh`0j{h(Wjh(XYy#lPh(3h(^W Rdlh(\ dy Rh( Rh(XZlPh(YX=[)~=Z)qZ)1ɉ Z)Ze[^_]US((=|(u 8[)@|(|(=~~ h~PhÁthPhjyKx(T1&5ԭ(CZx&1h(l((|(‰(( >y밉؋]U((=5&u>|(t5=~~ h~Ph.thPh\jy@5ԭ(Zx%x((((1`(d(1 y((T1&~x(~UWVSZ)t hjfx(=|(T1&u|( yI(+(EU EUT1&EEuuuu> u})׋E9ƉM}u}WVMZY+u}( T1&19}d( ((;(s5x(PY_(+(RP_Zxh(Ɖ5(T1&( ((T1&x(EU)`(d(1ɉ h( l(z5&hjwXZ؍e[^_]Ã=P1&US=5&uhjvXZyx1ۉ`(d(15T1&5(ZY~%((‰(`(d(1+P1&~C9}Ph"jTv yu뙋]ÃUWVuM ()ȣ(^_]UWVS$]CDž$$ x$|$x $=[)u15xPu ^_y狳1Vh?0jmvPuTZYud%1hH0j(vۉ15T1&5(u ƒ (9|Ru -WQQRu<9uUy%0Vhp0j@u79|$u9x$t hjtZPu ZYy,0Vh0jtNjE49}u;0th뗋9}3t)1;x$|$}Ru ye[^_]Ã=(t1US5T1&5(ZY~'((‰(`(d(=u.=8[)u(1$x1`(d(Z)]ÍL$qUWVSQ Q1ɉMM u15(=()9}Ή5()ډ tƋx(]؉}܍MQWSRP[ Ɖ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}`(d(19<(+(щ9|gx t%u؉}9}M؉]܋E(+u}뢸eY[^_]aUWVSU Ӆ~H(+(U U  )څ$ 9~؋5(}5()É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu Y[u]%,dhH0jqۉtE1҉P`1h9Ɖl  (+ ( } ^ș9hl}hdSpPtPQ5(u O]hlS} yE] Cpt1;x$|$5(=Z)0\t`A9\u\()hl} xdptZ;x$|$}L pN;x$|$^ZuZ=5&u#EUdhEl=5&u$Yu!Vh0jLf=Y)tY)sVhP$ $WyiJ!8=Z)u<$8$V y5Z)^$h&Wje1Y)$NF1҉$Pe[^_]UWVSĀlj։ˍxPQ聏ZY=([)t1|9Nu*;xu"F M9Nu;EuWh7j0d BE%=@u8hgbSZYt'S YyTA ShU0jdjSVZy-}tӸR tvvS uSWz ZYu1}tuSWhfRjxd둍e[^_]UWVS|]($1u(x$|$9ȉ}$9$U  xWVYZ@t$E%=@uVhjb KjAZe[^_]UE$tH $E] ]UWVS]E U$usPL YyVh0jWc=Z)u($=Z)t8k<$8$V =Z)($ttC($5($=Y)u(j Y)P Y)XZ($Y)!%PVY_5& 5&t%jjL$H$X$T$V$tG{WV觺 YZyWVh0jPbVT$B1$Y)Ze[^_]UWVS]Ct1$H%#($Njt1lp$H$`4 5Z)hZY=[)xPV蜋ZYum%=u[hRV u/tVh0j>ap#ƄWVZYp` `D$@$WV :WVt VhV P} ZYVh!j_ Ult lt)w$V#pZYxDžl=Z)tVh&RjD`뒉l<$8$VO lxDžl0=Z)u =Z)tCi<$8$Vy =Z)t#($tA$u($(($$u ($.($($tbYX$5Z)h*YZjV YZxPVAYZy+wthG0j_WV@1$H%# PVXZ=Z)u ($jZ) 5& 5&t[j $P3VA=5&u =5&t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSuu h_E18}t}t:|[)t[)E|[)6SVu譽 9u h}ix[)p[)Ex[)ҍCtPR:XY PM5Yuhoj%\XZ>CPVЉUPvEU 0j\̍<+E e[^_]UVSu] }u1NjjjVy ShjhY)VK ySh}0jt\e[^]UVS]u x@P, X=[)t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu  ~ pt1@9uNjt9|$up9x$thjsZ xPu NZYySh?OT$9X$u;t hjjju y$=Sh0jZp1$1e[^_]USY)tPl 1ۉY)Y)XY)um1 Đ&yh&3Yu9&P&94&uu%1S Y) t뭅u tډӡY)AY)uY) @Y)tϋY)zyP1ZO밣Y)j5Y)hY)} Y) &1]U=[)Y)=[)tY)=Z)t Y)@=Y)u'h 1Y)YuhjjXXZ1x[)t9UVSut>uh+j 91XuhFjXY[FVZH~ 8/u3E ؉C1C=Y)uY)Y)XY)1e[^]áY)t@= [)t Y)=[)u4=0[)t+UE$uY)tjP5Y)L US=[)t8Y)1t6{u+uhmj(WXZ3h9hp& [Ƌ]UWVS]=Y)u =Y)u$15Y)yx5Y)耞 Y)YtHHQf $|4 =[)tȋ@PURURpp p0;9xjjuuuu졸Y)pphj6Vphhp jW Rphp p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=[)L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPD y$Y)pVh0jUƄ  ǃ$h Y)pCPh Y)rP5Z)h t1Y)@8e[^_]W|$wUWVS<ÉUMMQEPu}j} 9ƉЍM}QhQh(j@S<ue[^_]g_UWVS\]uCE=[)uPh9V ue[^_]}W($] T$X$E(j8$ Ej<$ UuuPjRj4$Wh4V$ w'@$  R%PhF|$x$hQVIuEPhI)V4$Pw ShXu ShXV Vj ZYVXe[^_]UWVST]}T$X$uV($ SWVh`aQe[^_]UWVS]u fVfuPFZt%t0SRjP}W VW Cۉu ]e[^_] e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=[)!u%U[)hijMXZ1ø1UWVSSu] E}MM1҉91=Y)u0K Y)Y)9-u BY) &=Y)u" Y)QY)u Y)Y)1Ҁ=Y)t7tMM}E] ue[^_] E] ue[^_]J UWP+ZYtU:u W3h(x:u9&9}91@&W3hhp&}?e[^_]1UE E EE]NW|$wUWVSjEPSƉ׃EU E9Es 11M9ttuj,V@ZY…tUj=V*Y_DžUuhUj #ZUuhjJSm, juZ) Z)BZ)1Z)Boe[^_]UWVSQÍEPS` ^_u C #ƋE| t@E]Sk#ZuZ)1 KDe[^_]Uhp&h(蛀 j5&t 9tU5&Uhp&he hp&h\V hp&h3G hp&h-8 j/UWVSPuh[S6 ZYh[S_ZÊEhViYXuVh0jOJ }t/1e[^_]UWVSlj/E 0 ^_Z)t@E Z)hP' Y[dZ)Z)[)111҉U11Ejh`1&h=u uKzX$4 91|(591hd |(렸1P1&덡918-uxu1ԭ(Ejԭ([[)QЭ('B([)3Z)$15&=5&u->|1Z)Z)=Z)u Z)Z)5&c [)T591=Y1[)o,[)` 5&GЭ(8Y)91Z)#[)EH9~2MxPV%XZMuhjFj!EƋ91Z)PMЭ(1Z)[)Z)591EЭ(ffԭ(5&Wԭ(5&Hԭ(5&9ԭ(5&*ԭ(5&ԭ(5& 5&91Э(Z)1x5&1ɉ [)591"DZ40[)|Z)&E <5&umu}t Z)p&Z)&Hw69Uu }uj@ ؃kL4&8[)Z)nt HuZ)1ɉM`hkjDhP_[ZhSHZYGZ)Y)}tE^Mth*uZYE&t*h݁uKEZYuuhj D1E1EE^E}tESg%[hu{ZYuY)u@%XEjhu u@Y)t EtS %[EPu$XZ1ɉMEHjSu E&EE]}t EtS$[h*uZYt u1[=Z)nu2j5Z)S dE>GEtZ)>}15Z)jP$Y[yRFEMhSZY;GCjP[^u}uhP[Z_uh*SY^&uS(…u_h*SpZYtV^=Z)tShzFtjP8ZYy*h݁SXZuSBhRUZYt8jhUR8 UujjRZYMpjP؃jSu1ɉ P1&}Jԭ(t 88heCԭ(Zt 8ԭ( Z)11jh`4&hu u z$6 14&ă뿃91|(591h4[)0[)x91ԭ(f,[) TЭ('E([)@3$[)΀ [) 9191hp&h!t 54&h=hp& 5,5&h=hp&hp&hGHt Э(0[)91Éѣp(t(19| 591h<%thhSjV=X [)91ShcZYuP1& SyG P1&Yyhyj591Z\@D[)/[)Phj<j (1ۉ[)591Y591*ZZ) Z)@|Z)gZ)U1x5&IZ):91Э(+Э([) x& hp&j Y[{%E1 u15&Z)&nEE u5& Ge%1ɉÁ u5& 095 u 5&܋E5 _5&.1 t\5Z)hhp&l 1 AI!8 Phšp&Pp& 5&uu8[),5&v/t1jj} 4 &&9Em&9Ehj9ME MZ)PZy$j6j} 4g^_'&&;E|1ۉP1&e[^_]áZ)t PZ)Ã=Z)t[U8[)0h=jN9 tp0hlhp&5Z)hZYu1UWVSM11JqX?tCt*tK[t~=0[)ttjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puhj7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 5Z)h6[_Vh,6h\|6h~r6h W6hMWZYuhWJ[= u h&6Y덊uh6ZX<.uuh5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDhDj3|tHL@t<uDhghp&4 WDh}hp&t@th WD0 1e[^_]UWVS]t K΄u h4<\u FFu8uj Xuhj2^_DžoGjQP: t2hVP SVhjd2 W[띍V֊t\uF8t)F WSh j2YR賅Zu% Whj1$N1GtYuh= j% XuhR j0[^C31CV~ZC 1ɉKECE C=Z)uZ)Z)XZ)1e[^]USZ)1t6Cu+uh j0XZ3h9hp&4 [Ƌ]UWVSuZ)t$tS= [)u S1u=0[)uSu$t9utZ)}FP蟃Yuh j/C_Zt/1srCt/1ɉK;WOZC Hǀ?/uC C$c‹@t 9uBSS1ɉ$[:h ja/XZe[^_]UVSu1ɉ$Z)u,= [)u1=4[){C |/t[t0CuPFP3 KVPZuɡ4[)u '$tVZYx 1$e[^]UWVS]=x5&tjs{.u{.u Ct:Yt+EV*Zu@F0k NDоU11USY) w U$8 0k KDЃD=d80k KDkd-lBK0k sL1ȉBB0k KDωB0k KDЉB 0k KDЉB0k KDЉBR'W!Z@؍e[^_]UWVSM5@[)t!8$=1t4;t@5<[)t+<$=1t ;t@H[)1҅Pփ Ӄt] t)8pX$9T$}d$9`$XP ;T$X$}s;`$(td$89`$X|ItOP `$9xd$.tX$89T$X|tP T$9pX$} @&1҅‰[^_]UWVSQ]t:t4=@[)u3Ujh=&@[)_ZUuh j([^#t.\u{#uCSYuSh j( ʋXj jCS à =1@[)<7t 9t&@ujfZt p h1 b1e[^_]UWVSQ]t:t4=<[)u3Ujh=?<[)_ZUuhT j'[^#t.\u{#uCSYuSh j' ʋXj jCS à =1<[)<7t 9t&@ujZt p h b1e[^_]UWVSut>u h j/V観 [_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh j& TE@jXuh j&Y[0t;u GM1GtAt0yVhY &O}thE8t`W yuhu j%WqbGƒWt+G 9OG}Vuh j%W:1G=H[)u=H[)D[)x=D[)1 h e[^_]UWVSM=`[)tPÉֹ=1:t9pt@9u9U}tjZUuh j$[^1p1ɉH xe[^_]Ã=l[)u1Ujh l[)YZt1h j$XZ1UWVS}l[)$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujYtGGPwZt0 $$$CSEC ECECEC1vSOYh5 j#XZ\Uh 3 P 1$$CHCUwC3S[^e[^_]UWVSMl[)4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3@X]e[^_]0e[^_]UWVSS=l[)t51ۋ4t#1ɉ v0EEPXZuC u͍e[^_]Ã=h[)UWVjhGZh[)_ZuhS j"Y^C~ =Z)5Z)5&Z@u"5Z)Vh 0j"5Z)uX1e^_]1Ã=d[)u1Ujhd[)YZt1h jp!XZ1Ã=`[)u1Ujh=`[)YZt1h j3!XZ1UE$$ $]UWVS(}=`[)$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAjX11q $$$AQ C AK 1St$P[)T[)P[)T[) u+P[)T[)M!u!9u^9uZtLP[)5T[) t:UjSZt+UM܉HUPp K HC $$$3GPhjhOj$P @ $$$E؉,$Eԉ0$1e[^_]Ã=\[)u1Ujh=\[)YZt1hjXZ1Ã=\[)tDUVS1\[)0tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ \[)=1Et#؋M9Hu9p u M9Hu9xt@$uj(X҉UtMuBqUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!RXE Ee[^_];e[^_]UWVSEEE EM}\[)tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3BS<XZ1e[^_]1UWVS]}E=Y)t";/tPS ^ZuShj$WYuShj. hSoZuShj ue[^_]GFG4W8F VG(W,FVGlFF X[)F5X[)e[^_]USX[)tvCX[)=Z)u{ t s3hXZ5& 5&tjjssss 3輲=|5&t s3YX3SX[)XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=h[)FhGSPl <9tjww 55&:;Wu;G t h7*SR55&+{ 9؍tmhO0j SR yT$X$G9__W1jXjjj55&聻G WxNS55&z 9u)T$X$GWh[)W8hg h0j7 WXhj#ZYe[^_]UWVSQd[)uhjXZohu u Eޅt6uY_tcvj ^t;uHlƉYt#u7lGZt _E81QVXW _hja[^0^SuZYtSukF_Zuhe[^_]UWVSu} d[)t=h7V t&3VZYuusVE [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=&ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh7h S蜽SyEVh?h S|Sy=VhJh SYSyVhXh S9Sce[^_]USSˋ t%RQPǸE31U1ɉ EeveRu P薸 ]URPhcjUjhoø1҃=[)t1UME1҉[)1Ҁ<u=Bu} u,J=[)t[)1҃8]UVS]} ~;uqjhP] u%=5&u 5&hj0ZY15&jjPƺ 9؍e[^]UVSiÅ3hVZY[uh7SZYt)SVhjh7hhj 5&vSVh*jt[)o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVht[)|[) x Rhp[)x[) U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$8 =[)t_hPj hyhhŃ d~ Ph뮋p3Sc~Rh땹1jdRPq1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEPjj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 th$%$1$Z)  Z)t54Z)=8Z) T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh3e[^_]11UWVS}} ?jhV= ÅulhXVY^¡[) [) u[)h`j XZjjPƺ 9tPVhj ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPW躯z/@E K<vM E)Sht[)|[)} Rhp[)x[) } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)P yjjCtP͹<$ ƃ(8$P P ZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2j8$ j<$ Ãuj W P艀 uj S)Pn1jjtDhP莕ZYy|jj ԕ[_x졌[)u$  ЃH5[)PC¡[)1ۉ[)[)_Yx)ЙRPnZYy넸e[^_]UWVS$ƍ@- 1U ډe[^]wUWVSu>-u~t2h݁V4_Xu$C0BPVhaj[&1EPS  ZYt/G}vEVWhtjEUt&u1 SXe[^_]á[)t UU RuP 5[)UVS]u F5[)tRPSo tD3j S;}ZYu1e[^]US]}t Z)Z) [)t=Z)thp&j 1Z)ZY5Z)h?hp&jSu hp&Whp&j h ]USjhQlV Y[xEhEP辞[)YZt&h݁S訞[)YZt135[)艡ZSW X=,[)thQhj ]UVS] u}t Z)Z) [)t=Z)th&j 1ɉ Z)XZ5Z)h?hp&lVuhp&Y~SPhhp&Ahp&j J XZe[^]U\SPhhp&jȠ[)U6SPhhp&j袠UWVSƋ=[)tPhhp&迩 =[)u ЉˋQtjP+YZt8tɍEPsa XZ=[)tVh? ^Xjs/ js( g} uVWPREPh2hp&hp&ɂĐ&HĐ&[yh&ˠY&P&؃t- t( Đ&y h&藠Z&P&΃1Ylje[^_]UWVSAօu9VP'ZYt&[)h+&^_F%=t1jhAS @txP#Y[|x^9|u,;u(^9u;F u%=t(/DS Zjjj耝  ׉NX^\19ȉ}{ 9}Dž 1PP 9y+{tP IR ZCjjj诜 ' NX^\19ȉ}{ 9}Dž 1PP 9+{O xQ Zrjjjޛ VNX^\19ȉ}{ 9}Dž 1PGO 9+{N P Zjjj NX^\19ȉ 9}Dž 1WtO 9PPW# +^M O _jjj# ~\vX19}p1҉ u݉19} 1QPM 9u#)5M O [@H[)h9!XZVO Ye[^_]UE @E E@E]UVSutYSC t } uC\)@\)RsS\)H\) u\)te[^]UVSu\)@\)[)؃8t VPjZY|\)u \)u\)t e[^]e[^]UVS[)1؋tJ9tFjPZY|\)uԉe[^]UWVS\)@\)ƍP辮Y11ɋ[)tx?tBA'u9t h \)u\)th jVS k19}Vphp7&HQP yPH7&H Z J GS谮Xe[^_]UMtA'1[)]UWVSu^Nj7t#vuשY[Åu jWXZ ׻؍e[^_]USh ZtaujY1"4he)tP{ Ãhe)X؋]UWVSP}U UWRW"ơ\)@\)$蚬WάC1҉S UR转C\)H\)u\)t e[^_]Ge[^_]UVSuV[t#sV轨ZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY1he)8u&S;u0h57&XZhe)Phe)uj=CP~pY_uyjS5_ZDžuSh57&m Shtwn7&xWP yP7&H YlJ ]@PS3XZKe[^_]UWVS5\)&DCtWjEPV贚\)\)] E :MAEIE uV)PRhE tK\)|\)CE u)BUP謪\)NjU󤡄\)Xu,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^\)e[^_]U5\)PhXUWVSQ5Di)|\)Di)PÉ5Di)^=F7&t xuKt;u1҉jEPSӗƉ 8uE8t+ث8t`E  tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$4:  u !AuEU Ѹt݃} uWVuu ? WVuui@ &MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=\)%us Љ UUEU=\)&t wE\)\)S1 VVڋExYtEUe[^_]UWVS(Ɖӡ\)\)EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh'j]SjSu e[^_]US7=\))u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HI\)\)SuЉE뭃$9 "tFكPE4EȉU̸=\)#4EEЍpًt(SEȉŨwhf\)SEȉUYEȉŨw><\)ƒ}'u1EURPh'juV~jV3EУ\)\)\)S]U]\)\)SWڋEXY E1ۉ]\)\)SWڋE ЉE҉UXs}t V\)\)˃'u1ӉMȉ]SQh'j]S胑jS5\)  똋M̋EȋEċ}eʍe[^_]g_W|$wUWVSEUϋE܋sá\)\)EUVU)\)Kvu^*l: 8l: |u0VQ{\)YYuRPUMY_Kwl: 9M~ ߉EUce[^_]g_UWVS}USƉ׋ \)AZwSjƉXZ=\)uJE졄\)\)MQ1  SUEY 1ۅÉ!1e[^_]UWVS}USNƉX=\)uJ=E졄\)\)MQ  SUE X1 1e[^_]ÍL$qUWVSQ q}W5\)XjLPdZYt5xIu,xNu&1҉Uj P{dZYUtB@)։5\)@뽉\)\)m1=\)t EЉUWEЋUԍeY[^_]aUWVSRE} _6&6&@c)@c)HO;t(@c)sx&P ωʋ7@c)tx BMסP M҅xJ 軡H+ 6&QОX5Di)SƉRPhk1 e[^_]Ë\)Ѕt /tt@1ɉ \)HUS]u1Z;/uPhgb2ZY@tEPS#ZY@tҋU9u;Eu3E3U ]UWVS}VVPض tS覝\)Y]e[^_]kSe]Z8"u뺅uJ0IPh< e[^_]UVSu=\)uE=5&t.1҉5&hSuPYZtS\)Xue[^]3e[^]UVSu4t =\)\)tPY\)@\)\)\)1\)jR\)H\)Zu\)tG =\)t,j5\)hPLj5\)hS:jhS[^1Vc@$]\)VP莣 6&6&@c) >/t[5\)>t'@c)H@c)FxFCXVԀ~/u#@c)KhMVZYu$6&9r :ƅuh@c)K;/u>thgbVZYt @c)x/4tX/ gXV>t@c)H@c)FxފFC96&u @c)x/C 'X/=@c)u@c)\)@\)\)tPX\)\)56&Ӛ\)j5\)hP j5\)hS \)H\)u \)u@e[^]UWVS} ]\)@\)uf Yy \)u\)tuj;ơ\)H\)Zu\)tut hW Y4u1-=6&u =V7&t5\)h9XZuÍe[^_]UWVS6&hƅdhcYt jh tZYt܉lddjStP.+p p轘xPp  y5u藛8t荛8pϏ@$ɗlX1뇋E%=@t3op蘏@$蒗l^EhuSp蓓ZYdPp yZ8՚8p@$lXWPlhe[^_]UjU\)ZtjPhSq hXUSLhAYthe)8th^t>h[dW豑ZYEthW蝑ZYEuEE1}}FHπ\ut}tnxP0tB<wV$: NE1>: 6 2 . * &щǍ@0w\9Eu}7&HyP7&H X JF>/7&HyP7&H X J }u-7&HyPP7&H [ J 57&7&fBYtfBhGj(1e[^_]UWVS]u }7&t7&9tx u h7&X\)\)u/Ph?h7& \)t\)Ph?h7& t&WVh7& x0hSh7&ZYxSPhh7&7&HyP#7&H X J E7&e[^_]e[^_]U塸\)ufU\)jPS UU 1\)\)@\)tuRj u\)t \)U1\)EEEEjEPj/ =8c)t=6&tjQjj萊j迋 U=])u ])E Puj:UEPu u(UE])jUS]]Su 0uUBuu 0uUEPu juUuu j}uUS] Su0^ ]UՔu u0A UE Puj+ Uu uj UM; ft9uPU t@Qhܛj h\)\)á\)UWVSP\ YuOƋjjPR/ ǃ t 3/ ;ZC jjP,/ ǃ t sz/ {Xe[^_]UShĨYhe)8tN6&7&M\)thB sXZi)XjjSP5he)#j1]W|$wUWVS ƉӃ=\)uj'_k<\)X \)1ƉU1}m @M1EmPP$hjSf~;6u{0ujh>SzF SZÀ{0u K{.te[^_]g_1\)\)\)\)US]tvUUt[F~#CtVj RPWjEpS:~5j Rs cWE@C us XCX C @C[놋]Ã=\)USQjj]Sjjh$6&@tBEP\)Zt,jjSPjh$6&读@t\)PATH@=5\)\)6&X\)]á\)US ]t6;u1Ct*p~Zti)PjEPCp1(]UWVS }W1t@\)B\)PWDrE_XZsnEX;t.Ey"xVQ, Y輐0軽Ph1Psus ua \)u\)t[~5jVJXZ}xu+ ju0 jssYX}yjs_XZxV+ ^uu+ Yu u|Z upX1\) \)u\)te[^_]UWVS}u 7&tu u1\)1E܍]SÌXZ$; uwYX=7&m=\)%jw~XZ=7&K\) \)4jwNYX=7&=\)=\)=f)t>VW VW=S- =f)tVW=f)tjwXZ=7&=\)u=\)uSŋZU ?1=\))=f)tuW =f)tfuWSi =f)tAuWfك=f)t(www+1ɉ \)jwXZ1=\)\)jwY_=\)tr\)f=f)tW,S踊XZTjVW S蛊6Rh)h7&ES{SpY Sgf1S轊Xf)t}=6&t\)t tPtj=e[^_]UWVSE ǃE܍uV5Di)ju^1jY=7&tKt>=7&u5tUXUt E܃PuRcXZ=\)u V苉X^VZu1\)tje[^_]UWVSWE} _6&6&@c)@c)HO;t(@c)sx&迊P ωʋ7@c)tx BM蓊P M҅xJ wH+ 6&Q茇^\)PS}ZY1\)\)e[^_]UVS]\)1js&XZ=7&=\)tT\)u\)H\)x1\)뼃u \)Q\) 1ɉ \)MwE5\)=\); ut-t)E Ps5\)XZ=\)Ro \)5\)e[^]UWVSu=\)=7&u1EPIE؉E܋^Yt$hPSO =\)b[E؋E1҉\)]؅6FDi)=7&Pi)P莦PCh7K9v 17&xWPyP7&H =_ J=s7&xWPYyP7&H X J 57&?_jsv E Pv =\)=7&uJ\)t:u\)H\)-1ɉ \)Hu \)H\)1҉\) \)=\)EPPXe[^_]UWVS]uV薅E؉E܋S Di)jPsiM[=\){tuGDi)EpWRZYtV1=\)uZ=7&uQSC ; tDi)u P \)[_.[Di)u P\)ZYu뇋[g1\)VlXe[^_]UWVS]} 31EsZ=7&{5Di)i)P*PhStj RU57&UR hXu hX7&HyPV7&H X J 57&X\)@\)ujSguSPEq}trt8u4guu \)u\)t3js"Wsj\)H\)u~\)tunUu;Rf1ɉ \)\)H\)[\)e[^_]Rr\)\)H\)Zu\)t tJ=7&tA{t;5Di)i)PjPh7&Ee[^_]e[^_]USD\)EE1EEpX=7&tlExtc5Di)i)PZYEP$[EXtj S57&X [hg[57&XjEP[ ZYtlE\)\)jXEuKt&:EP$X57&XԋEt\)j5\)9 \)@\)Eģ\)j EpXZ1ɉM \)t5u Ep-Y[\)@\)E\)j!X \)t\)t뻡\)tEt"EPK$)?X57&Z]UWVS}] 1CCC =7&EP聀\)@\)E^y h1xjWfdjWPyu31ɉ \)\)tu jujWud E؉s \)H\)Zu\)tEPwXe[^_]UWVSE ,1@i)X@i)(Eg- `tfE=f)u Ext,AEftfwE= t= tˋE@fat5\)@\)ju^[^n6&9tߋM/t/CUuSs 1ɉ ])U^_}9uB])<:ttB1::uBMudZD+6&Ee[^_]k1e[^_]UWVS|uj/Se0Y_tAuu VS\no xP6_Z@ j6EPǃ tjMy\=])uSuu VWu>n8t4n8t*n8 uxPWZY@t nWkX뀃 h u tCƒv~ ])PSP6h"jUWVSuU F^fftfftdNi)$U jS$PJPj IU yхtvhXZWPXtkh<XtZh+_MtIhSh\)@\)v~P$Pb\)H\)tShNY[?\)th,Ph PShM~ t-7&HyP^7&H *Z J*7&HyP17&H X J e[^_]UVSuK t"8u%uCVPdZYt؍e[^]UVSuK t8uVPdZYuCݍe[^]US,6&1ҋ ])tHft fux@ |u[]UWVS}\)@\) ])t,Pfu9x fu9=,6&| PX҉΍^])t \)u\)t e[^_]Se[^_]UWVSSui)X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPh#uZYUt>:uGFC딃=,6&y t ,6&u1҉MRM ,6&Xe[^_]UWVS\)@\) ])t!f{usSɏXZٍ݉w])t \)u\)t e[^_] e[^_]UWVSutA%< ]) ])tCVPnbZYtdߋ} tX\)@\)V^$eÉ1fCC VCP4m \)H\) u\)th=])؍e[^_]USK tjP)f@SPXZߋ]U塰\)@\)]) P~\)H\)Zu\)tUWVS] j/u)^_t[EtFxPuZYy h8th8thffCf1CƋMi)9tMEth"QDS Y_tM ju_Zt>HftftfuEEu E u=,6&yƀx u91ETtE,6&tuDYDžDž\DžXDž`juEP` Wd])Z?/xPWYZ2E%==])NEWt[Lȉ`+6&$]cWabjuƃfx`QWTfXZF FfF CfF fCFC,6&f~tF\`9\HPh#pZYtuYDž 5])h+epYZ`9\~8f8kf8]fXKWuh05\)@\)dTujuY_f~udfF`FDžX t@Et$jXPuh57&Tf`\)@\)dTujuXZf~udfF~ \).\)!1 e[^_]UWVS$EE111E11EEhEyEZtPEbw$h< 1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEEhe)81 ])tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u57&^7&@hO[EjWZYt[@ft:,fuu>he)Phe)8ufHu*}"fu}}t˃=,6&x ti)PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZvd]uEԉERuIEe[^_]UVSu \)@\)ju!Ë@ZYft&fHu sgXfCFC fFC FC \)u\)t e[^]e[^]US ]\)@\)fEEE6&fEu ?EEPSL\)H\) u\)t ]~]UjuTZYtfxup)X1UWVS 1ɉM11uh@vZt(ptvtVuEEлɋE 8ctu ދM Mt4PhHt}t5h4he):t/1E he):he):{RPhm`@ jjV XZu}jV)XZGfEGEEfGfj/V!ZYEEԡi)}tEjVEPGEP\My`uh9XZhe)Phe)0Ih.j wu  hwh9he) 87&HP7&H he)Phe)0YV_8uVPWZYmIwhowh9J he)Phe)0i)PjEPV1MfHftPh%iY^jVmP_Zuu hFYV`&^0%Phό he)Phe)0 u%h,uhB uhWfVh9he)Phe)0_Xt!he)Phe)0E.htYEE~uh넋Ee[^_]UWVSEPyZ])+6&PY6&XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=V7&t"E u @c)xB [P}눃=@c)u[@c)6&8uu@h|XtVAZ^E %E1bz PbYuVZZPbX VZXu‹E|}u5F< v@ @c)])y8[P])Csu2"H  <w @c)])yZP])8t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:MhVq< ZYEąM9EЀxupx9uE EEE9s2>uF9utsEE tdU9UvsԋUE͈@ĉƃEM9MUPyYPEPy EXZt\uuЀ>-utF<]tm/uu}NtFuc=])Uqxvtu@r t@١]);}u5])S[rxRPؼZYyZ9tt1t9s'@ZxvttE]S@ϡ]);EtP9Uu8/t}G gb[P? XE9])t@/Džp>t F1ptJxw@tu@o\)tS[ Ypu{F/uS Zt߀x .u o.uǍx jWt tptWutP 5]) 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu])skY > <6&t$ @c)])yNHP])6&C뼃} XEN=le)u ])te)CEm8uA @c)])yGP]) @c)])yGP])EE"H  <w @c)])y~GP]) @c)xUBE])UGUJMH ]) @c)x"BE])H ])U:uGUJMك; @c)])yFP])7&j)uj)85te)FEE%E} Et`"H  <w @c)])yaFP]) @c)xUBE])8FUJMH ])떋}u? @c)x^UBE])H ])Eu΋?ug< w @c)])yEP])EUJM렊"H  <w @c)])ynEP]) @c)])yPEP])UAJ}} s8j @c)])yEP])G0 cE1ɉj EPSN E 8;Et<=*e)t9le)te)DE]} E"H  <w @c)])yKDP]) @c)xUBE])"DUJMH ])뒅u. @c)xMUBE])H ])EuJ< w @c)])yCP])CUJM5])P ])XZe[^_]UWVS$E} }؍p8}]}1t@E j=VY[E@EEHEEЋM t1])+6&E Li)})}MԅtLEPVXZۡ])t+6&E}"M6&>@uP])DVƴY])u+6&,+6&EEt;t}1ɻN)ЉE=F7&8<@.<*&}tE<VE)HPh(1ۅI~@@c)H@c)Cx])P])S։MAP])SM뻍G1҅~օ)xu u܋E%PV1ɀ} k])+6&ыE))])]) @c)@} uSY6Z}EtsŠ"H  <w2 @c)x])H ])U@H ])U @c)x])H ])U@H ])UԈC뇻11EԀƒ v! @c)xM])H ])CuJ @c)x])H ])ĈU7@H ])U뫈U@H ])U뫻1111ɋE%Et>@u=le)uM @1 1E @€}E$< U5])Q8])^_Uzu LuЉU E PuY[ExU^1 @c)])yB?P])5])+56&uuuuVuu%])+6&ʉ]))@@c)uZ0uuuVuiƒeuXE)Di) Rh誩}O#uOQVHPRh#u EEEPVE)HPRhgu9u1ۅu"uԡ])+6&Pu 1Ҁ}t`]uu E]Etq|wt ]) ])׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tE7&j)u j)E])+6&E;~uE t u SXZE 1Es}B~< O$,= :=J{s{u{y{@u{=uz1])E} t @c)])ys<P])e s @c)])yI<P])Di) @c)])y#<P]) t=])t"])+6&M9~xuH]) uE uE 11 @c)])y;P])҃}u C< w @c)])y;P])S @c)x])H ])U^;H ])U߈ tsDi)E#E PVu R])pl])])VrXU @c)x])H ])U:H ])U߈E {~=u}1Eu V[X uDi) @c)x])H ])U`:H ])U߈EE RuZY])+6&jPHP wމe[^_]UWVSEu ]=&7&t1҉])P ])6&])6&@c)1ɉ ]) ])PDi)Sp_Xu&])=@c)u9])@c) @c)])yg9P])])+6&Pq6])])XtAh])W&])1҉])])Y_ÀtS5])+5])_Wj6x])])Y[k])1҉])tNFe[^_]Ujju56&@E5UWVS$EPEߋ5])+56&hREС@c)H@c)ZYx])>8P])=6&VWW]S6])+6&P+55Di)WݔEԉUS66&]))Љ])@c)@c) 7])uuh'j5])蝜])׉Gu}"tj)PV} ]))O]))=@c)EЍe[^_]UWVS]u =])1}DPSXZ])=@c)u7])@c)=])}=6&}t }tA];tWh9h7&褛j> EtPV)KSh֡jWV肥+])=]))@c)e[^_]UWVS]u=])CvE%PuXZ])=@c)u56])@c)=]) 6&}M  t?9s@UVWQM MUt <CÍY9s1:UVWQM{ MUS9st{u8u@@9r9sS륍Y9rVSQM, SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+])]))@c)I9tKCCG+])])@c)x C])4P]) ])@c)e[^_]UVSu]Sc2F ])6&])6&@c)1])jv@c)H@c) x])4P])])+6&P1ju PES2Ee[^]UWVSuFPhx蝘7&xWP[_yP7&H Y J19}E 4(ZCWh??7&xWP_YyP莖7&H [BJE 4x7&xWPYyPF7&H XC9| J1e[^_]UhUhםUUM 06&t 9PuH]Ë @b)1-06&B t xt 1z1@b) 8b)UWVS}u ]\)@\)06&z tj.06&J B ZB$B 8b)P@b)Pjj55Pb)e[^]UWVS]u+`b)i5rOCShk\)@\)19~Qi@tǃu=uFjR ZY@u(tPUPh9+`b)i5rOCSh輒HJ΃utBƃs \)u\)t e[^_]e[^_]US]\)@\)9t PJMZ1ƃ1҉ \)u\)t ]霑]UWVSTÉ։Mt&uPh3]Sv =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=`b))i5rO 6&+9t# ti1;J-R@PhjEP舊hgjEPs URZEUt%‹E0hjRUDURdǃE@T=uhR) YXu*tQhjRfhEmjRTu =t̉UQRj URP/E@Ut$RǸ@)$D=Ph`/ U:Plj$URXZKyS赇P Y P G~SEPHXZEu EL}tzKySgP _ P KySEP|Y@P|4M}tWhOS藈 iEM0EKySP Z P EEE}S{X>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~W..[tW-XY*Ft~uH<-tB<%t<+u:6&6&i`b) `b)\b)E1MxdtS~JH~?u(UFPQM YZMUt UQW,YZUu뗅uV7-ZtjV,`b)\b)XJxRt~i90tM΅x29\b)~*i`b)t" *1ۃ} uVPL؍e[^_]UVSh6X=Xb)tYh8r7&HP57&H Y肈Snhe)Z8Phe)xjhe)0Y^u hH請=P+`b)i5rO@Phj8 9DiPhO FXZՋJ ;1e[^]UWVSQ111Uhr5ZUt$jtptguܿպλǍH~hv he)tyt h辊UjPYXUt 1t+`b)i5rO@Pht$Ph3]'XZ1tiHi0i0h7&BHBCY_y3R4X9H 7&z99y9H y:؉؍e[^_]Ã=Xb)u!UjuZYu11áXb)u!\b) `b)Jxu 1øUE=6&t@=8c)t7uR+`b)i5rO@Ph57&趂UWVS=Xb)t.5\b)`b)NxtS{X1Xb)\b)`b)J\)B\)uh=ViP*Ë\b)`b)i߉_19~i9uFPNC^`b)\b)iƄDŽIu\b) \)u$\)t膇t \)@\)=N7&1ɉfǃPb))؃} ~iE PZ \)u\)t؍e[^_]UWVSu]=8c)tSSzYXuM18c)\)c)jcjjz1Pb)XZ}u*=6&}u=6&)=7&t u &0Vj _X}u-V56& ZY@u%0$IhPhC\SjrSjr{}tXb)}u`SjzSjzu }um߃u2`u)j3 jhQG thQhxЅt$=6&tSj\rSjTrSjLr_e[^_]US]U M=7&u1t uEM E[]~ UWVS}tE1ۉEPu EPǃ u8f)t\)@\)`b)E1i\b)M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉[tgu tUP=8c)t =6&u;u uEɃ@ ;u uEuEu7&P \)u\)tȂe[^_]UWVSjjjà ~ jjj=7&tQCtN56&> e^9t7[P56& ZY@uq0pEhjPhC訂1`b)95\b)|btPu=Xb)u>SX5E t t&tt M ڋE8F떍e[^_]US1h,Zt$ltptZu⻀ۻԻ͡he)u t8t Pho cjvo Y[=6&u =V7&u@t4jhe)0‰١7&he)Phe)YZxuS57&?XZ1]UWVS411Eh+Xt)ntput h&5de)Eƃ}t1E̅u4Xb)E̅trHhe)8uEu=Xb)tO*jjV~ uVhjV9Y_t Vh 蠀=Xb)t}`b) \b)=he)Ix.}t ?u1҉1E؋Eԅju4EZYtxu M؉}tDE؀u8jPqZYÅt j7V薃 =6&)ugXE؊u CM؈`he)8tu E؃]ȉ1}ܡ`b)\b)1Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV贂 OuA1ɉM܍EPjj @usE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_EԅthPhC{\)@\)SSË\)J\)XYu\)t{؍e[^]Uh&Xhe)US] h%X]Lb) Xb)uPUS`b)\b)9|:t%uh AtLb)X A1Ë]UWVS fE Hb)EDb)E11}uEE@<}%<T~<w=$T= )69<=Pހ<'<\FEF1FEv t!4 < t+ E0 wE> < tB փ8t "B1t1}~ unFEf"dt`@6&t ɉ1:GS@6&<}tO~u/SCAE\U$H "N  $E 1E]CMtjBBu] t}t E"M@EEDb)EHb) [^_]UWVS]} =Db)3x$x= gjsZYu h;4Xhg[_jshe jsshj n[ ho \^ho Q[Y1벋st7jv3XZ>t hr 'X6jsjs u7{t1hXhljsh61[(hv js u h;4_hjs { t&u h;4n^hz cjs T u h;4H[h hUh ,XjsZYu h;4Xh js u h;4Xh h7Ks hjsyh js h Cphs t=jvihdjv U; uh h A_vh s)h sY 1\ %1&1_ 1b  V S9tRhxj}W^oWV^w-C yh* `P蚗à u\b)dP_KP^؀;.8t@x/t@xPS%vZYy1EЉEԋ\ńb)\u94b)E} ])u e1t:t@u=@c)h SV ^_196&XaX6&5])߉Sj7&xWPYyPi7&H X J EЋUԋ\b)b)\ne[^_]UWVS}uV[1ۡf)tCe=6&u\ujJY=7&j57&jh7&h7&jI=7&uQ1~jIZ=7&u8u{=7&ur;u=6&t`=6&tWh iXC+t'=7&u1҃=Lb)‰Lb)jPvY[1V4ܑZuVyXe[^_]UVSU:\)@\)jR* [^y$ \)\)e[^]4ojP\)H\)ZYu\)t o=f7&u11.1=7&t 7&1ۀ=7&t 7&j蜑jj莑 =f7&tt7&t7&e[^]Xe[^]US]\)@\)jS9 ZYxjP\)H\)ZYt Shxn\)t3njX]UWu}~E pdPBec1Uu Zu h4!GnUu u%ZYu h4!'nUVSuV@$VPF ؍e[^]UVSEX96&}]ށ}\)@\)FPb6&P6&56&6&\)H\)Zu\)tm\)@\)56&6&)6& \)u\)tle[^]UEuj hA!jT y6&)6&6&UE6&6&P6&P@c)P Dc)PDc)]US]\)@\)6&9t6&P'XC6&C6&C @c) \)u\)t ]l]UU\)@\)BDc)R~\)H\)Zu\)tkUWVSW 6&\ k\)@\)=6&56&G9ui`c)ta6&CPW¡6&6&J 6&+6&@c)6&Dc)^^t5;8u1H+pp X@MSNjM󤣐6&6&X \)u\)t e[^_]je[^_]UE\)B\)6&)6& \)u\)t]j]US6&6&@c)6&[]US6&+@c)6&)أ@c)6&[]UU6&)6&6&6&+U У@c)]UWVS,ME 11˅t MPZMwDGƋ܃}tE0v hL!PjFPKE0u _E1t0wLG V"YMVuS MM̋3XZ̋EЍe[^_]UWVSD])11EE hi!wE_t/}pt}rt}duܡde)EЋde)E뿋=he)?u ho!ijE^tt Sbe[EjhpEZYuÈEP 56&6&@c)X1EEЉEEEÉEjMQj# HMu6U߉Ӏ\uN}\}uKjQj Hu U߃ u Eu}tjPa[X9UUtRUuZYUt@RhZYt}tc }Eu[}? @c)_/}] @c)xFUpUԈ+6&E1ۉ]E@c)u#EJ@c)xFpUh7ZYUu.J@c)xV }P+6&RE^)u\@c)j56&7k 56&6&@c)1ۉ]3=@c)u2@c)#Su诽ZYt*Sh螽ZYtNE6&9s}~}tjuhj j56&7|j t jh> PEP+E؍e[^_]UWVS1h(/E[t硰\)@\)j P \)H\)ZYu\)tehe)1rErǀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD5wFuD5xFD5EPEPEPh!C_Wh!0__X0 wI112NЀvSh!%ɍD=vB:u҅t Sh!eP\)@\)S~U ^u \)tW0'PSh"dׁWPE&T ËUR\)H\) u \)t9d\)t)dӁSվ Y57&\\Z7&@th "]XEEe[^_]UWVS,f11}Uh2"E^Ut*}St}at}HuMЃMʺË]E> Eԃ8t@9tE Sh"che)8}Ѕuxt hc}uEhuZYEЉE1E؉EEȋE@HЃ w7̋}9 ErXk] eډΉ׉u؉}뷅t uhU"IEX 1RShj脉 }9Us uhB"}e؉[}uE> 11114EhE\j hx=9\ Et‹u}eh\X}j hx=[ YX;EPC PsCP3hd"[EE|u}eC 1RPWVV ƉRPhz"[ *C 1RPWV/ ƉRPhz"][ Oj hx=I[XZ M؉]܍}WE@ PFZY@M؋]u0$Ph"HE}tXEtM]tM]WE@ P [^y0#Ph"`EԀx udj}b)/tM] EtM]uu h"qZY$E@ 1RPSQ RPhMZ 57&eXZ7&@th"YXEE̍e[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPSuM t#9t9uƉׁvSh;#Sh&#_e[^_]UE0 w @8u1]UVS]1tSqZ1tpVhS#S ¸tVVhS ¸t<uhSwY^¸t0 vSB Ze[^]Åt2US6&t1:6&u6&Au6&[]È6&U6&PS7&PXZ=b)tM=67&uDM P' R P̐ b)0 XYu-jPhX#b UWVS}] Fh\#UW_S1ۃ<6&u,6&R6&#RPht#WTCuġ7&HyPU7&H ^ J 1ۋ6&t#<6&tRPh{#5W Cuh#V[16&:6&t26&#t RPh#6&RPh#V Cu7&HyP*U7&H YJ vu&h#W^Zu6&@uK16&tPWZYuډe[^_]FuW#Ph#k\e[^_]USMU 16&9u ]R@uQ#Ph#)\UVS]Ct&st PXCEe[^]e[^]UWVSP]1ƍ@uPkXtUPUBX1hle)rpe)5le)=te)1҉xe)Ye[^_]UWVSPutf1=\e)\O he)P-udX]}-t@BBt&ctQo:tW؅u1PRY[=he)uxu+t =he)1롅ttf\e)e)덋Wt؅u1=he)뗅uSj#Ph#Zru th#aPh#*TjZUSPXZUu)7&7&uuMe[^_]7e[^_]UVS] C}أhe)V7&16&@uV7&jjXhe)8u=\e)un7&=6&u*=n7&u:j^tjYt 6& =6&u=n7&u6&=7&u 6&7&e)=7&ut :-u7&1<6&u 6& 6& 6& 6&@uԋ \e)=n7&u>he)t he)u7;\)Phe)e)jPƿe)\)XZ=\e)t6u h#XH he)\e)Pthe)e)he)te)qe)le)1ۉB9tt 5le) he)e[^]U}ujjjjuXE\)@\)jche)Z8tPX \)u \)u1~WUU0 wj jR^ Hu1xe)qe)UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh$}[à uVh $cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh$[à tuVh$h7&>Pjh$`1H9ujQh$Zà 1Mjhh$Zà M+E@1?1ɉE11ɋU Phxj MQOhMQh4$_Z ÊEEEjMQu EZ( t1E1҉URjUe[^_]UME  h;$UP ute)=qe)uxe)1ɉ |e)qe)h|e)hxe)RppUVSM`e)t:u>he)u1:-uztXhe)z-uztBu he)ͅtɍr8tuPh^$9Yy:u܀y:u.zu he)J he)2u Phq$T5de)15`e)e[^]UWVSj,he)^_zth$:8->E he)1`e)jhe)Ytzth$(Tle)uD8-u @P5le)P)Xgle)9Zyh$9|EPá\)@\)te) le))<}_߉ƋM9sω9s x19r )ЍpkME9s 15xe) \)u\)tRS[PYle)9} h$\)B\))أle)te)ljNx=pe)tE7 ZEy1ۍ te)1u1xe) \)u\)tR1e[^_]Ë7&z8U @c)x@ 6@7&J87&z8]ÃxuUSt P. XK]HÃ8uU1҉P8u]UVSƋXCF~hy1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P7&JHR P UPUSUJtXxv-u~u C $t h%7&B0+B8PCXe[^_]UWVS46&E=u6E8t h(@ 3=6&6&@c)} E=6&6&@c)\C@c)\GNà " @c) G46&(=k@c)H}t@c)G u͡46&@46&=-} uE( u ƴEu 9E@E菴t9u& u46&7&HH FՁt| tf,jE)VP+ &kx\[x @c)@x 46&7&HH @c)xO H6&)Q7&X46&U)Ѝe[^_]UWVS@} 7&B ]urVY wVh%Vh% 4@ h%j"S|GSZ؅tWh%}xM4@ h&jPGGSUWVS]S;56&MM E,ZY96&ulP(_H=e)9s<wDu 9rMW5e)ZYt%e)=e)M܋=e)5e) &&S>e[^_]ø7&ztGUS])ttt*2&#i)i)546&P])ZY]UE])jZEEU\uHر u"46&7&@8xtjjX聮jjh耮 镱UVS7&Xt 1ۉXX=x tjb7&1҉P Y7&1p846&P0 @b)x8b)P8b)0Fƃ)c t,~tŁF $>  46&7&PP @\ |td;Z=t 蘰 uc?&u7&@197&@_|u7&@7&@$&t;u,7&@ 7&@ 訬7&@7&@r7&@_蒯=t0 u746&@46&7&B0ztjj[Y7&1҉PjhbJ Và ؍e[^]UWVSSá7&@tuxt =7&,uyGEt7`@ t,O8uQPLZYu`@ ^_8Et2jwE.Y_t XS4$PSd Rt 7&1҉P؍e[^_]UVS7&p$ t jj7&ubX(x,u{ upV ZuhJ&P: uBPVL7&BC1ɉ ^t‹(wjpVe P0+P8RuF Xe[^]Um7&B]US]V9tjS]UWVS 3t u%j 8XpZʡ7&@؍e[^_]UWVS7&@}t11[WA t1MHwRFuv7&@@},jEu-뤃uj p1AXumtCMuj 18XMHXj 1҉WPMHGYljރ}t' }uZߨjE#BW}uG7&}u:7&@@ A }t jj7&@e[^_]UWVShEӉM7&@E1E\)E豮E+6&]jEP) ZYt bJ fxbJ u fx @c)E46&7&xtjjZXsbf@fLd;xcTd*"t~L tgF=.H#"$$? Džd't+pЃ辥PЃv;46&7&ht蔥PЃw tSdCd\ƍ@;w`u h&\u9\uh&ރ?bDžd Džd11`PЃ `w t0)Pw t0Pw t0臡 Ad9ud(=w h&0=@c) á@c)HCw6 @c)?ʀJ R @c)CC@wj @c) ?ʀJ w @c)CC @c)?ʀJ vH @c)H@ @c)qwj @c) ?ʀJ w @c)CC @c)?ʀJ vH @c)H@ @c);wj @c)?ʀJ w @c)CC @c) ?ɀQ vP @c)P@ @c) ? @c)?ʀJ w @c)CC @c)?ʀJ vH @c)H@ @c) ?ȀP vQ @c)QA @c)?ȀH vJ @c)JB @c)?ʀB< vA @c)AA @c)ph '} ~€ u @c)st] t%舡't:\uy=uh& 46&7&xtjjFX  Š"H  <w @c)C @c)sfxt @ @c)C=u @c)s\ u'46&7&@8xtjj^WHtujXY>tt-uVƉCY;b)} ;b)~b)}>uQy>u |u &u !Utv&uya1ɉK7&dj`dB(7&@(X46&PZ-7&@(u @  1҉P 蜘y1s7&X$7&@ W7&\H,hP SV7&p7&@ X P(Xu1 @c)GD@c)r5H"0ǗjhډMX@c)HXq{t E @c)X+56&T @c)`X@Džd{1d#kDžd}tmE uW&DruJt?:}u5e)e)jjhe)ٖ 1ɉd躖Džd E @c)t> @c)x`@`H`E uKЃ wC @c)x`@`H`iÃdt@@Ѓ v6t'H@c)X`XX, Džd @c)x`"p=d%:t #u)Ph @ 蛉[Z…t!Džd[Sh @ |ZY…uH% @c)x:F p:Džd @c)xF p@ {`@9Ë`uBW``Dd u(}t# @c)x#F p#Džd詔d1ɉdGfxufxt dT6&Jwd@ ӈd ӈ{dNj@f@f@dK@bJ 1҉P:'uAW|bJ u1@c)X\Nj@@"H f@@c)X$諓H @c)JNj@@G @f@e[^_]UWVSS7&1ۅtXC17&0x tjR7&1҉P YF8Pv v^S‹FP U8tSj7&pZjhBI P`7&HUJ@ B 萘]e[^_]UHu+]UWhPT\)lژd7&`\)\}1󫡨7&X1pjEP ZYE\)\)E7&Tjh` jhBI Pc 7&B t$Pt=^7& hppDžt1ɉxR|T}E7&jjtP袉 6&pnX7&`7&d蜗Zl\)\\)\)u jl  Džpu^j-DžpY'X7&`7&d.Xl\)\\)pu hpp}UWVS 7&@1ۉ]}U 7&u@$x @40$? j袿jCjj Cu;jiF EjUBjbjUB뻡7&xu jF Y1҉V @j]j á7&x 14$pCjj_Cj7&@A. u7&x,u pr[u hq'j腾 7&PS @0CB7&Yx u`x,uZhpu^ZuGu 7&up0pY1҉US@PvjjfHu?8j@7&1҉P P7&J0HCBHYvB7&@-ttjjjCV7&@^Xjk 7&B0+B8C j f7&p0C57& ~ uhvIZYt hCEFu7&xjƋE0FEY7&xu;7&x  jj p0‰EEU表7&@Zu UBE밡7&xt jj@0FjF 7&@Yt-Pv jj u 7&@FEM1҉@{j jeC1҉SY^tNjjLX=V7&tt3j7&@X&}t7&@uWd^_Tjj 7&u@$x@1ɉutt;tj ;XZÉs؍e[^_]UWVSV} uE E1ۉ]1]7&xn 7&u*p0QƉXYtա7&pZu1뿋H up$E0FE뢋}9u}} uwj7& 46&H4^S ZYuh'SZqj/v~ t h't 7&46&+A8F%F7&1x4R@@u} u jj1E1҉j1ɉHEFE F 7&@0F[e[^_]UWVSS7&@1uG u=V7&th'7&@puWj Y1BUjBËUBpXYUj)&C^Ut1ɉ ֡7&@tj)pZƉe[^_]UU7&1ɉHHPtjjYX7&1҉P t/Ht37&@j7&Ytrrh'n&7&1U11ҋE]FUU Et 9Pt]UMe)tPt9JuB]US]j袷SCU PUPUP X]UWVSEPB [y h1%u;57&~57&ExW覯Z=w PWV% `jjj uNuV jjjjjjݯjjԯ$jj ȯSEpujugV Ee[^_]1=e)UWVS}u }t~h@VW܂ à VW ZY}t9u9t:WV X19t-yg0fPVWh(SU SVWh($97&}7&؍e[^_]UWVS]{tN7Gu e)} t} t&Wxjw PR+GxPhU YW*Z1Ce[^_]USe)\)@\)uSwe)S\)H\) u\)t ]T#]UVSue)t1u(jS#ZYFxPT X6utse[^]UWVSu] 957&}57&97&}7&9t7ST jjSV%9tٸ8V`T WPSh( #؍e[^_]US7& @7& 7& ~.CPjjS x97&}7&PS X͹ؙ } e)]UVSue) ~;b)|l5e)j VBS à x97&}7&9t0=PShP)yjSRO ZYut0PShp)%pt @e[^_]UWVSSlj1QÃ}tWh{57& EtE A 7&td#GtQuh RqW҃!t#)t7QhRS u1ۃ u u1hz57&*YX 됅ttSh)R h57&XZe[^_]US]5e)j SN uce)CPj SM tCPj SM u0j j SM ujj SM u h)97&}7&]UVS]t4e)9C|sKƋCZ9tVPSsM s e[^]UWVSuU 1E E1E Et{jڭ1ۉXe)=e)X]^9b)[vaSYESX$6Y}ue)u EPVH vu9b)}b)9^ uSYu S]Ztj jjSfL y+0*PSh(fSUZ9USL XISwYZOjS L ZY1҉UxE䡰\)@\)=e) e)b)9}@PjSK ƒ E肰Ht UtoE5e)jSK ƒ yAM8ujjSmK ƒ y$ .8t$0#PSh(;7&~.7&&=7&}07&$97&}7&xjjRUJ UuRSW\)H\)\)x}t 7&7&}t 7&7&e[^_]UWVS ]1}}91&1EEh)u S{ tu~tvhxS S4g)f)@f)=6&tu\)u \)0[^]US]SVYt ]]ߴh$S4YZtS Zu]US]*t%Sq ZuShxj hdf)蹕 df)]UVS]} t"KyS P ^ P VPhS  t?uSh ZY?t.!KvyS9 P X뭋P 롍e[^]US\)@\)f)t8t P1҉Yg)u1f) \)u\)t ]-]Ëf)uf)t9u=g)u 1UWVSu} =f)t=8c)t?u;f)tۃftGtt; f)Wt2<=6&"f)uQ=\e)uH=n7&t?$=6&=7& f)u> uU4f)tY<I<tG<0<#t5<< f)uw EPjVW @}ttKtR1N=7&t tFv =6&u <t9uyn PVBZY@t\u f)u jV ZY1E܉EEEN>v 7 DjEPj@ e[^_]UWVSu] uhseZYtshVCY_uh*B j57&h h*V_ZǾf)tl\)@\)f)P1ۉf)^u \)t\)tjW\)H\)ZYu\)tG@u15f)1ۉ].{hv  DjEPj8 6SP9 XZ5pf)Utf)Epf)]UWVSh`B Pl ZYj'V__Zu <)ș19e[^_]á\)@\)7&t,UP17&7&Z \)u \)t \)u\)tUWVS]߅~91Wu ur7 ~ )Dž~E u F ~) 8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfuh)CfKS u>\)@\)s6C CC\)H\)^uV\)tMFfu9s\)@\)6CPRC S)S\)H\)ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 97&u]e[^]e[^]U57&uXZU57&u~XZUPuu EPk E u h+ouPJuh UEPu u UE Pu57& UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'V@\_Ztt~tnh+ViZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h`B V ZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'97&u]e[^_]we[^_]U57&uXZUh7&Mh7&CXZU8ruPh+Ph+@UWVSSEPE X856&6&@c)j=RUYZYj=SYZYU))9~߉Ӊ @c)I @c)t$<=t xFU蔗p UCɅxUvU] Ue[^_]B- UE1@u,Di)+@i)Rpp h,jhj)l j)UWVS]} Mt t9u t113E ƍCt9tE u1@t)؉[^_]UWVSS11h)tZuA=u܍P襓EY1h)t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE*e[^]h,S|ZYS Z9u;Shj'SWY^ƅu+Sh.XZ/<'uh2,sXuS)Ph5,t e[^]UWVS]} sSt"CtS҉XuEs1Et Wh!Y_}t5uh XZ$7&Jy R` 7&z9 _F>=u y:Cu}th%VFPZY7&HyP7&H X J e[^_]UWVS=,j)u(j) h8,j)Y11ۋh)tJG} tE t8tEt.(j)9P5,j),j)%(j)XZ,j) V E ucCƒSu u sذZESʰX \)u\)t>1҉Ѝe[^]UWVSj)j)su"6&s 6&s l論YVCƒJujvXZ=StuPF K DPY_F u v!ZCFC FCFSX`e[^_]UWVS111Eh,{Xt2vt&etfuEՃxuп뽋E uhe)t0}tUP( YUtW2U XZUʉ؍e[^_]UUE  E U?t h, jpp 1UWVSUUu \)@\)j臅XU:-u0zu*56&k6& 6&C 1ɉK^1jEPRUǃ UuSj=RJ_ZUtRVVP?VjR E81ɉK C1s@C O t0KOKGt u tGG <=uRUVP tjRULXZU wHi)u1 Ti)< =u1tfzuhI jjh D 1zuHh^ jj hD BRm .uhI jjh0E h-P~ZY1u(E UVS|ƉӀ8!uxu :\|fxqpftft!f u&PVZ?;*;"|f uPS[^1PS,ZYuNf$`C |&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!]Tn ]H 9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$C SV{Y[SV{_ZYSV{[^SV{ZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV^_xPSZY04]E9uc9u_E98PVi^_uWxPSVZYuD04MU9u9uE98f9]PV^_t1PxPSZYu鋅|9u;xu͋ 3E3U R>~u5!uډx!(u;)u{u ?e[^_]UWVSu] h3y_Zu!Nu xtP!zUWv Yu UR&DPtÅt S Z@tM}th6vZYu }tM1EE8%u!Pz^X6h. _Xz}1ɉj EPuiljыE 9Et:8u5 t/u u 9uMt}8Mt#y޸euPh. EGSW1 YZ@u'.|RPhI)$ Etu jW XZMurUVS@lb)^)b)^)51t j=S=YZt hSLXZ Phxj@]Sg jShL/|j h7&hk(j h~h4$Wf ƒ u-j PhX#2j,hQ/h#!j h~h7 $e[^]UN=\)t 1@b)j)Ɔ?j)@j)e[^_]ÍL$qUWVSQ01Y1ɉ j) j)7&f`~Fj%s1_Zu1h%SV< tLu%j)ۡ&)ƍ NAEčCEԣj)j)EĉEEp<<\uB1ɍUiE衸7&HyP7&H U[븋JE<%u}%u?7&Jy$ER~ 7&ZEYui Yh:1V藠 _Zƀ>*uFE$Eh2Vs Y[EEE8.u(px*u Eh2V9 _ZEEu uhA1}f?f}‹}G}l M9tVh1&l S] DH/}^uQ?t -tЃU D:H u ED>HE @,1e[^_]UVS]ss 3shN2U `O tVTRPhy2T S S VPh2T e[^]UWVS uj:u (ZYE u h2j @E } hDP E Pb Y_8j=Pv(_ZqxEPh2WO E }w t24&4 u44r4r"44@u4@t"4y4Àu!4y-4Àu4PI4 r4 r#4' 4 r4 s#44 r4 r#45 r5 r"55u 5t"5~5u5u"5^W5u5t"570%5u$5t%5 u^,5?'3t3^,5}wu135%45u35;5u:5u":5B5uA5t1B5`%Yt@I5JQ5@3>uMH5*tOP53MH5 P53^W53@Q53^W5^W5}w s 3 r3%=t)wt=u&3=u3 33Q3 r3<}vw s3_5#'_5 r^5 g5rf5r#f5n5rm5s#n5v5 ru5 s#v5~5r}5s#~5oh5r5s#5F?3s3sj3^}uS5P`O ;t3CaP3h5jd,WB 1 11ɻ`O ;}t SC8t{$(Wh5j ,(PB CPh5j }(PA $A u,P0 W* Y_1Ƀ bt,P EP XZe[^_]U Ph5hp&E jG< U塸j)6=j)uePRPh26hp&\E j< UWVSQÉU10;#uCj EPSS U 8t Shj E8tWSh6jy e[^_]USÊt%<#ueSVZt@j)]UE E EE]MUWVSÉU}utj VS.S  @t 9E s T8"u"3O;t)t:Et&fDB@fO1e[^_]UWSPh68)Zu$).j URPR à urT8"u h7j 1ҍe[_]UWSPh!7(Zu().j URPVR à uT8"u h17j0 1ҍe[_]USÃ=)t =)t?)9t6t2@t=u@QRhP7W )1))]UVSƻ X t[PVKZYuICƒ )$)C()Cj)C 1f‰)te[^]% Vhl7j  e[^]UVSÉ֋t8uVh7jURM1YZtVh74V XZ)1EEe[^]UWVS11Dž=0)~ Vh7U XZ1 RPhSC=t=0)Vh7藿 &f}Uu1.=0)Vh7oU [^v49tV Cfw4[ hOPh:h&c> s(h:h&N> s,h:h&<> s0h&:h&*> $s8h-:h&> s4h4:h&> Kh&h9 Ea6Whz:h&< vWh:h&< F (tlF c)h4>S;^Zƅuq;jP11҉ZYth>>zF _X )Fe돍VhV>SE+ HuEt9j)s(he>F j)f)[^f)uƅhBS:ZYujhh)h4nS:Y_ujhx) {h>S:_ZuAjV11҉Y^))h>SQ:_Zu.jV11҉Y^)h>S:_Zu.jV11҉PY^L)h>S9_Zu.jV11҉Y^ )lhS9_Zu.jV11҉ZY)-h>SU9Y_th>SD9_Zu.jV11҉Y^~)h>S9_Zu2hV11҉@Y^<f)hR"S8_Zu2hV11҉Y^f)Wh>S8_Zu2hV11҉Y^f)h>S<8_Zu.hV11҉wY^uwf)h?S7_Zu*jV11҉;Y^u;)h?S7_Zu9jV11҉Y^tWSh>f)Pa<w{tSh'?;=j)rShB?0B <~!jShb?B ‰))]‰))hkSn ^ZÉ;uh7xA Y[ [ 1V:2Zߋt ujPSV踬 uO [ )V1YÀ;thkSLn ^ZÉ;1ۉ[ ]&DPt7hP11҉ZYt&h7z@ ^X Dž" !v&Sh?J@ h?@@ 1ɉ)_ `)Ft<$ U u^ \`)l)F )!)13FfF`)l)F )ta)t613Fsl))h`)Ze[^_]UWVSP1۾ [ < [ tCtg1}jSEP%' th?^> Y1@E h9 jSP1E4n FZ9uu`Xe[^_]UEU M= 8&tMU E]:]USÃ=D)= )u1҉t%Ph`)XZH u= )t =H)tH Vux=8)u=,)u7j$ h`)hedAS/ tHh`)hrdAS u/h @j h`)hedAP y h)@j ]USQ`)WEV)WEVf)h`):f)X=D)=H)u2h`)hfdS y 98t98t:@rE=H)u2EPhmdS? y hK@aZ$8&hoV " XR=H)t1&h`)hgdS y\@:]UWVEu `)t `)e^_]Uh)hmd5$8& UEU 19s f3P]UERPZYUS]EPu Y h&hS; ƒt$< ttj S ZYt1]US@8&tsPhEM$ /`E EE]*$ U=)u PhEP: ~9$u ~#EPV EZY9 uu VG PhGS t4Ph+S HtShG8 XZ붋fv(hGSW Dt0Ph+S HtShG Y_뻋F(v,hGS t0Ph+SW HtSh"H XZ뻋F,v0hBHS t0Ph+S  HtShgHJ Y_뻋F0v8hHSm Zt0Ph+S HtShH XZ뻋F8v4hHS  t0Ph+Sm HtShG Y_뻋F4vu>8t/jQ} tu Sh'M胊 Sh)s _X뿃} tu /Ph'MU 벍/Ph)? [^띋$t $PBYP BZ}tEGjPS~ y h XAЃu ƀt/tu1PwI$u h" e[^_]UE)E )]á)á)UE Puhp&uu hp&j " j% UWVS]8ށu=)t5)h?t YX=)t"=)u5)h[NP 1)XZuu ZYyW{HPh% t7=)t.j / X=)t P5)hiN je e[^_]UE Puj' UE Puj UE Puh UE Pujj UWVSx1ۉ)Ph[^_yhNhVuȴ ]t Ƅ1PS蔈ZYyShNLY[u%=`uz 9u;u)Shh)(ƃ uShN뜍xPV_ZyV끋%= VhNe= u:u*ShV%) t ÿ"ShN0Sc [+SW Y0hV  u|h)h5XZ|듉e[^_]UEP ZtPRPh O u uhOhh )L  )U)tjXj USj0h` j)jjc ]USyj jj9 jj0 Y]UWVSÉ֋x CPww wwփt=)~j Ɛ X)e[^_]UWVS1=)))1)))1 DžJ u/h"Oh-O [^Dž SUYu\ Åu~3hV% ǃ uVh跄 XZAP~XEtVhKO Euu듋CuOHujsVsUYE >9 C 8H1u"Wh]Ohp&! Dž CC jhPjVz!Ãt'$Phzd@S @uSɱ[W YD &9rDYt)PH)t4KRWQ  u <tPȉjxWC1ɉK C C1{;)C))XZ{ t%Vw YZuVhoO XZ?jVkG]G OGG1CG8{DžaETuDž)Eu)} u:E 5j YtshO] s _Xtvh=G 6M 9~=) 1ۋ9U tE 9}?Cԉ a^ EtPs sshO …g=\Qs sshOhp& ҋC'BDž 1)C) 1F)H)~ + )(Pb ^t5)9F6냽tr)t`:t(hOPhOhp&Q )t/;tTPs sshPhp& ͋ 莺  Ph!P Y[0F1҉StPVS s7s7S}7 uU89;))?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs sNY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss{Y^} GWsseY^GWs$s RY^G W$CDȉGDs,s(7Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHsNjCSMEAE@ufFZ[tA 1H)Ee[^_]UWVSu^8C@PvM ) UB fCB u0C‰UjjȼUfPjjSuu褼YZ8tuu蒼YZ8WVStWV,UMPHPH QR_EWVUU$WVDYZ8u(CWV+fXuuf@uu XZA@fAEeY[^_]aÍL$qUWVSQpQAQ A1~ ^_EC:ffmGf@t_PhP蹆=X)t+=P)tC CC C u$hP% YhPTZu1=H)1_ t貺f@[^) )jj ¡,9&ƅDž Dž1XY=P)tB>BBp+BtPR|[^t)) hPqY=X)t-5(9&jjjj)) h QZu5,9&RPjjPt)=X)tohQ# b5)=) t(jj[[XA!HfAWV#1))XZ=X)tj : _)) tjjRPe) )u hQ+5)5)[^f%f=@hKQhiQ ZY5)=)5(9&jjjj)) xRP5,9&jjy\jj5)5)ƅDž WV@@PP WVf@5)5)5)5)蹷^_8thtQ1ɉ H)[)) tCjj RP~{C9s#Qjj RP{N019r)#u 5)5)u"hQAh 1H)XZ謶fH^_f@t 5)5)hMu6!@t%hM5)5)5)5))Z[@@fA\5)5)f@5)5)ChQ<$u thQ =X)j XeY[^_]aUWVS}u w wTXZCfEE9uc0)t=X)t =\)tj jjjw w'u0)jhQW  w wNYXG )9O u,9&;)tf%_f=@umGRhQw wgE)PuhQq =X)us=\)tRyNj r hRXZ=X)t2h(RE _=X)tfE)fCe[^_]Z h4ReZHt1ɉ H)x밍e[^_]UWSáԙ)p8hSY t& ԙ)q0RP¡ԙ)H01z 1҉Ѝe[_]Ƀ=$)tf‰Ã=$)tÃ=$)tUWRPpY_}UWVS(}M] U ));E] w+EU 9ԙ)p8}E9|+F]!É]E !ЉEEUEU9}"=|)tWN#uVu uhFR 5ԙ)}̉Euuu u~EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=|)tlSQu uhnR ԙ)\Tumq֋]!qISQuuhRn ZE̋UEU؋}9Ћ}};=|)tSQu uhR* ԙ)uuhR $럍e[^_]ÍL$qUWVSQ0QEU}9Es9=))EsuuhR"{(),)ԙ)sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuutŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuuvK` t1Ɖ׋Cu}ܡؙ)t`s0WVխؙ)ԙ)@x1҃ RPuu_uM])Ӊ (),)ԙ)@x1RPuu/uؙ)R=P)tЍeY[^_]aÍL$qUWVSQ8QEU))Ӄ ))}9u}9u9=) )EsuuhSy))E؉U܋E9EEE)@Ẹ)ԙ)\1ҍMQRPuurUEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuutK` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=)u )) ))EUܣ))Suu5)5<)腧=())})E5)=P)19}VVdf%ZYf=u Gvdv`jYYF`Vdvlvh jYYFhVl1tttpMiYYM؉DpTtA u1MiYYM؉Auv<=)u ԙ)(1E؉Ẻ}EċM9MSuu5)58)躧rVVif%ZYf=u+=l)u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡) ) )=P) )ЍeY[^_]aUWVS u} ԙ)M]1EuuWVq ‹Mt WVh'Su1) )1(),)5)=)5)=)1)=)8#AH)=P)态1ǣ)1ã))5)t C) =) )Qh\)ZYu hLSte[^_]á)tUPZ1ɉ )1)UWVS u=P)tFVFV zEUԙ)H0AEUSQRPZu w 1҉UtE4PX3)RPuu lo)1{{E U 1҉CS1CC E UC SEC$EC( P)1E v 9st DpTtD(D,T0Gу} w))9)ub11tDXGu뺍PRZY=)u hsSr))d)P))e[^_]UWVu} )RPWV*n)t9xu9p tWVhSre^_]Ã=)tQUS))\;)r 3}X5)l5)a1))ZY]áؙ)@ UWVS$Ɖx@t@VЉ_uDžT v vv ԙ)p0vvxNjHԙ)P0@t 1ɋ9}=؋ÉA빋EU RPmÉ19r= )thP)tF1ۋ9}&G q1vcYYQCG W58)ɣ[X9}W ʉ@~ ԙ)9Htԙ)9Xt~zG=P)t T <tYv vhShR< RV莤t"G=P)t 1ɉ ؉L1҉G 1H)C|W58)[X"~@)EU 9GG=P)t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉH)FV RPRPhS¤ShSo hS蟛Xv v!ZY=P)t@V+EU FV@V z+EU oFV hS 4)gX g؍e[^_]UWVS uE 8t18E 1ۉX0X4P)tFVFV щ} G$W(ff%f= ԙ)fua(9=)t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQki1P) t ԙ)#8tU@DNL!Ή!؉HT tԙ)@8] C t`d E x@1҉H)P @RPRPhS聡ShShl hS^YHE p p^X=P)ԙ)tp0PCSp0 ^_=P)tCSCS RPh5T =P)tC(C|1RP_iZYE E@Te[^_]ھ e[^_]UWVSS]u }s sEZYOu6f%_f=@umGRVhI)fs s_=X)t hJTy YhUT辒ZH=X)u؃)){@tjjjjsHsDs s Suf^_=P)t `)@ `) }s sԚZYe[^_]1H)e[^_]UWVu} WVuuuh[Tfj 踼 WV膚$t uB<v RhjTde^_]ÍL$qUWVSQ81yAE̙)EЉ tWVZY8t 1u؉}1ۉ]̋E;)E)suuޙEZY8t EU͋E9)uE9)ԙ)1ҍMQRWuu]EĉEE)Eȋ19]E s 9sjVYXu!RhTdXZ1E؉ESEpW@lEȋ 9s@t EpXE)x0uuԘEY[ ԙ)EƉׁ\TtAЋU!ASA RPh )]5<)ԙ)}=()t =$)t =$)t5ԙ)u5<), EЁxU tU tuhT|cXZ=()th )誗@)_EЍxU uEЋp\ơԙ)1RPuu]EH ԙ)ELHh R5)j5ș)5)'=$)t)PP膾[^5)pf)E%Y=t =t)=@EE@Eԙ)p8 Eh )舖@)uuà =P)VQAEЉUԋUЋEԉщSpCtZ Ef1{XEPQ: EUC S$C0S4C(S,ԙ)HT t1CS CSV譟C(Yu EEaf1҉SdEP9 E\CC Cԙ)HT t1;CS  ChX))=`)tE }̈GE؋U܍eY[^_]aUWVSX̙)Eԙ)1RPu u=\EEƉׁ\TtCЋU!CQC RPh )豒5<)ԙ)}=()t =$)t =$)t5ԙ)u5<)耾 ExU t U tuhT__X1EU1E EU EURP=Y^=P)t@ECECX@pECtECdz EEPS8XZ=P)t `)@ `) u u袓^_}tjjjjuuuu. ))}ExU uEp\ơԙ)1RPu u'Y E@ ԙ)EL@h R5)f5ș)5)蕗=$)t)PPY[5)a)h )A@)XZe[^_]ÍL$qUWVSQ0AQEUA Eċ=ԙ)GPEP)E}t%f%ƋCS0}E#f%ƋCS 0}E}1҉ft1uމU!U؋U!U܉9E؉}ыu}M t 9|N}tFTFD1҉ zuRP襏}ĉԙ)@0 E1uȉE1Ẽ9Ή|m+u}̉EUE9ƉU|6+u}EEEUEEE9ƉM}E,E#uuhT0[EȋỦEUEE؃}t DT1҉ uRP貎à uuuu[EUP)EԋKMЍEPuuWVEXu}}MtT 1҉  c ԙ)q0RP,à MqEĉԙ)@0eY[^_]aÍL$qUWVSQH9P)E̅tGWGW EU5ԙ)F0E}tE1ɉMԋGWEUEE1EԋGhE1҉UNPEU t1҉E؉Uܸ ]9ظ]|bEƅu1%ԙ)X0EU=P)t`M؃ωT@‹E؃T ؙ]UE؋U܃EUċE9EEċu]Ћu)]uċEԋ]Í E؉UM܋E9EEċu|G]؋u)]uċMЋEȋEԋ]eЉE؉UM܋E9EEċu}E,E#uuh UZXEЋUԉE؉UEEȍp}t/B uvEE̅u"EȋTT tډ1Gԙ)X0EU=P)t# uUDXuRPpẼ uuuuXE؉U܋ P)ME̋pEPuuuuTËEUEUċMtTP :1҉ ueEƅԙ)@0 EUEU=P)tM̋IىTŰRE@ `uũf ԙ)q0RPzẼ 1Mu h+UVԙ)@0EU=P)tGWEUuGWGW ESGheY[^_]aUZ PhhUhp&d j UWVSSƉ׉uEPQe2 U 9t:tWVhUjv e[^_]UWVS É5X)PUXZ=|)t=X)t hUVXVScc^_t u=X)u1hUYV[0)=X)u6ԙ)PhVGV7UZYt h+V2VXh@V'VX=ę)t8=X)t heVUX=\)t hVUXhVU_=X)u hVU^v(=X)u hVU[0=X)u h WUYe7=X)u h.WUZ9=)t=X)u hMW`UXQRԙ) $( @8 $(RP5)5)5)5)hhWTԙ)@Di($ʉ1WVRPTjj RP'SRPk(dd$WVRPtTRP ($hW身 @=|)))+)) ԙ))) 5ԙ)NF)ڋ~,f,))Ӌ~4DӋF8׉֋ $(+ )) )) t/SQhW RPhW诪 =|)9z=ę)t4hW芪 ę)XtsshXo  j 肩 X=)t4hXM )XtsshDX2  j E X1=)=ę)=)=@)tmԙ)j* 04h 5ԙ)5)Y5ș)5)脋=$)t)PP[^5)U)Y=4)t1҉H)jX1ۡ)ԙ);Z,sDtPXCP1)X=0)t =4)thKXQH)X=@) =X)u h{XzQ_=4)t hXfQ^UP0Ph[^ Y[u70t-1҉,j,R Ph[h"] t=X)u hXPXTe[^_]UWVS ]s{{@u(EUE9E;s WVE܃ WVhbs sD))EU)) E9U}Xs shY/P =X)thY _EhY{^u1ۉH)j j C EE}n}uPE1ɉM؋EԋU)r8))jWV tEWVh`s s))EU)) E9M}s shYj Zu#1ɉ H)hZNhYz[^px)u)ę)1҉ ę) )9t9zu9rt9yu9qt)C0S4MEEe[^_]Ƀ=$)tf‰Ã=$)tÃ=$)tUWRP?Y_}UWVSDRPleP)t&uff%GW$Off%GW KftGj`hЗ)GpP' urjh0)P& uNuJG G@j0h)G(P& u+j h)GXP& u uhtkh+ZLhUTxHu=*^_=P)t `)@ `) R1ۉH) ) ) ԙ)t04A09؉rEA09؉r#f@u;9ظ=|) hLZ)=X)fh[ZowYHu|XZ=P)ԙ)@4t GWGW fԙ)H0ASQRPnFy%=|) RPhjZO P)f`t f uf=l):9h)G(RKd1RPS5<)xt hZH=|)t1ShZ+ PG(P#Q=P)t 1GG1Gh/ԙ)(P)x_ș9rL=)t;9ظs)(t G Gtht)t 9ظ Dž1~V@tʋ롋 P) 9ظC tNDp Dttރ=|)u0D(PShZ͞ j|(볋DpTtRPShZ蘞 5 ԙ)119Ћ}{AtRPFC뷋ORPh"[ t uC~8|X=|)euDXPh [裝 ^_AWpq[2))GfBf[j tYu01ɉ H)h;[EhYq[Zu-jj詖 PH))f@u> ЃW)  B=P)=l)tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u1))))FV =P)tGFDG FHGXGpFDGtFHGd F@VW[X=P)=L)t =d)G\uG`Wd uGhWl tlhU[Cht[ou 1ɉ H)21G\G`GdGhGl f!0XZ=L)ubԙ)X4 ؙN0ʋF4f0F0V4=P)LGWF ԙ)W\tF@I0D11 ԙ) G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPh[mA=X)t h[ Yh&b7mZ_XF0=P)tV4CSCh~@jjv4v0vHvD wh[@hUTlH ZY=P)t `)@ `) 4e[^_]UWVS̙)E1ۋ ԙ);Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEU)CBHLY4DEUE9ƉU}:E1EEU)븍U1E 1ɉ ) ) ) )Mԙ)];X,}|1Eu| ԙ)EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh )p5<)ԙ)}=()t =$)t =$)t5ԙ)u5<)P =P)tE@x ԙ)1҉EU=)t6ԙ)p,kEd1<SVuPh[hp&ʗ 1)=X)=\)ExU t1U u E#uh\=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEE)ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EE)ËE} u 1s<}%?}u}9t uuuxYuuhL\;j 1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]5)= )|U) )ԙ)M]11 19E}eu5)9|]s1-h1l|]+hlȉ uv)]1t_}}9u}9to<%?u9tSQh6\:j虋 M]WxMY[M]u Wuhp\9MEsE)lj1VEi1 )e[^_]UWVSEP@EUE@ E}juu# t )t`}9xuPu9puHEuuh`Ep p{ )qyEpxu}qy )9)u )u덋= )98tEUMK؍e[^_]UWVSTU1EE ę) )111Eԙ)x,9}=)t2kEd1E7uWuPh\hp& 1=)1ɉMԙ)M;9ظVSXZts]u$)=P)tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=$)tf‰Ã=$)tÃ=$)tUWRPz)Y_}UWVS EX8=P)t 1Q=l)tt1;))slj}1RPk@C^_DžE@4} G0.3ChgbPOZY'Mqy u9tXY_8u695)|_ssدFXZC SCS u95)|)js s]Ah_,#hP%O 3ss訦1ƅs{DžV ^_=P)tBBBpBtVR`ZYu h_["_PsstQDž ss輥VPtVf@Y[5)5)~VfHXZ:e[^_]UWVS(EP@EU̙)Eԙ)RVuu!EEmƉׁ\TtCЋU!CQC RPh )S5<)ԙ)}=()t =$)t =$)t5ԙ)u5<) ExU t U tuh` XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUM)EMBę)Åt4}9{u}9{tPHSKę)PbX#E}tlExU t}G`ǡԙ)RPuuӉE1EЋE̋Uǃ))Ex@t+jjԙ)@4 ؙRPEpHpDp pa ԙ)Ez89x t0}t*E@$ EL@ EUMM}tttoԙ)E{89x u^E@EL@jRPEppxK` tPuSYdh 5ԙ)5)@&5ș)5)W=$)t)PP-zXZ5)")h )zR@)e[^_]Ã=$)tUWVS\U1E 1uԙ)X,9] =)t/kEd1VSuPh7`hp&x 1ۉ)ԙ)u1EE1ɉM)MU;9WVWVQEu} P)tCECECXCpECtECd EEP$a EXftbWVYZt=|)WVh_`!WV^YZt!=|)WVh`'t SEP襛XZ)Ѕ9xu39pu.JZHX)RxjhQEPLjhQ$tC CC Cu jh`jh`EP躴`WVPh`E?Ee[^_]UWVSԙ)̙)|jj'P1󪋅h_X=t)xX$=X)uh`*G^uha)[=X)t؋1ɉ$p)h 5ԙ)5)"5ș)5)+T=$)t)PPvXZ5)t)XHXI$~6P9)`~$tl<hNjH`ltW,Ћ9G0sVha$^_n=X)tVh2aY[hFaEZC=X)uՋB,t|Fl$1~H`F|@ltË#XLS5̙)该|^_u hZa|̙)p)h 5ԙ)5)B 5ș)5)Q=$)t)PP/tY[5))ZP)tt DžPLDžHLPP1󪋅lPP TCHX$~@=)u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPhua1hDž\L1 l)׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtx)ttx1tX,9t=)t4ktd1=VStPhahp&~o 1)tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh )F5<)|=()t =$)t #=$)t5ԙ)|5<)r =p)u-|xU tU ttha[^=()th )(H@)Y=t)t =)u() h) d) ԙ)Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5)58)kC ԙ)𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh`)E=t)tthaXZXԙ)ph5|)5Й)1 =$)t5Й)5|)*n_XЙ)\8 uǀ\T5ș)5ԙ)KY^=t)th bPE_Zu)5Й)5ԙ)CY^u9L)u ԙ)Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5)58)Aj5ԙ)HXZΉlߋpËlቅlpplp8T<DT9ƉD} TDP)Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh.b CVtuPU u PU u P1ɉ`T9lpD)8lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P =|)`t'W3VslsQs thKb[` (hbPX<ZYtej PSVh 5ԙ)5)@5ș)5)A =$)t)PP-d_X5) )^1ۉH)=p)tP|x\|P uT|PTxU u |PTHU u HhRP hb\P@;ZYtw\S|5 HU uHڋ|xU tT |GThRPh )c;@)1H)=\)u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPhb,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPhbOXZlAu농U u PXRP txhcP8Y[taU u P|xU t |G\XRPT h )8@)t j SV0  =|)ts hcx[ DhbPu7_Zts󥋅ƀƀh 5ԙ)5)O 5ș)5)<=$)t)PP<_Y[5)&)Z1H)e[^_]UVS1;] s8Sh(Z ^X1E0PhgcZ FZYuj Y XÍe[^]áԙ)!UVS1ۍsrT =X)t409&hcAZ YX"lctcP.Zty=X)uɡԙ)t4象ԙ)1ɉ Lh P5) 5ș)5);=$)t)PP]XZ5))X15H)Ktԙ)ԙ)=X)t hcw [hc-Yti=X)uۡԙ) h P5)M 5ș)5):=$)t)PP:]XZ5)$)X1H)jWjWYXuj]Zuj]Xe[^]UE)E )]á)á)UE Puhp&4 hp&j Er jQ UWVS]k8ށu=)t5)h?3X YX=@)t"=)u5)h[NX 1@)XZuu 9ZYyW:PhW t7=)t.j V X=)t P5)hiNW j$Q e[^_]UE Puj' UE Puj UE Puh UE PujjP UWVSx1ۉ)Ph[ ^_yhNhVu ]t Ƅ1PSS ZYyShNLY[u%=`uz 9u;u)Shh)xƃ uShN뜍xPV _ZyV끋%= VhNe= u:u*ShVx t ÿ"ShN0S" [+S Y0hV[ u|h)h5XZ|듉e[^_]UEPJ ZtPRPh O u uhOhh`) T `)UD)tjXj _USshj0hb jH)jj"]Kh]US8hj jj\jj\h]Åt3USӃ=X)tPh?T YXShcXZ]USu=T=Tu =Tt=Tt=8 uI,)t=u 1111$)) )()1<=T=Tu = 8u1ہ=,)묃[]UEL) h)t,\Tu ǀ\8 Tu ǀ\ 8=d)t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC"Zu"hd'[=$)t hd)Y=()t)PPQXZh 5)5ԙ) =$)t5ԙ)5)QY[ԙ)\8 uL)ǃ\T1\TP)uSChEZd= V )΋)ѡ)ƉϋKdC4)RPWVY))) =)TC,HEƉ׋Eǁ\TtC!C1uCRPh`)'=t)=()t|)PP^PY[ԙ)ph5|)5Й)- =$)t5Й)5|)&PXZ Й)\8 u ǁ\T5|)Q5ԙ)u tc=|)udEKhe衒 =Й)ԙ)shX9s΋9tRP+ԙ)Ph0eXK hș)5ԙ)*() h)[^ d)t[h 5ԙ)5)6 5ș)5),=$)t)PP#OZY5) ))XE)e[^_]UWVS]u E)8)D)xPS Y_y]0跊PShzef=T)t(jSF<)_ZyT]0膊PShe5%= tShwhYp u1I =)t 8)=X)t"he/_jS8)ZYySheI 1ɉ @)X) @)u SheI XZ1@))))))1))h)l)1x)h h')h h ǣԙ)h h|)h h݊Й)  ʅ ʅˆt heVSUTY_¡T)t"ujVl_ZyVhx ^<)=T)u%RRjPVM8@t))t:) X) T)PDPj5<)S7@u SheY^Tu Sheh"tVSS_Zt%hfVBSZYtVSh$f `LuShOfC\uShrf+5)V4uShfuShff^_uShf܍X1‰11p~u 1ۉ)}Tu%HSQRPDžTӃ~ ƅtBtѥPD1D1É1P1RPWVVOډSWRP3hgZ1ۅ~;srPƉρ}Tt!1׋ t1)1t ;r5Ch:ghXghughghghghgD 5)hh@^_=KÅtԙ)\Tu [t1ۡԙ)!@)=X)tth"h[u hJhYYԙ) h P5)@ 5ș)5)%=$)t)PP-HXZ5))_1ۃ=|)tԙ)PhzhC Y^ԙ)=()uNtJt2=@)ue=X)tPhhXZ=X)u hhXԙ)8<))C,)1=)C0k NKt鉅 ׉ ЉNj׉   =P)=t)ԙ)=t)x=X)t hh^hh[ԙ)1҉XǀP1ɉh P5) 5ș)5)#=$)t)PPE^_5))[=P)5=X)t hiYh8iZXԙ)PP #ԙ)ǂL1XǂP1\hș)RC h 5ԙ)5) 5ș)5)"$=$)t)PPD[^5))Yԙ) tyPh[ihUT Hu^ԙ)  h P5) 5ș)5) "=$)t)PPlDXZ5)V)_ԙ)vuh~ighi`[^Hu\ԙ)1ɉh P5) 5ș)5)!=$)t)PPCXZ5))Xԙ)@_X5)?))^ԙ)(=P)tx<PhjJY[=P)ăxԙ)(=X)uh_ZHuqhi襀 _=X)th 5ԙ)5) 5ș)5)$=$)t)PP=[^5)m))Y ԙ)8<qH։9u9RPhjqԙ)BHЉ8< =X)uh_. ZHuqhi X=X)th 5ԙ)5) 5ș)5)K=$)t)PP<_X5)))^ ԙ)@DqL։9u9RPh kԙ)BLЉ@D =X)uh_U [Huqhi~ Y=X)th 5ԙ)5) 5ș)5)r=$)t)PP;XZ5)))_`)=P)0PH҉8<PL҉@D15`)ԙ)=t)ԙ)=t)?,=X)t h/ki[hOkI Yl)ԙ)ǀ, 04ǀ(<PH҉8<PL҉@Dh P5) 5ș)5)=$)t)PP|:XZ5)f))X=P)OL9=X)t hkklXhkL _p)ԙ)ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S5)9 5ș)5)=$)t)PP&9[^5)))Y =)tvԙ)=)uhh P5) 5ș)5)X=$)t)PP8XZԙ)ph5)5|) h`)58) 5ԙ)Sh=v‰L^_u Shk1׉1ɉ5ԙ)9)~09~NjLWF8HLNd t1RPS5<) t>t Dž)hkhY^Zu1ۉH)j, =()tHWSS6 ԙ)WA8HLId t1RPS58) =$)t WSS6 ԙ)@0 ))11Shwt£)XYu Shk1׉^,jSf)_ZuShl}=) )) ȉڃ9 sA)))1ɉ ) )jPeã)j5)e)…ˆt)PhEl"Shls̙)_Zu!Shhl[^1H)jZ7&ԙ) \)=T)u*t!hfP<ZYu ) )>hSP5)5<)ƃ ))))=LBALt[=)hlh_Y_jjjjjS6:=)fGW69fG)CJtejPhlk =X)uh&bBZu9h[v X=X)tC=)fGW8fG)_fCff=v]hlY=X)uhmZu8h msv X=X)tfC=)fGWZ8fG)_fCffuihmY=X)uh_lZuDhi v _=X)tjjjjjS8=)fGW7fG)f{f9}zD3<:uƃu}EEUEURP5)u u0 )9u)E ;}|v)EUtJ9tFRPؙUEЉEe]EUSQRP$RPhn' RPhXq' Fyj & Xe[^_]UWVS}u EUEUEE)ؙMʋEeEUMuuuVW9Eu@)UMtwhn& X19]~KؙEURP5)VW )9tؙEURPhX& )E e[^_]% e[^_]UWVSQƉӋJt,B=)n9us sRhnC 1҉Sss ssV)1E1ۋԙ)9)؋r09~ƋL߃=$)t VWWj) ԙ)VEA8HLId t1RPW58)=$)t VWW) ԙ)X0Ede[^_]UEU z t]]UWVS]ԙ)Hdu } t1)9{ u9st7S58))uWVs5<)Cs{ ECe[^_]UVS)5ԙ))t+NdEU  t19S u9CtCt[)uh!ouu uS$SPC))X)K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPhLo9{@uRs s8 RhXZ=X)th8oj YhDoZu 1]UWVE5̙)ԙ)x=$)t5ԙ)p5̙) * e^_])ÍL$qUWVSQQ9) )s RPhhoH5) ԙ)1ۍ}WSQRPU Ƹ89&;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE [)uu1_Z=)u <vuE (4]e[^_]w)U1EEƃE9Eu E9EEUEUEUEUEUEUEUEV ]uuMURPZS))lj$SW wG/ 9raEUEUE Et@EUEUE EMRPMURPcZC1ɉ )1҉)1)E EtF?N)Eu ]e[^_] UWVS]\TUH} FE 8uh`P} XE u hoh`SPp =|)t hoIg _L=()1@J =$)uE PP1$Y^E \=$)uPP#XZ1fEfffE@9uރ=$)tE PP#_XE \Ǎ=$)tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P UWVS}u=l)1H)8)y <)h)P^_=E)=)=X)t hov[h pVY=X)u׋ԙ) )=P)ux șRQ3))h S5) )5ș)S2=$)t SS XZ5)))8)Xh)58)5)Th )58)5<)T)1t-)t%FS58){spTSjTϡ)9t )Ph%p#1=ܙ)=ؙ)=H)ԙ)=X)t hPhFSo yL8St Y h5qj$W2 jjWjÃy}tW MZt8PhF|@S y&hF S^_PAtPAY}}Wt9PlAR XZtPMAXiutUR ߋu0PA_t P AYt$R ZxS)룅tR X؍e[^_]Ƀ=$)tf‰Ã=$)tÍL$qUWVSQ0EЋAEqy AEĠ)Eסԙ)X0]؉E܍EPuuWV UMUȉM̉E9މEsMp1Mȋ])jj`SQ芫ǡ)U4ڃr hAq迯_W!ʈEċxlEHX)!9tPRPhWqu)u< =X)t hiM ^h_2[u 1ɉ H)1!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=$)tUWRP  Y_}UWVS EԉUMQƉ׋] ԙ)H0ș9Ή}EE5EPWVuPԙ);B0u ExthzqtXԙ)@0RPWVUBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hqˬ,=X)t hiPK Yh_Zu 1H)1)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSNԙ);B0u UztWV2K_X5$)u  )QrRP3 E@ `ԙ)M ȐȔh P5)Z $5ș)5)[^=$)t)PPEZY5)/)Xe[^_]UWVSE XChSlEEUE EE=P)tP@P @ƉuOEXuhq1҉H)YX5$)ԙ)@0RPWVqS E@ `ChSlEUE Eu hq蛩ԙ)H0ș9M}sE E>EPuuunLԙ);B0u ExthrPXԙ)@0RPuu襤UBEPT@PChSls}EgUBXEU}GWEU G8W<5)#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tEЛec EЍc)ԙ)}}{rT 9RPYXJԙ)ws$de 1҉Ut4Vh7r=X)hJTfG Xt4VhZr賨=X)FhJT4G YRt4hzrkj t4+XZf%f=tCԙ)ڔڐVPhr5=X)hJTF XEPjjQJ=ԙ);G0u Ext+Crt4ljE Gԙ)E1ɉ ‰L_XP=$)%JXF^9t(ߔߐVhr蒧E`QB9uР)8BufJEf9uwhUT@_uS hUT/Yu(hUTZu1H)}tԙ)ؔؐ,F_Xԙ)1ɉؐؔԙ){rT uDVhrʦXZ=X)t hQPE ^h QYsS5ԙ),XZԙ)t4*EEPjjujHԙ)Z09u Extuhs1jF @E܋E=P)tP@P @u4puSQRP蘡EP-ƣ)X1}9}~hԙ)X01uE)ù`1j@@Pp1_X1U9} MȉыU @ۍzEE܍Hhhus EPUEk[^1E9E~+u܍Lphus EPUEh UWVS] 1LPTX\`DHv d󥍵dhHwuS< @PT |s1ɉKs SZY9t&Xuu h{WC?sPsT1$lPsLsHWpu/}tsLsHh={WVp^Z‹;SXt)tsLsHha{Wp YHE ~A Eujjh{h{Wo(uu h{h{WT  EujSPjjuu W Au  ujpPl1RPsLsHWn t 1҉ll;CPs㋕lSTp4aF(V,+F V$dh~>VhhtQDhdv$v tQh{W>,jVjhdv$v W 6lQPl/S~X1e[^_]UWVS ƉUMjQRPtuh {V_XfUt+tuuh{VS^111 tuB t@uمtr} }uWuRJtjjh{V~jjh{VjSjjjjjV pfuuh|V~uuh.|VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh$|V ~#1ۉESPuuRRh@|V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 S X렍e[^_]UWVSu} hjY[u)Vhp|M XZÉEEU(,E$E U$0418%jhSPVuhVS h|Sb<RP聱 ZY@uh|B$D%=u?$Phd@ @uh|S&^_$uh|M, ((Phd@ @uh|뭋, (h|S딋Eu ǃ$$, (uO1҉MRQWVr ‹MtQh|SV  (,u(,EU싋$1҉MRQuusƉ׸9ЋM|RVh&}StRVQuuhB}SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tPxXhk}SS 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@w @u%hx}SXZuSh}S E]Zx]US]jSYZuh}jS YZuh ~SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|P tijWRF uYjuWUu!@uuZYjuPUu@v0sh~us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h~S 1e[^_]ÍL$qUWVSQ qyAQEUy uh~S{ZY8$E܉E1EuuWVj tuWVhSBHEPuuuudhƉ׋EU tuuuh?뷋]9ً]}eY[^_]aUWVSu 1ۉ^hz591}_X1td1SщUf M YZMtUBuShsu} f f   Vhzje}XZ똉e[^_]US1f f uhU `u܋]UWVS ]} WhS蓼 1f f E؋E!ЋM#M t:;tTUWPSM Wf S@ UҋE!U!E`uE Et;uuhjuVY ;tTWPS WVS ؍e[^_]UWVS]} tEU E U uhS_X S^u E@P;E sPu hS؋E pVSZYEtu hS 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u hSn Ee[^_]USP] ;u:j EP591  U:u1҅u591h.u Ћ]UEUitstau+u PJ uPZYUg@RhP UE ft*u 5914ZYt591h7uA US] ;u#591i Y1҅uhRu%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~hdPY[E1eRP6 $RPn[ZR@8Zfu%S5913ZYQhvP\ ֋]UWVSu }jj hWVj]S<yEWVuh& }t Sh ZYj * Xe[^_]UWVSQ]M tu EEQhS'M $jXZM uWhS 9jVQjjuuS U 1ɅuWhрSKV‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_Zth2jS,Y^ujjjjSbEUE Eu hSXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h7PP @9E}}EU u hU'EUjjjS@ $uY_u hojPjuujjS9 uV.hSZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u ha @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9&tE @k 1҉Ue[^],(hۂ)$h~ $1RP,(aRPh h Z jSm uhA XrX CRPh5 s,s(hSs4s0hg$C8PhxhxVi-Vhzȸ sPh軸 1e[^]UU E$E8E U]UWVSVEUFV E܉UEUEUEUE9E EM|vuahNWE UEUEԉU؋E9EEM}6u&uuuu uuuuh]W(1FM]3M 3] t?uuuE Uà hWEXZ맋M܋]3M3] ut.u}t#uuuuu hWEFE F E$F$ku}tRD}w+Mk D}w Mk Dw k RQh҄Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuuXZ t/E؋UWVRP[щΉE؉UMWVuuZ t/EUWVRPj[щΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuu?YEUE Et6EЋUEȉUWVRPYMȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuuVÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw Uyh %uhurXZ~th>O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuuKWM؋])ӉM]MЋ]9]u 9M9ME}uuSQh_uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uuV ‹M؋]t&M]uuSQM]uVM])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uhu+GxpF)^N^ 9MEu hy~t hFV E؉U܉ȉ+EUEUE9E؋E܋U} hȅE؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yuEԍe[^_]UWVS@]u }(,EUEh WV} t(qtsu&jsEPjjS@uvE95&ths j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE EuuuhSE$1RP,(yFƉ׃u؉}܋}9ЋU}uuuuh(SjSEZYtE̋EЋ@E Et hdfEЋ@ EjS^_u h}?jSzZYu hx!x G EG$EjSG jS9 tu hS^XPH UMċM9Mu"M9Mu}u hSY[1p GPGT<9s/jhv V tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuh֋4E؋U+EU9E̋M| hU9UEUиM}9|E 9ȋU|&}tE؋U܉EUh4SXZE9E؋E܋M u}uU4}u hVSYX UMH0xh4S{XZ1}9}[uujSD@1jp juuEU+EURPS uhrS @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋EhS_X}ffuS7Y^@,hÀ}|h4SXZje[^_]UWVS]1uuuuu11hόuu x btENtoat%itClh=Y1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9&uEU t ths jZYWVRPuSe[^_]UWVS EЋu} jj hRPj]SyEWVuh }t Sh ZYj  Xe[^_]UWVStƉPZt 9St[Rh7V *{ RhO蕗 $1s3щ¸f$1s sщ¸WhhV (WhxhtS SV uhhBVx SVh# GPhxhS Sh $jmSj$G8P7Sh迖 h+赖 G0W4 uh2 X1RPhP?P ލe[^_]Ë &Q &y ;0&| t&J &Uh&P赛 XZUWVS֋U} $s Ev` u>h/zޕ X ׋󫋃V6h}蠕 XE/ze[^_]錕 h肕 X8ShxhtS ShS shEE뚋A t h}! XhǍ C SX1ۉ019u 9tCuEэ!ltPPh苔 hy _tjmWj$8Sɽ1tttShxShhWWh ZY?hCz Xu+u"ElVE Ee[^_]ؓ e[^_]UWVSxh h觓 h|x h茓 h  xà Džp&Džps3x p4 s sx p Ct Ph- K Cs31 W{ WhhPD WhxhtV*VPK uhhBPӌ Ph3V XZ{ h)hxhVVh^* Vh h jj hx$K x$cRPjV, x$K x$cRPh蠑 "jmVj$G8PVhގt h j G0W4 uWh2d X[tVh^/ GPhxhVVh ZYgRPhPP hgܐ K Cs31 OC tYC 8P)s t󫋆RhxhVVhV 1e[^_]UWVS}] u1EEEEh8VSNo t^l`~\a wT$s ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9&th t j^_xjWZYu hB X]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4h h h| h h  W+ƃ E&EEv6 u詎 v v u蕎  FtMPhll XZ N Fv6U vXZp hg Y볉؍e[^_]UWVSD] 1}v }Euhuu m tditHTt*PLt7olt Pwb&h=Y1tukVS_Z@ut6PEPSB @u#tjhv V t E 9&th4t jZYVht EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMhuV l tfitLat%bt0lh=/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95&thHt jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0h/RS! ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk`t WC uu wuc uRCu1jSk`t V u%u vu( uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh`W4 uEyƒtp Bu@uh֕SC$,# ;$u^u&H$,ȍt U _Y4t 1󫍽@WhVq tuh2SjR@ZYu(WhUVp tˍEP@ZYt@h8S hEPhVh tEPhVh mEPhOVph SWhVJp tj$EP@B sVMx ZYu+C xu"mt s sFYXj zk Zu Xe[^_]UWVSE @80ƅ77PhveuY t 7u@ Cu X0u: ^t h0p jVh! Ttg81ƅ9!@󥍅8Ph$jPS0Ph$jPuV VSh*jw3S) [t hj3T˅t_S zuR(,Wsv ZY,u1(zu%B sVq ZYu+C xu"t s s>YXj 0d Zu臼 Xe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u hx hu0^uhx hj,sP3^ s Ws^ hQtuH t.PEhou+E tZuEYLEPh>/uQ }Chs@Pu\ @qhouXZt VTYhwuXZt Q6XMEPh>/u QE Mu {hE EEEM؍CU`EPu u @Muhx hfEftft5fu6t2C t Whj9+}tC(UhC0ut3h̙j+t C0sHtS4KL9sщ}t:s@shuE[ us@s`u0[ @u;4u 81t/sl`}t$CU[s@s`uZ @uEsd6CptSuZY@u s\hs8sXuZ @u s\hte[^_]UWVSPuZu1iu _tQV1Yt=W:EWu  MuSV[^PQS$ uVZSX؍e[^_]UPEPhu[ƒ 1tEUWVSu\PhVS t\Mfnj4Zu\VXtd$1jRVWnVhiSzY @tt}f1RPhu Z1e[^_]US]uu S? @t ]]1]UWVSu uD[^u s PY9Esus ?VƋ}M)1Ze[^_]UWVSu u[^u +s PBY;Ers ?VLƋ}M)1Ze[^_]UEPh^uOƒ Eur UWVS8uEPhVO uhhx hhTh h3V_ZtPƹ}[E]ShiV5}ĉjSPh3u oƃ S6Yt=EUu؅yكۉM]! EjEPpXZuVh3u VHe[^_]UWVS1Rhiu4 @t|j7RPh=hSsހ>tVhs] Vze t j7RPh=hSks;tSh] S=e \ e[^_]UWVS]h3SmY^tVPZthhx jVh~f VƍUܹRhiS3@u hj%e[^_]UWh%1󫍅hPhiR3 t|}UWVS\PhuL uhhxz h0he dShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPhV,L uhhz hhd uS1^Xu h4j$CPSZYu hz hFPhou % uhz h`j#S 1e[^]UVSSu] EPSV @uhz hj#hxVZYuhhz hh2d oEuoPRS莿He[^]UVSSu] EPSV @uhz hj!#Eu hj"hwV艾ZYuhhz hhc PhwS He[^]UWVS}hW9[^um PpY@vhV,Zu hjl"VPhW@u hj""xtdPhiWp0 thћ뮉`SKX`e[^_]UWVS}hWtZYul rPpVwYXuhޛDVShWE@u hjq!1҉Uu]EPhiW/ @u h jp!S蠑X1e[^_]UVSÉЉʉƃ ι.uQuRPShX e[^]UWVSu1jS,Vhxi PGQ @uh% UЉUP艈XۋUu h>j U]Vhxi WQ @uhdڋE9E~E1}~ Wh X FXZ;u} j /W Yj %W S蛐juQ UVSPuVZt"ÍEPu V @u Sh}j( @P(Q UWVS$ƉUЉh*P{[ZtPƹY1@]Shvi V.j S8Ph*uà VHZe[^_]UWVS0]EPhSIG uhhz hfh` MԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EPaXZtVh*u VHe[^_]UVSuV[thQtVZYuhhz hh3_ P^fx PS+ZYu h4jKP{X1e[^]US]EPhSE u h &juS,ƒ 1Buhhz h- XZ]Uh 1US]dPhӜSE uhhz hhP^ d|lPhiS+ @u hڜ X1]US]dPhS E uhhz hh] d|lPhiS>+ @u h0 X1]U1EEpPhiu+ t hћj1UhxuZYuhhz hh:] Phou 蠸HɃ0 v+BwBÍBwBUg ]UWU1ERhiuG* @u h j1}W|$wUWSÉЄtGjj hQPj]SS4 zt.PSh)S hb¸TXe[_]g_UWVS uhXz hjGjLhB&& _ZtjmhB&& ZY¸ uWPSh*hp&RU =h?&t VW?XjmhB&& ZY¸ uSSSSSPShҝhp&U $VjK UEU P]UEU P]UEU P]UEU P]UE1҉T?&T?&1]UE1҉\?&\?&1]UE1҉d?&d?&1]UE1҉l?&l?&1]UE1҉Pt?&t?&1]US]ShB&% YZt d =CЃ v؃߃Av {d hB&X Z>u^d B&1]UE1҃t )]UUp?&t H9t@]UWVS81ۉ]܉]E䀖5Ĩ))EЉ]ԍEPjeC ZY@MЋ]u hJEU׉uȉ}̋}5)ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEPڠ [@tEЋU ЉEhj-uGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEP`Y[=Ĩ)u4]늋U9ыUjSZju虦 jH EPjA ZY@UE]9u]9u9}~ 9UȋU}h#bjUWVSÉHPZtP_D 1D1V9"LY@u hz h&RPHSƃ uhz hdjR1RPhrhW'jWVhN jVW[WhiLF @u Wh t PhM XZjVW@[Wh~iL^F @tt PhM Y_j L pHZ@uhz h# u =`?&j:RPh1hWb?tWhM WT | j:h1hWb?tWhɠL W^T | tHSW?YXjVW#ZDž@WhiL+E uh֠`L XZjS#jVTWYDžd1hlWhiLD @t|h!|Xu hl@1dWhiLD @@u h@lhK @R< =_)t%ow(z Rh*pK Y_HS XZ=_)u0=^)u'DjHSDP jV`VXV^)-{k?PLC @uʥ=^)tXPjEh3r:˨)%X th3TX thToX thCTMX tRPhN&J h3rf˨)j_ th3T^ thTY thqTZj H 5X?&X%SV65p?&tjHSVv e[^_]UWVS]S^t EPu S @u Wh}jsu  SҪYEtuhz h{jEP EZt hju1EVtRUW[T ZYU}tRUuPh@ hgHH9Tt$hk@ hgTj)? j ? P4Z,H%(h֥?@ L _1ҋ0t` xtO(9u 09t4#HɋL TuQPh ? ,딅u hB? ^j > YjmZti 119X~M%9u>uW<Phv? hi? h&4j v> F뫃 u]e[^_]we[^_]UWVSӉϋuu0 Zt2tVWP董 u3U1ɉ [u1V@ZV7 R Xe[^_]UVSu]}t Q jbNPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6uZQ BpWY_u 8Q ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP< Ɖ׉‰ 9иr E8tP 8"uoP ;sC| C 9s} P "WVjY^u jP 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPHX1e[_]UWVSÉUMU1}E;E t[ztMUj8l^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PtXC$ue[^_]UWVS1@}u FO -E@} uE@ } u"PR辟[^uPR詟ZYu덅LPh^E 0+ tu 112L 17 uu _tHhzHPI H,ZYu Dž,E@0tj/Sy Y_0t @0`1DžTXDž\@PTP,SQ ǃu.@xuP0 M kTtHu@xPS{ YZHu.fDžtt0u_SrXDž,uTtt,CM 1҃0u$SrZDž,T(j DP0葽 ,D (t8t,v ,vL "SrX%Dž,(SqX(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(Pg_,fCNj ֋$B$@tPXN ^(SSo LEHVUE [@2Ex0$,S ZYu,Shl hj@PV膧V8o uhl hFjSEpE0  uShl h`jSXE}G }xG }G1e[^_]UWVSu]}t W= Zv JI WUYu2I #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAu@}uE$EXExtHu E؋Exu[}t1}t.EH  H }ue[^_]UWVSQu}uG EX$Cu S{0u3PE 0IYZun?-uGPRU@ YZUu{(WR? YZuA{ Cu CuHPE 0YZtPE 0ۗYZu^ G CwH$T P艫-w7a w7DaXZ1u(7S_uCPhjȋK 11PE 2Z@tEF EFC4FCF1zF Ue[^_]Ujj$QgZYt$ U PUPUP UPUPUjjgZYt U PUPUP UPUWVSu] FtVuVVP-kX1;}t$jbXt0TQ1҉FNG1 VuVVPjXFue[^_]UVSuj(j`fY[t2 EC1҉SCCuu SB @u SjX1C؍e[^]UVSj,jfY[tDÉx E CEC1҉S$C$C(uuuMU @u S!jX1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79rD GM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EV޽EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u jn_Zt$pSuCCC]e[^]e[^]UWVShɦuhЦutÅu'j`h hצE !B  VYSQY[@8Fthݦ^F1󫍅Nv󤍝tJvr󤀽uCU9 t hj|t uh!jP9jS1PhJiu @t1 h=蛮 Xe[^_]Uhp&hMQ XZUWVS, =`) ƅƅF1RhKiu3 @PXujPY_VjWhQRP qpujPXZpVjRhVpQPQ hW8 $,hR8 ZY,tRVRSPh, e[^_]UjhIiup @u hj1US]DD&9t@tu)@5)X ujjS3 ) u DD&DD&]UWVS ]UUEt ;0uK &f|JxuEuE} tˆUPu ZYUtC}t:=&‰EHffUtSUBf<fuhE9r^h E9rhҧA X1_EtE &WtU0 &fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uS &f|PxtN=&119} fLOu0t ,@t@ޅtt SVhSPhS*=* %h.* Y19};Phh* GXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s< 1LuÍKكt :M؍AMPYZtfP׋Me[^_]UWVSQUU} uj[UuhRZu hj|jPV6 u} ]e[^_]! UWl$1E|Ru ul}UWVS,E u:[u hP hj6Y@uhP hjPQy Z@u hP hݍF1jR" s3 ^_C xyDž@Rhih @uhP hI ZYq:u]S `)PjjhVPR u+t"ݫtVPhy-' ~ Xe[^_]UWVSu FPZu0: 8+u1h7j:\`%1juS64t \vSh iR9 @u9 81t9 8/th5 Xpe[^_]UEU =a)uRP*ZYE EE&& UVS] t4sVu1 ZYtC P;UuPVZYft1e[^]Uhp&hTF XZUWVSSÉ։M1S>_u}uJhxjjhP0 uW&DPtVh:iSf @؍e[^_]UVS]u1ɉh@uh hjEPhSA uC8 )EfEVh9iSƒ 1Bu hj1e[^]UVS ]u1ɉ@uh hjEPh٨S t,juV E؀8t-EPhS u7 )EfEVh9iS=ƒ 1Bu hje[^]UUE9@t-EMfuu tURPh¨# ËPt<Pt2PPtPt (4øËtI't?t2tt (4ø UWVSljӉʋuFEE9s]19tc  ^w@v|UShWE K 1UvAE9s:2UFPhh)ȉMPO M UuRW u9utD7...}e[^_]* 1e[^_]UVS ]uVhiS @u hjEPh!S uhhX hh+1+ E߉EVhiS uEhp茢 XE1e[^]UWVS$]uӹ!1j EPhS?uh4 hjEVhiS @u hj1e[^_]UVS ]EPhS uhh hh+Q* uVhiS @uhE؉EVhiS @u hpjQ1e[^]UWVSxhShu@uh hjDžDžDžDžDžShé]_Zu?Dž1ɉDžDžDžDžjSh˩3 u ؉8 &DytRx:uL҃0jWVhzPt;9u8tMhԩjjRVjPdƒu2 ;t 1҉Ŕ@|Phi8uƒ 1Bu hj]e[^_]UVS0]juVhSо@u h hV<7Zu VhjUf@fEލEPhiS4 @u h+j1e[^]Uhp&h;ܫ XZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Phjh [P\P <fDžLVhiS @t%fNth=_)t h%2 XfDžLVhiS @t%fNth.=_)t h8 XfDžL VhiS @t0Nf=) PhC _X=_)t hK YfDžLIVhiS9 @t0Nf=) PhQs XZ=_)t hZ\ X1|󫍅|Phi8S @t}u(j H $PhiS@)_ha EEEEĉEEEԉEEEEE|Phi8S^@uhp Xr}uMu u uuBEH~HE&DJtx:t~&jPhé uWhi@ ^_Eyhé( Y111Pt՘hXZGj, DYyhé Xhm Y4t8hy XZ h Xj  _PhiS= @PhiS! @jh P萜 u ftePh= [^Vf"fP'2Ph  ft Ph ZYj  Xe[^_]U81EE1҉UUUUUUUUEPhi8uF @u hj1UWU1Rhiu @u h+j1}UVS]EPhS1  uhhh hNh+9" uVhiS @u hjX1e[^]UWVSÉUPh S[ Ǹ) 6 9|j< )X$j< ))_ j- [/UEPhhi EZYUJt)Dj>j Xe[^_]UWVSƍt1fDžfDžRhiV y h}j h' 1p)֍H(@!P }_9p}p' Džp hhhhTh=h5hpphE (G(\G!PO(!W Y )t  )E!)tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P-h )Sld`VPPpphʬ G"`G!\ƃ0`*w/wNtA2FltU0W=_)FQSPhh Ql=_)==_)$YdPhz XZ&d9 ʃlylRPh2 Cz빀=_)FPFPFPhh F1d^1ɉll9d&j> [S=_)FFPhWKStRTRPh$ RPh.r l대=_)FPh5H XZlF=Ptlbh@h  Y[=_)FPhE FPhJ ^ fdV\ǫt5X\PQh  \K XdˉX\lT\lXtWl̫Pt٫PtPt(4PQh  lX 렊dزT<\t=PuEFu:h]h XZ=_)%FPFPhb{ t#=_)l򸳭h]h= Y[=_)FPh{ XZ1D dD ҃L ll\ltdRP\Q4 h Cuhh [X=_)FPhEz FPhJg ^V l\lǫXt5dlPQh  lK dNjXfld\ Td\tR\̫t٫tt(4PQh  \K lXkT؃dPhQ< ZYkl=_).N=_)'$` }itsnti[`Y RK D(=068/B(G!PY` tF)`j p )hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh芎 XE1e[^_]UPEPhȭu= uhh@ hh+ ME\UPEPh/u uhhL hh+z MEUVSjjj"L y hѭ \1ɺxBhPS裺 y h舍 ZuufiuS荻Xe[^]UpPhiu< ulh& Xl$Eu hjEE1UPEPh\u uhht hAh+? MIE@u h8j_1UPEPhMu uhh h4h+ M E@u hTj1UUS~ tp t y Jt1G&]á)t H@4} )USE UUXt=EEEE1҃UjURP 뺋]UE PujnKbK Ã=)tMUEE EjjEPEPjEPGƒEBuhƮXÃUS E=)tF9Et:EE jEPjjjEP{G@uuSh5 ]UE PujJJ UE PujJtJjٕUWVSj褊 N^ _9ȉ|+)ډE܉UE9}| F@ 1F11~胱 uEvh!z[^E=)t*h){Yth)F$0hG*j tvhoj ~(]tz uvhXZWuS1}}}}jSj+ y hЯYF,P08vF,0hj j|Z1EEEEjSjeF$P0vF$0hP j e[^_]UWVSӉι1j Pr f6j SP\ E8}u Ef4Sa v\jSP` PuPhCoXZ e[^_]UVSыX u X(upVpɃ0Vp e[^]UE조)tQMQUEUUEjURURPPtEphgXZEXUSpd?C YtPV?s$N?XZC(tP??s,7?ZYS/?X]Ã=)UWVSƉӍ1Phuj P fDž6jEP' ff>ff[1h j}ZYu؍e[^]UVSÉ֋@ tP>s$>XZ6vhI)C P1L C t)WC$u!shs =1s 1O~uBC(tP=Yv袯 C(C,Zush̰s(s=1C(몍e[^]UWVS EUA u1΋Etytj84YtڍP 1CEuhd#h CP9K {u S<Z똉u b1C4}u)EC0EX4؍e[^_]US]SeDPhjݏSI )P)~ UuÉ=# t5r t-t={ t#m} tTy tp cðsUSP荳jh 聱jSYuShNjPZ@uSh5j ]UVS]E pt&I>v S ![^]USh:h)h)hSw SG]UWVSlE`E]U1EqEh#RJ uSEPSjuV? @uhDdUE`EEE1EsEE[EhR uSjjjVhhbh;> 14 jZY@t1҉)j Y  8uM=)u) 8 tjEPjs t؋U 8 tCuh=UX# ]UWVSd15)|~11ۉ]]]]]E}W]Sj uVSj  Ãjhj[ ZYujw[1uuuujEPj蹨E1}jhhEPhQ( hQhܲjsj u6hy[jjjr jWj jVj j1ɉ G&jEPjWr ub 8tvh/Z6UE$E9uW,Ph{jWj jVj # Eƒu+=t$hajS٨ =G&^ =G&tjWj4 jVj* G&pÄt8=t1 SEEEEEPX)jWj jVj  e[^_]UWVS( Åu1EEEEEEj]Sj] jSjS wEEв1=)uE1ۉ]jEPjS t%h)肫Yth)hj VhQ趿hhQh׳jq hhQh jjjp jτZiU9t/jVjoǃ u 8thhQh&Ẻƒt(ƒuIhhQhqU # y=thhQhP0jS{q=tt9u=G&p uEEEEEPҤXu={ e[^_]UWVSl1=={ (E`jjEPh)h@umh Z8EPuVh#_ @t5U1}EEEEj`RjjjV4Vu)uh) _N9t hִ^-h[h) ZYt=={ uF1)1)jjhhmh;8hhmh;8 É؍e[^_]USQjj]Sjjh G&3thu}&ȭ)Zu haj躾jjSPjh G&3u‹Eĭ)]US Phhp& hp&h} Shhp& jd UE E ] UWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9t4 (  9\$ t   11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t4 / $ 9L$t   11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]4  $09tu  E 11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t4  $9L$t   11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]4  $9tu  E 11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]4  $9tu  E 11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]4  $9tu  E 11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t4 9T$ uwy|$y|$L$ ˋL$ ˉ$4$19t4 9L$t$9T$t 11 [^_]Uh jjh@G&u 1҅tPUWVS jEPEu_X1E9}2uSP ZYt!SP ZY tG1EEe[^_]UVSQË0tRVh!EPVQ)ER Ze[^]UWVSQ1:nuzouPX1҉UhzPDZYt98nuxouSP/-ZYu}SP-ZYuE1V(Ee[^_]U PPPh'hp& jp UWVSÉϋu ,PQPZYu Wh1}uHt*hV ZY41Uu1u4h[,P ^_u~u M }jP賞ZYt1ihVjhW uU jZP,P t% 9|\ 뭋QRSG u) )u1BhWj Vh EtEtEtEt6 u0P,P 7ZY@tjj@^_,t#jhS\ uhԸV Y[0tShShhV 0 ,Dž@hz,P1 XZ9 PW@XZڄtVB L<-u.1j=V Y^t$S@LS4Q ,t1ɉL=)t>}uh _17=)u卅$PY@uNhߤZl XA=)u}t2ҋ4h= GXZ9j X=)t=i t t6h'k X t #XP#=)tj}t0$ՙjΙj(@u hk _G&,W3h)h,Rj P,R3 8tV,Rh'M0k ;u 8uWVWhk j t "[P"Y}u, Ex](טjj  WS$螗 ~)t}u2h&,P6w XZj P$U ~j,P` @uhj X,Ѓu ƀt&qttP)PVh" H}) )0SV2Y_@uVh!i XZ e[^_]UWVSj Ph, ;11to tZď t =)t>ȏ FktTQPh $ !ǃ 끍W.ktTWPRh? udtjktTPhT 2 t 0h hx XZ=)KtSp+F=)u=)KtSpktTQRPhb, =)hTh sds`sTsPht slshs\sXh 0=)~chSjjhju.t%j S賺 ^_tShu h6{- Y't\PhL XZ He[^_]US] 1t-tPu ZYu)1=)]UWVSEt48nuxou )Ps X1uho_af X1Y,u@B uP_uha1f S[^ljxj,S蔹 ZYt X1e[^_]UB Phhp& j UWVS]!11tE1҉91&111ɉplh@u u 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVSh"c,@uL t!t" 0Z2tHPShwj艧j UVS]u VSYZu Shj舧;/t"Sh XZu E e[^] e[^]U Phhp& jR UWVS]E1ɉ#11d111lhhu u追 HuLf$M,9tQG.C|g$ UC| C|C|C|591 CpZDžlL591CtXDžh.591CxX591Xjuh 591u hjѥP@X591> XDždC|&P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPW8^ Y^@uRWh j xPW^ YZ@tECp'xPW] YZ@tǃluECpECtuE%CxdupV ] V @$XZK|ǃe[^_]UWVS SVdPhWu u hWdShV芵,@uSVhjf@tKRPh< hSSha 0j USP]jEPS%_ U :9uySu h-jV]US]SZt@ heSZY]US]SZt@ hSsZY]USP]jEPS^ U 9t :uy Sh?jˢ]UVS]u VSYZu Shj̢;/t"Sh XZu E e[^] e[^]UhDjdU h`hqhhŽhPh+hp& jk UVSQÉj EPS] U:uVShEje[^]UWVSuEE@t") 1VFe[^_]P _u ho_j͡VP ZYuj ]e[^_]UWVSQ]E10u1G&hu u< 2F$ =h)td)뷃=d)uh)c뛁K뒺a91C8K t l)hK\cPD91jC@K@2K&g91@Ps4K I91C(KK@KEPuh 591ƃu hj!Et l)tctKtK@tK t=h)d) s=d)th)c@tKt1҉,H&sc sKsC  sC sheV`)Y_EthpVC$KXZEthgVC KY_EthmVzC$KXZEthvV]CPh h" # HxUWVS]u uu uQ fMA1CCS1CC@)@@)ȉC1҉SCE ȉCЋEȉCԋEȉC؍~E$PWh E$` 1t<16 1Ƀ 1Ƀ 1ɅtuRhrjȃ1ɋuЋ} t1M 8"t$M tM9uM9t Suh맋E9ƉU}7=)tuuWVSuh uuWVSuh?9u؋E}<=)tuuWVSuhv uuWVSuhje[^_]g_UVSf =)tPhhp&< hPhhp&" hp&hI G XZ=) ttsh9hp& j萳 =)u UP~ UWV=LH&uHH׉=T)t&ɉ HffJ=LH&u f@ffB^_]UWVSƉ˃=)t/=)t 1}mQ)X)Pui Pס)RPSu5)nl9t s 0rPWVh^ j"葲 e[^_]ÅtUWRPCS Y_}Ã=)UWVSSƉˋ )=)tSu X)Qh S׉ș։ЉEMRPSu5)vk9t 0PWVhi j$ e[^_]Ã=)2W|$wUWVS#Å=Դ)uд)BB4)Դ) ) ;))ؙ=д);|*9Դ)_1)։ؙ5)pؙQ Y JtRz!9t !9t ҋ1҉ؙ=)Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ д)A Id t15))X=T)t)5д)PPV )xU th{X)H xU t@\M؋]ȋM؃=T)t)5д)PP д)A Id t15)д)̴)JH,1X9M؋}ruuhĵ д)\E1ҍMQRPuuVlj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuuYK` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05)д)_\T)@xRPuuyWÃ=T)tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu %ClRPuuVÃ=T)t]Su,XZ1EtttpN Y_DpTtF u1EM Y_Fu @ߋu %CPд)H05)EЋUpXe[^_]g_UWVSQEӃ=D)1}=LH&tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Shhp&. ]W|$wUWVSLEUȋ д)A Id t15)yY=T)t)5д)PP )xU th1҉U؉U܃xh _1E؉Eд)X`u؋}܉ tu}}zU tStX~KM< Ʌд)@8EU܋)J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh0hp&z Nt% tSt1\uWEahMÍ Í ? # Shwhp& д)$~?)EE1uԋEЋUEUClM )EHд)̴)EHesE@E=LH&nKdu؋} t1RPWVW}WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWVUMQuuRPSEыEȉEEeƉϋMUeuuRPUEȋ}EЉEeЉƉϋRPWVV}f E9C0u'=T))5д)PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋) д)9A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 д)A Id t15)$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1󫡠)=LH&t@fxfDžA& xk‰|fDž I&=LH&tK&д)@40u 1ۉ,д)@DJL!ȉ!؉ pZ4JdQyt@f fDžA ]‰P(,iKL04H89sv Dž19s H11WVRPBKRPBȃȻ)щWVRP=F 041~ H`9))HRPSQA1ɉ<؋Fȃ1~H`F9}Shc G д)C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=LH&(C|HL!ЉjjjhjC4PjWF £̴)uj'+ д)H41д)H)̴)ȴ)H4 ډĴ))ʉ)@`#PL ~ PhHH&P<h)PXd)P\t)1҉PTX Hfǀƀ$ д)%ƃC4D8<KC,ș)׋C)ȋ1)׉C8HK` tƉ׋Й)׉!lj!׉11ҋ!~ ) 1҃1)׉@D04=LH&>C s(H1@)t ǃ^F=)s0Kd t1RP߭ڍ,VV$h д) ؙy8PۅI4WW$q,h2ے  д)A0= @ ))=)u\Tu kУ)jjjhj5)jB £)u)9)uhl`j&ċ )1=)L))9|RPh ))5) ) [t?t  Lș)FOu뺸2=D)t?jj5H)S$=)STb )uPؙVpjV uؙ=)VY)д)Xlj=T)t PRXZд)x)\=)~ hXDž=)~ д)A,XÉƉ׋ǁ\TtA!A1׋AId t1RPhjj誎 f&&ftRhht@P~ DžPu ft)=)tu1'1=д)1w,1д);x, h&k д)1҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h(_д)1=))CU C )C5д)$~N`Cp=LH&u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=D)uCh|{lN`Cd9sh%P[)д)P t+)lj1ɉ1xU u@\€ )H xU u@\€ )H ?xU u@`¡д)@`д)$~%)Bl5)Fд)=LH&~!{8)9rKd1VT~U uVT~U t PFXƋP1~FKd1111f3д)@8P!tx ))D4)Љ)9s?zU tR`ك 2)B$C1ҋ9r)д)H`艅 д))BY89&zU tR`A`д)$~%)Bl5)Fд)=LH&Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rNд)5)$.Nh񉍸Flx1Dž1҉)D4);xsxU t@` )@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹ȴ)Bȴ);Ĵ)u^=T)t)s4PP )@)д)Z4Jd15))ȴ)д)H41[д)Z0 } )؋5)=T)t5д))P5)4 д)X05)ދvxx д)\t4Tu %Fl %CPO붡))𙋝ڋÉƉ߁TtAЋ!A1׋AId t1д)Y\Tt=)]s8)){0ƉK`Cx1񉅰69s)9s)V %Cl뀡))9rߋ д)A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==)j. X܋ д)𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1guWVRh81 9]=)Dд)P,t,=)t hK X1j X1b~j X=)tjtx|m_u=)thAv5д)04=LH&0FF4+=_w hYjJ)X󥋅`1=T)tR5д)蘾[^)=)t ǃ\8 5д)x\󪡄)RP)SMY=T)t̴)д)r4PP蔽 д)X4HdLH t15̴))Z;ȴ)sE=T)tд)r4PP8 )@)д)Z4Jd15)X5)5)- д)@4P5̴) eY[^_]aÃUWVSu]tVrI_uVhL&jaH`1ɉPhd@u l tGRhedAu x @u! 8tuhc&T XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h2ƹ ߋSh{&V`oCPh&VRq C Ph&V@qCPh&V1qCPh&V"qCC,$C,Ph&V qC0Ph&VptP X}!uhzd@u 1w @RhedAu w @uuh&jF41}󫍅Pu ^_@4ȋ9i9t(Ћ}1ۉ1E1ɉ [Eƀ*Ppj PEPw 1e[^_]UWVS4}jhPjW萛tGjPjVWV+u$U ʋMQ؍e[^_]UVS]u VSSYZu Shj#E;/t"ShV XZu E e[^]? e[^]ÅtUWRP Y_}UWVSuuuuNÉ֋EU)jj`RPT Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8CUWVSƉ׉ˋ )%)RPSu5\))9tWVh h"j>e[^_]Ã=)uPUWVSƉ׉ˋ )%)RPSu5X)")9tWVh hAj>e[^_]Ã=)UWVS==T)u14)$)T) )11;))4))9r(9T)1)Ӊ5d*pPY JtTz!9t !9t ҋ1҉15)1ҍQXe[^_]W|$wUWVS$E։ϡ$)EPڤEYuhȤ haj<H) 1RPjj P)f|uPjj hȤ hj<B 8)1uME@Ztjj hȤ h^UBP)@ 8)1u $)P)fK 0)XH)<)19։rWVhȤ hj<P)1ҍMQRPWV؉EءD)RPuu]؋K1ӋE؋@(1҉¸ڋ 8) t1E؉Uu $)D)RPWV&M&؋EÃ=l)t x)ߋuEfEf%f=u0c Cdu $)E؋Uoupe[^_]g_ÍC(u(UWVSQU=P)f to$)9reS蠢XtX 8)1V@)_9r)u $8u@)t%1ɸAuV˪[1uˉ8كshФ hj1: P) 8)1V $)aVdP)fH ZYesf@ ,)4)؍e[^_]UWVSj8Pv E \)EX)5)F[_tVh)C!؉t Sh0jq9 )9s QSh[whVhjD9v hVh9t SVhסM&=M&f uft Whu @$8) <)5$)$()F0)4)أ,)sË f)É$8)D)14)x$1ۡ))9׃}SQRPhUj8$ t$$)D81lj 1=) w ) i;)s))1 1XOt t \Nj)‰ 9sCÉ$11  D1ȋ )$5$) ) <)@)1H)M&ƻd1()@)D) H)1ɉ L)8tDž111 P)T)X)S\) `)d)N1=h)l)|))) k fp)REfr)t) fM&fx),PDSmXZ,t hSh)1)Y^t&St Zv h\jSh)Yg ) )1))l)@)|)5@)$)$)+4)1 v1ҍN11WVSQjD19sȋ)Ë H‹ )9s؅u|)f))Q£P)Xҋu h1@))|))fH)f fӡ4)|119 t4tu )HtHKC H9u )fC tfCfCF@<,)0)=)$Ɖ5)5)5)$)й1PVuhj @) 5H)P)P hi @)@$)`*jjjhjPj@ £d*u hl `*1=)up5)=)9| WVhGRR )\ ^St1޸ =)~ h^[Dž =)~/ H@)4)1RPhjjtg f&&ft0Rhht@PHa DžPu2ft)=)tu1ɉ$1҉1 1$$9 h&D X=l)t)t$] )$fz)$@)14) d*$) <)5P)5`*)֋$ @)4)ȋ 8)15)1SX$)`)1׋<)H9$u^@)$)+4)$)ȍX9s`)@)‰э`)1ۋ$~9s ƃ`)C$_9sك`)C׋$P)8 8)1h`)H)`)1߉$))Ѱ_$t;P)D0 8)1h`)~`) $)1^1T1`)@ u렡P)| 8)1h`) $)F[;5H)s"1;=D)sM& Ŀ)G=)'$=l)t)t$~==)gj.c Y܋$@)4)1ҹguRP Qh8d 9[=)B$<)t,=)t hKKd Z1j Lc X1$~j (c X=)l=l)8|)u )"'O&/P&V1fDžT8a fV8\`dd;flfDžn$)Ɖ׉1҃ $((ˉ$ʃv)uhؤ hXU| 11EET$Euhؤ h 8)$)S趒_uhؤ h PS蚒$Yt @)1hؤ h;'91҉C4)D1;<)19 r )$1 8)1$} 8)CX)=$) @)9 9GPhؤ hq{)tЉtF 9rhؤ h@)‹ȋ$ 8)GB 9s1PShj%!xtuhj!PV}tu 0u S e[^_]UVS]+t!3xPhhh*2W 4jjPܜ ƃ t3xP6h2hh*V *e[^]UQPȉE:tEnPhX XZUWVSÉU܍Esu{hBEPEPEPVEPhW fERf PhW (EPEPEPh|W uwPhiW uw PhSW XZvNE9sGGPhh/W ݍe[^_]UWVS0ÍEčs\+tEătE<u/\+FVPVPhj<u+\+t{FVPVPh;uUEع}uCfE\+t"fUfPRhLV fPh5V XZe[^_]Ujh+j @u h(joUVS11 *A9ut *‰Љ[^]Ë &Q &y ;0&| t&J &Uh&P [ XZUWVSh *~+*\T&.*H*$t")*\T&]*xt%=*t >1ɉ *\T&h&o1 hp&e1 *,* h XZe[^_]W|$wUWSøth+hBT XZ5x*h_wT 5p*hxgT h+t PhPT _Xx*t?p*9} h1T [()(MMEuQQ$h T j S p*Z1\+h+EEH*ۃH~-@*]PP$tLRR$SP*QQ$SEWW$S hT&PP$ShQS <\+**!]**Ezuٞzu=p*\$=x*$h R e[_]g_1UjjZ XZ1=p*PL U=`T&u =p*ujh(upZ x*ZY9*~*\+ueUSá**xFأ***wr\T&y1]Y]W|$wUWVS*x*ff"*t* *=0*9=$*u ;,**f *f*]f*1Ej]Sjj5H+4yhB[jh+jjh*5H+.y\+t hc _EjSjj5H+*4y hj:h *jC[^*t*f *\+ s$ ,*ɡ4*ȉ $*(*s$*,*+}f*Bf**4fpjh(+jVP5L+/Ã9t:y h YSVh+hf hp&a, Z1`T&x*% x* +x*@x**,** * *u*,*,*,**Av.}fE fEm]mE* *5X*=\* * **`*U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}* * *,**H؉ * * * *E**=ɚ;~ * *-ʚ;*h*rW X*\* * * * *`***=ɚ;~ * *-ʚ;*\+t ;\+te[^_]g_UWVS<ÉUM\+tUUEčs}uyMăA}9}fE؍t E;t*uJ1 *$*u5}t4\+u+JEPuhL Ѝe[^_]W|$wUWVSEU܉M7C]\+MQURuhJL t h9L XWh-L \+Y_t,%E LRR$PhK ]+t"uCp&e[^_]g_e e[^_]g_USv=+u SPhhp&ON jE UWVSƉP¡+_tEtPh!E +9U|} VhGjktt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ +1҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPsiPVhU S_PVhc{I BhPSj7 PVhqSI S^PCPVh7I h&% Xe[^]Ãt"¸7ttURIZøUSљRPQhSdh&SE] &yUh&j -N XZá&P& UWVSDuh&$ e[^_]ÉÉhaH aXE1ɿ!t0\Љt }uCEtHP1DA u1tЅ}t2}uKU1ˉj.h+EPj聒 :U1ˉugVPhj.h+F h+h=[G XZT5+VPh=8G G 0=+UWVS @<tPhF Y[C tRh?PhF ^_PhF XZCH<$ hC PhF C  ScsshhF C! <t` <t| COS C #CPh9)F CZYPfwk$ hKhHE X1ZhUhbhphW"E _3huE ^!h}E Y PhiE XZ뢍A9sh蟌EԍsfCfhw:ffEPEPEPEPEPEPhAE jfEPEPEPEPEPEPEPEPEPEPEPEPEPEPhD ~[Zt?EXSX]YuWEEPV~[Zt#}uσ=+t$VD?Z@u6'V5?XuX }u MU1 +U1EDe[^_]UST&tuPG ZYtC]UPu*fxu#@Phehh +x:  + Htu DPSPQZU}uE ҃' hmhRRhkPPhsL; UEt#t#tPhRh/; XZUVS$ E׉Íu 9stMtJ@Sh: XZe[^]UVSU#tYE uLjjEP~ à uU1j.0 Y^ƅth +@P+F YZuUuRZZhPh +4 +e[^]UUE Pjjhh +PRn%thhSnh + +UVSE UMYt @ȅu˅t6t1R )˅t8u3jSNZYt%u#hPh +3 VShhh +7 mVPRhhh +7 DσVQPRhhh +7 VSQPRhhh +7 +e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uh#h +EN [^vthN YEPjjhVPP"t hSnVM XZSVhhh +5  +e[^_]UVSMQ +Q!+يۊ BZ XÃ@.)օ~=+uC +[^]UWVS uE Eԃ=4V&tL1ɉ 4V&hh +e [_u(j.h +i _Zth@Ph +0  +uhh#h +q0 F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEPa[^uԍEPmZY6e[^_]VPFPhhh +4  +e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPhhh +3  +]UWVS(uE MMԋ]U~u)ẺUЍ}عjuVZ_XUЅҋEtuu SVZY SPV }yE Ee[^_]^4 tEEԉE E@e[^_]=4 EEԉEE E0e[^_]4 UWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]Sqyhg)EuhzXe[^_]PcXu jjjjVWjSpyh݋EEhjzXE9^CU!‹M9A}tSyM9,sxEt  Cy;8V&t8V&PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h*h*h*(2 &H &$yh&j 7 XZ&P& }e[^_]yjUUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һ3~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(USx Ph:hp&+3 Shwhp&3 Shhp& 3 $Shhp&2 Shhp&2 Shhp&2 $Shhp&2 Shhp&2 Sh;hp&2 $jY) UVSƃ=$+uPEЋU WVRP$PWVM]SQPuh~uhe $uXXeY[^_]aU; Phhp&" j UWVSƉUσ=d+u'jhd+`+ZYuh虠 [`+Xi d+}u)VUP{+ ZYUub`VUPR+ ZYUu9Rhh`+k%ƒ `+uPhjK k1e[^_]UVSƻ@V&tPV* ZYt%Vh!5P,! x, OC St8tPRhz RhzZYuj 3h , C,,묍e[^]Uj臷X=$,t%P,fPftjhP jh+UWVS=,5,ÉDžu¿4RWhB5P, 5P, PhPh&$y'1=0,ShS5P,u  &fDHfn,f?trfauH,Shc5P,) (fptfqt#1҉,5P,h軪Y[C10,Sh5P, &SSh5P, e[^_]Ã=0,tO=$,tFUVS5,,,1ɉ ,1U5,,u1҉0,[^]10,U+jiZ=,uj舆X,t,jmjh+}UWVSxEUtk1ut=tu&DSt1@֋]څu$EE%@ &t &fBuӃ}tgh@,B# [ƋE]tC1ۊT,t8u9s&H@, CuݍHȋ])=~ E봉EE} %Uй 1]1@,trtl$t\uF8PuQ@@x0~-H8tWDЉ\C8tu\:u;81ɉLЋEǸ@,:[tL\t$ HWыu)@,-x$uvX&DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2&DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5&D^tS@0uU tZBGOu)~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuP EE5P,hb詥EXZ‹Ee[^_]USEU t~M袣g@V&P,tRQh P r PhBx,ZY/t!h ,h~5P,` 1x, B]R]UVS]5 ,u9,twE ,u1 ,@V&8t 9XtShjm@u= ,th ,Ph#s PhsZYu,5 ,e[^]U}u{x,]ø]U}uVx,]øԔ]fU}u1x,]ø]AU}t h`,h5P, x,U}tءh,h5P, x,U}t褡h,h 5P, x,UWVS1}uEE PPEu IHt}6hBE PEP> uhME PEP# t}E p,XE Pu E4, 0,t!tVWjVjjhRSYyS X x,e[^_]U}u]U}u 輖h hh!5P, 1x,UWVSE]uu1҅‰uTpuCE xhWGZYu u0HhW}GZYu1t/ uPVh15P, e[^_]Uh9h,u uIx,U}u•x,= ,tP,E EC]r]Uhwh̢,u ux,UVSE] u1=Ȣ,Ȣ,u{yt @shVnFZYtBhV]FZYu 1Ȣ,4Vо^sh5P, 맣Ģ,Ȣ,노Ph5P, =Ȣ,t5Ģ,h5P, 5P,heȢ,Y[t1҉L,x,e[^]Uhh ,u ux,Uhh,u ux,UhhL,u ux,=L,t1Ȣ,Uhh,u uMx,UVSE] t~ 軓1=,,u=shVDZYu,hVDZYu1,9s,^hsh+ ,+, A ,,8uQPRhK5P, ,x,e[^]á,t8u5P,h蒔1,ZYƋ ,Uhnh,u ux,Uhwh|,u ux,UVSE] u CuoshVlCZYu,,,_hVDCZYu1ɉ ,,,HV谻Zy$sh5P, 1=,,,,t  1,,PQh5P, 1=,x,e[^]UEuQx,HuhE PEPD tЋE phaYZu9=x,uJ= ,t5P,hĒXZE phHaZYu,,1,USUE x,u +Pt ]酐pYtePZ@u Sh h @Ͷ=,t"h,h5P,Y 1ɉ x, 5P,h4XZ]] =]UEt~x,=HuhME PEP tӋE phY0`ZYu ,USSEu蜏x,HuhE PEP菿 t0,h\jE[Xjh+dXYE tE ;u1ɉ 0,jju 華à uu=0,tڋtShY^_[Zu ,E =0,u=$,t,,1ҋt0,,tujXZ1ɉ 0,]UEurx,}Ht}6haE PEP` uhkE PEPE t}E phs^ZYu!E ph{j^ZYu ,UWVSUU] 3E=$,t5,,1ҋE _¡0,t@0,5,uj×ZY1ۉ0,EM9t EP7Xe[^_]UWVS}u <jju@ ÉXZSCYujjEh# à uQj/Sy_ZڅtPhRWA =,t65P,S=P,HQPY^y Pj ( Y^ J }~j5h,hWSN@ jWS@@ Sh ~ x,j ~P_Z9uWjd[^WjXZYt1 h} Xx,e[^_]UWVSPEEu萈x,%HhE PEP胸 EwɋE ph#X^_t 5P,h+Y[}h:衫Zu ]E XShEjXS 1 t뙃}hMWXu ]E X ShW XS 1 t-U}u"E X ShWWSg 1 ,$e[^_]Ux,}t;=,t =,u#踭=,uP,E E_h,h5P, 1x, Ux,}t̆=,u#1=,uP,E E4zh,h5P, 1x, UEukx,{HuhE PEPa tӋE phVYZu9=x,u<= ,t5P,hXZE pheVZYu ,UEu΅x,{HuhE PEPĵ tӋE phVYZu9=x,u<= ,t5P,hDXZE phUZYu ,UWVSu huS 9}1hE4S¼ F 9~hhgS証 GShJUY[Hu jNZ,e[^_]UEu誄x,/Huh#E PEP蠴 tu uh- UEu^x,/Huh8E PEPT tu uhR UEux,[Ht}6hE PEP uhME PEP t}E pphXT USE ,u蓃x,2 ,Hu hiSYE phtSXZ ,]USE ,Pv6x,2 ,Hu hSYE phpSXZ ,]USE ,u݂x,2 ,Hu h*SYE phSXZ ,]UE} tu腂x,=,thRXU} t}uIx,Ã=,t jjXZj`Y=,t jjuXZj Ujjj UWSREEu؁x,=uE Xh?Xu]ShWRS 1 e[_]UVSEut0HuhW$ZYt.hW$ZYthW$Y[t뷻v<ZtP,u6hRp t(,t$,5$,5(,hR@ 1x,e[^_]UWVSPU} uRUyZUuUE DP,Ee[^_] Ë@t P1ɉKXWNCZ= ,ttP3hZ5P, e[^_]USEU x,t tt<]]rV&t8CuPRj hq5P,O jrr 1x,]UVSu x,}t e[^]qvxXuvhD5P, ,Ct P1҉SY3hz5P, 1x, e[^]US ,}u|qx,<=̘,uP,E E])s ,hA ,X]USEU  ,Hvqx,P=Ԙ,uP,E E]r ,Hu h>AYrh.AXZ ,]USMU  ,Avpx,Y=̘,uP,E E]Ar ,BuPh$@XZrPh,@  ,]UWVS @Eu} t px,AHhE PEP tЋ5 ,} 19~j k,Pw t*Cu%whl5P, x, h@hP,P> 1ؿk,X 9Xr&DP@tCP,<$t<\CFC &K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP,)PE 4VL E 43߿iu6CDžؿ9}~),)PE 4V E 41 ƃF;r<,0oXu 5P,hu!5P,hox,^X~ t=,u 5P,h΃= ,t:5P,hP,oP,HQPYYy Pj k YX J j 6R2 <,P58,V =,t3~t-P,HQPy;P| J Pj XZh@PhP, q8,E<,E 9XCؿt G9}ce[^_]USËt P1XCt P1ɉKXCt Pw1CZ]USd+jyX=$,t>裌 Phjd]SI ~!P,fJftPSR& jh +AUSdjJyX=$,t>A Phjd]S ~!P,fJftPSRČ jh +EAUWVSƉӋ:j:W YZuWhV; :W P]YZtj%W޳ YZtWhVW<C uf{P Huf{tCPhnVӦ h=VŦXZe[^_]UWVS ERU ZEE0U;OwuCuRS] uCEÊ u w)tu C;OvE1e[^_]UWVSË@t PB1s_stV& Y1Ct P1CZe[^_]UWVSljӋu,u<MPyFE8 u@EuhXZ,HEHwuE1e[^_]Å8UWVSH%Pt=&ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u hjljjh P uW1ɉK fCPjhW uWC fCjhWУ u WC _t36蟝v蕝Cv芝CF C FfC (Wuh" Ef: j/RU! ^ZEUu R%8)ЉUHQM諜ƋMQURP/ { uEuCYj@Vʯ ZYt_{ u1҉,Mq@P輜j:Ep藯 t@P蜜MAYE@E@tu[uvVj]RUP YZEtH:UttWuVh2)PERV MV耕u WuVhRtEx:u-u%p/Uj:Vݮ YZUt>t3 3ׄtK3Gpj EPV >tU:u PvWuVhw /fC*C tt5,u5,tV[CZ{u\{ t[P;CX1e[^_]USZKJy ;J| t Y RPJ XZ]UWVSP1ۉDžfDž1jhP趠 jPCZY@tt8tt8uVhuDž8tj;Pn[_ÅthPZYtChSY_t>hS_ZuhO[gVShDž DžsDžV蝙Éj@Pw t1҉,@PnYj:D ^_@PF[H8?u1;u11ۃ/j/S'ZY9u$uHsjh[S cu)uR,1ۅ%pu'j,u911ۃ=,Džt*1;t%h SZ ZY11u @11ɉ>t+h V _Z1ɉ=,=,t jj_XZ=,D hPW 1 t1ɉ,1҉,QP,,YZu u*(4#Hu9 uWh+ u Pj衾PjrY_t ;1$j/SG _Zu Jx;hhRZ 1ɉ ,Pj=,u/; =x,hp&h8 bXZt>ut>uGt>t݃t3hSS hh[S苗 hVS $hhSm 1 tL5,1ɉ ,=,t hh hhS Wj$5,F,uj/V[ZtP1ɉ=,t WjWjXZx,-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh +2ZYu PY[@S^Ւ<$Zffu0t#;thnS.ZYt hx3t$?t?u+u =,uhW+Y,,,t <,j/PD_Zt@,PZ PґY, t 8uthc1=0,=4,8,<,DžtDžx=,t0 tRPQ ZYu0,4,D,,h݁P˘^_44u ,4Pat$P荴 Y[u/tx8,<,50,=4, t14P1҉$WVP y,Ph = ,u=$,<$, -,Ph&5P, 0,4, P, u5P,j [^RPh1Qm hSh + Ș, +ZYuW@ Y9sFj DPAP ytD9u9tyPW)P藔 …Yt_ uu6  4, 0,t h)jYaZY,u<Pa$P0[^44@P_Xj`X,u<P`Y= ,u 4uvhW5P,P Ӌ ,t+Phjhf5P, hrV襎 4hV hVd_XhVWXZ=+twhV= ?4, 0,tP5P,hj6TY[54,50,hV54,50,h5P,A =,u&4hD Zt6PhV词 = 4Pt=PR艍_Xh hhVpt64u1jO1T94ujuuTu@= ,t;Rh5P,( ChHV賌 u&ehHV荌 t== ,t%Rh'5P, WhBVW WhBVF t= ,t5P,h\CR[^4h=PXZ4PsY@uh\AE 1$]jv][<415]&0É`h$ ]&ڋ_ucj SN ZY@`j lRPG lt&DB@`_2t1ySDžDžDžDžDžDž1ɉ\P ]&ڋZ\dqdt:j `Pd 8,<,`8tdiƅ$ dOud8*u@j pVP >p8-/@dj VPo 9pd8/Pdx*u,j pPR pd84, 0,Ghd+tXH ׉dRs^_Džh8HRy YtxdtdE2dt]dth{Xrd`ujh U^_p@9Cd'tWdƅu ]dutPYVmZt<oZu&J4, 0,hon_t 8uhڡX+PX+~ h0^} ,1uQu2P7ZYu ƃ +9u h 8"ty- "+R)Ph; ( u @;t+h= Y[t$h At@ uƅ= ,u ,șu+1jPO XZ؉|tL𙋍|9Ή| ||=Ȣ,S|19=+|19lj||Nj4PWj5+ςǃ1@,D,|)ډ|8+@DžftSY^uShSXZpEVqEUB/ @PqEYFEPj^XyOEEPjvx,-_Z1ۃc)EEPj蝛Cx,-Y^cw u1uEZtPX؍e[^_]US- +jH+@+ X]US +jHX=$,t%P,fPftjhP)\ +@+=@+t jh`+ ]US j)HX=$,t%P,fPftjhP[ +@+=@+t jh`+)% ]U+jGZ=$,t%P,fPftjhPM[ D+10,+jh`+USd+jUGjdh ]S蹨 P,fJfuPSRZu7Yjh+_USd+jF10,+,Yr]tsuAjdh jdh S5 jdh Sq P,fJ ft Ph juPSR@Zjh+UWVSƉ׉1ۅtfNftщUfEڅtfOftщTSfDiPREPl ~1tfEt fT Ѝe[^_]USZKJy ;J|< t Y RPD XZ]UWVSXEUMEEE̋EȋỦEԉU؋E1҉EUĉEU} tE EEjEPUB [^蟿 1҉u}1ɉM19E9ƉM}PuuYà yZ 8tP 8#EEEU@,D,EESuuXEЃ y 8t 8#ЋE)Eă}tNEԋU؉EU P,E9@,D,]| ʸ#xEԋUEỦEԉUQ҇ X+u}} jEPA EU+EUM[^+My @B19@B)PzV Z+ 8}tI @,D,19}6;Mu}P,#P, 5P, Xս 8Ct 1}e[^_]UWVS$1++hjyChFjgCDž@+111x,11,u<PBR5+iǃ R5+eiY_= =~ -v!R5+5i_ZsPhR5+iZYTPhhh5+ 5+觅 &5++jAX}t9+@ t.jBjAx,114,jSX= ,t21u4ȭ hJ 5P,9 5P, x,jAjwAE 3= ,z$5Ht%&Dxkx, DУx,x,=,uZP,=,u)BP,=,tnu~tZP,yu&x,1=O5Ș,hO5P,Ω P,u^x,w7t~*u%&Dxu=ti1ۃ~UuO t+)t&?+sX@CW=51$du(t9dt5d -uut1x,u )b5E9@ , 5u$ ,uP, 5P, Xx u@uhPh+襟 =x,u+t R_t$x,9tu1t1ۉ4,j=j=j==x,t ujOY+!ȅ!Ѓ„tt jZ+F!ȅ!Ѓ„tt jXF(#e[^_]UVSu=+uhj |x,[11ۉ+hj<ÍE PV5+U 5+h=15+ 4, hV+ ^ZPƋ+Y!ȅ„t tjYSjU<XZe[^]UWVSDžXp,++jj+PM + yh h# ,,tjXRjhPޅ+<t <=,=,5 ,=,u  ,h WÉ5 ,_~It,=,t#x,-wQ5P,h /Y[=h+h95P,豤 =,x,-v+,h Z=,=,=,5 ,=,u  ,h xÉ5 ,_~It,=,t#x,-wM5P,h .[^9h+h95P,ң =,x,-vtP,h Y=,u9 =l,t 5+P5P,h y  uh SF _Zx,$ w=t5P,h ,+<t <flpRPdPRRRP`P\Ph h@+蛛, \`dtk=+x,$ lpRPRRRPh h@+  #+1f+ Ћ Ћ ȣ+lp ff+9+YlpRPdPPPPPPPPPPPPPPPPS`P\Ph h@+\t-5P,hU +5+L+ \u`u dt 5P,h 붺+1f++@ulp ff+jh+h+ 5P,h F5P,h 6h S [^^1ɉlx,-w 5P,h ERpRRRPh+ h@+螘t5P,h6 U*XZ:u:u:u˿++󥋅pff+j+Ph+5+Xy/+=l,wP-KX+1p,>=+%h+j5+[_Zy h  ^+=,<<+<+P+P+P+P+P+Ph Ã=,^=,Q1҉,++=,t f++tPJ_jj+PNF + y"h  ^ ,=,u#jXRjhP!~@uhD $+Ph+5+w y%hn Q Y5+oI+x,,tjXPjh5+}Džh+1󫍅hPR5+ @h x=,,,=, ,t$=,=,\t+<u1ɉj j WhStPtP5 ,=,u  ,WS\h aÉ5 ,~5t=,t,7h+h95P,͛ =,u Iu<t=,+P+Pj+P+P+P+P+P+P+P+P+P+P+P+P+P+P+P+Pjjh HÃX1st ,<uBDžXjXPjj5+1{5+F+X1=&5P,h. e[^_]UWVSD}+=p,tWPHjjPEƃ HPj5+E @-+EfEjEP-- M]ġ,ZZ<ډEUjEP- M+M̋EZ[+Ey@Biy1QjEPV  8t 8#th +EEPEP5+Eà ty5+ME+VjSD@t?}uEjEPjjSyW5+葌 Y[QuhF ЬX5+D+Z1(K 8\= 8#Nhi  뽍e[^_]UWVSu1ɉ +hj.E[_t=,u`++=,W+`+5,,,Ș,thPBUP跏 UBCȘ, ++ 󥍺++󥡬+<<++@@+,DD,,HH,4,LL4,,PP,,TT,,XX,,\\,jhT,`UP j`PhT,l jh@,U썂qPV $jqPh@,@ ,U쉂,hh@,P hPh@, $hh@,UˆRߍ hÈSh@,ɍ uj,+ t1+EEe[^_]e[^_]UWVSQ}j/Wv[^t#9u jh[jWZ XZ/jhgbE Y^y Wh x nhWh`+% a+ƀ`+. d1.F9t@BUUjh`+ XZx9U0t8u-Ou5P,h XZ10jh`+谗 YXy`+F<.u1F@F0볍e[^_]UWVSu+u/h 訨X=D+t x,1Ee[^_]<fDžƅfPftjjWP< t h@ Xhh5+@ 5+m +Ã(t h X=D+t x,jD<Xt(t#fVfthWP> jYu=x,(ujtZjlXe[^_]US E1ۉ]huz ZYt E3=,t8E,u=Ę,t=,ۃ9,u%h kYt!5P,h$PjSxXZjOX=,u)5P,hZ[Xj,Xx, 9,uh@+hrZYt}jSLx[Xjh`+ZY!hj(Y[E0,4, uuuhI) Hu.RPhz tԋEPj(XZjxXbj8$_XE@E0,4, uuEu PhI)# Huv@+j1$1$vE$j (XZjY1ۉ@+uu h5P,t RPhz sjh+|Y[hj'XZ1ɉ @+hu [Z¡,tt =4,tSjtjUXEt1=,P9X=4,t(MEu PhI) Hu\j[뼋Eu(Eu PhI) Hu/=4,tjY1=,PZ=4,tCjX=4,tqj]g 1ҡ+~j1$X=,u06u=D+tx, h Xj.8Xj9Yj1[=D+t x,EPj&XZ]UWVS1X`Ģ,pt,(1\@,D,8,<,L,H= ,t}u=,tTuu u E 8-u}tuh5P, u h5P,؎ ʡ,9,u:1ɉdDžhDžlDžLEjh+[^u#jPAtXZ뺃=4,j9Xh$j$XZhqj$Y[hh*u > ^_uDžT&1L,E 8|u]jj }$Y[lE Xh݁S}^_TTuSh XZ]1=L,Dždyh݁u  [^TTu u h yDždtTfzt T@xRPo ZYxE%=tu h5P,7 EЋUԣ8,<,?jh+9^_c50,=4, h3uڕ ZYth=uǕ ZY,twCTfxu TjWVPT@jWVP yu h A Y[L54,50,hz *DžL}tEuuhI)a H,LZ\\uCuh^_뽡(,hh h6h 9+s&+tPlY(,+PIZ+j"_l@ujj !Y^l=Ȣ,t=L,t =<,y Ģ,1ۡ,8\fxt \PTfyt T@S5,5+ +R uu h XZ& 8 @,D,P ta\`RPPG @\@ @@,D,TXRP(GPY^@uzt[pt95@,D,|@P,#:5P,c _ptĢ,pt륋\`RPj G @uu!P\@ @u@,D,pt P,9@,D,|P, T@ @t,ʸ#詙 Xu h XZ\@ @t"聙 `Ih XGjXdtdTR^1T\P= 1ɉ\ $f[zhPjXZDžh=4,u x,c+xPl4X+\t\P~ ^1\j[x,1;@,D,}jYh@u l@u"hPjRXZ㋅lPj @^_+xP3[+du \u)TtꋅdTRY؋\P ~ XHL,1҉0,4,@,D,e[^_]UWVS1,4(0Ģ,PT,O1=@,=D,L8,<,L, |,hu迏 ZYDDu =,uVu= ,t}t}u&E 8-u}tuh5P,` 뺋E Ph5P,G ɋDtE uPu 1ۉ8Dž<Dž@1=t,uDHjh+ZYt=4,tzjXh$j%Y[hqj^_<}tWE jP2 [^E j/P=fZY 8tN 8 tDE Ph = [^x,$ E h*P8 _ZE 8|uuU [t,gb%E 9u jh[E jP茇 ^_/ jP} Y[n=,t F 8 uW@: 8 u"E hPV4_ZyE Ph6=,t 뽃=,tE PYE D,uJustYjjiXZ,9u&ju/^_8,<,x,ujPiY[=ujh+$_ZVDu}u-k0,4, tRPhz {͋E8t8PuhI) HYh݁^00uuhY[ȃ}E h*P2 _ZuDž(&15L,5|,E 8|uXjj j_Z@E hE@PlY[((u E @PhA15L,5|,Dž8y=E uP Y[((uE Ph yi XZDž8t(fzt (@xRP{d ^_@tE%=t1ۉL,|,$,hh h?hj9+s&+tPɷY$,+P?Z+j|X=Ȣ,t=L,t =<,yĢ,$1$,Dt@0,4, t/(f{t (IjRPQXw 5 ,+ +(fxt (P0ft 0@$VSm u0^ 8 u@,D,h(^ڃD4, 0, (jjjP11y4E Ph @Y[1,RPH=[Zt׃ t;50,4,(|jjjP떃 @,D,$@,D,04RP<XZ tl(,RPj = @tz(@ @unz04RPg<^_tA UL@L Hu (,RPS< @uq$u{PT9ȉP,#55P,X YPTĢ,ډPT@,D,띃@,D,PT P,95@,D,|P, 0@ @tJʸ#Ǝ 4蹎 8 u@,D, h(Y݋(@ @t耎 ,E PhEXZjX8t8(R^1(0PAt 1ɉ0 $j[Lu@,D,y3`LPh=5P,g} 5P,hqXZ뾋D$ u=|,uj6 _苅8=tju)[^X\Bu@j`S ^_X\lp1tE SPQZY@XP|k $L+‹E $Ph5P,| `jh+ZYt$x,1;@,D,}4jX Y*hj^_=4,0PA[벋<@u @@u"\x,轌1.+=+u%DžjPjjXh݁k +hEk +=+tuh+^4= ,t5Ș,h'5P,w jr[~"+tP$n Y+tFPn Z=jSjhWjShhWȘ,(x,?#Xe[^_]U5P,h9XZUE }utx,hfW~ ZYEt ue[^_]3ø=,tPh5P,t W&t$=,t~ tP3PS2 SQ%YE ]e[^_]*yQMZƒMuQWh5P,Bt KSu QWh+ދ}u#Uj PMQk MMEPjUR rPj hq5P,s 릍e[^_]UVS`P, @,,$t!uItJuB,h,1,P`P,]&8!]& u @ u,tJt ,1&,h, tGtBB@"u\uXu@!@B؀"@tՈButB@,`P,:@,`P,,tHt ,1,1h,[^]US`P,P,@,`,1ɉ ,<,1ۉX18,{P5<,0XZt8,@ڋ]UVS P,=$,t,SP$^Z8tPh5P,q 5P,K jh@hP,h&*y}uB5P,hEt.=$,t P,Hy Pj Wt Y[ J ]x=8,?<,0ZÃu 5P,h+u 5P,hx t =,u5P,h[^1ɉ ,j 3uVh <,0P58,S =,t3{t-P,HQPy;P| J Pjss XZ{  qhM&jh&j e[^]UEt]1]US]u hpj5SZu Shj5@]U=]&u ]&P,fPftP(&Z9]&ÍL$qUWVSQ@ , L, jP +,,_[+ ,y @B8ڽ߭ݕ @,D,=,19}a؞v3߭ٽf f٭߽٭؉ʃ. u1.WPSQhhPj ٽf f݅٭۝٭Q~:Qֺt.RPh)PPj Ãօt Phh)PPi Ã<RPh)PPi ؉1ɋ9ϋ}'t' @Ńu4 %%y)Džkdd%1 P%1҉ RPh)PPmh 8@,D,19݅8,<,t50,=4,9H)߭߭ٽf f٭۝٭h)PP8g à t!Whh)VPg Ã<RPh )PPf Ë+,,Ɖ׃,9}19},h)PPf à h)PPZf ؃ uP,fJftPVR+ eY[^_]aUSz 1;@,D,}6=$,t%P,fPftjhP jXWz ]UWVEE왉U1E}ujEPj? e^_]U0E E1EԉE؉E܉EEEPEPuWq ƒ xEÍL$qUWVSQ@@u5jh,X,,0,4,,,XZjP!0,4,@,D,+,,_X,9},9=,,sB,󥋵5,=,1w~s9؋}gA WPh"hSc P,fJftPSRjjj-jh,5=L,uhgjjujjj =L,l%_hqPS{(,Y[tPhhP c x8,<,19߭y<ݝ݅ (߭ٽf f٭۝٭y1d~dVhX)P=PXb NjH,~-(,t Pk Z)Å~:ùdh)Sh Ph_)P=Pa ǃ119ʉst @u4 SQhi)P=Pa +,,+ ,y @B8ڽ߭ @,D,19ظw ȉ߭Xs9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4 %11d PVShv)PP_ á8,<,9lj@,D,)ލ 9lj݅99Ћ}hVQ$_ à +0,4,߭߭ٽf f٭۝٭?~~hrtPhhVQ~^ ÃhgVQk^ à <ЙRPh)PP2^ Ãuh)PP^ à P,fPftSVP  eY[^_]aUSar jSr X]á$,@ `t1US$,HyPY Yu1ZJ,ƒ uɍPv"u|,$,HyP?Y ZuJ"\u%$,HyP Y ZuJCC$,uhtY,,$,HyPX Zu ZJ, „t@Pv8\u"$,HyPX Yu JCC$,uq]&=,th,PVi ZYuC ߸ ]UWVSQƉUh,PH[_tHj.Vr1 [_1ۅt6uP"ZYÅu#)Wh,Vr$ u1ۀ,1ۉ؍e[^_]À=+tUWVSh݁h+` $,^_u"p 8th+hbY[1$hS _ZyƅEj.S0 [^pu Džp1btH uuzG uҋpȘ,uSpEƅt1;4 3*%u_3uGE uh,} h,PZg ZYtE thP;g [_tB$,fPfttRPC@ ZYx|?thqhw$xAE85h,=}X $,fPfttRP? [_x"|?thgqhO]qE8h,}z=,t5$,PU Yt u $,Hy t u5P,hJɋ ,u5P,hXk,,,$,HyPT Zu@J&DB@uGG9u u ,u3,+=$,HyP0T YuJkPk,B,k,,$,HyPS ZuJ< u6 ,k,9,u@ , {u@ ,KZCh,ho_X$,@tRR [5P,h(XZ5$,Q Y 5P,hۍe[^_]1US]&uhSHZYuИ,DB@tCjhS u Ԙ,UhSZYu ؘ,8hSZYu ܘ,h"SǔZYu ,]USZKJy ;J|< t Y RP ] ZY]UWVS ,=,u  ,h^tIh'h+P ZYƺ9¸} +.uh+Vh,5P,Y jhIh+Q 5,tjhh+3 uSt , Ę,1,j hh ,Q t\h ,h~5P,QY Bt 1,1Ę,t*j hNh+ga u5P,hY^_̘,И,Ԙ,ؘ,ܘ,,+ #h Y1u<̘,u 1҉̘,@u̘,1+ ,e[^_]U塨+tPN X1+,Ę,,=,u1,+1,,,tPY1҉,=,u1 ,U+j X=$,t%P,fPftjhP jh,4UVS](h 0jX=,tf+t-fPftjP5+M 1+ +x jP]5+R+ 1,j舾X=,t>+t-fPftjP 5+M 1+ 1ɉ ,1,j2PZt Shj26g 0e[^]UWVS],=0,t =,u$u 1ۉ,,Pu7=,uE,,P,@1ɉ ,=,h5,VM /thh[V hhVo V yVhXZ1pP= ,Xأ ,5Ȣ,L,1Ȣ,L,} t1=,P軼XEEEt!jjRPPh ҡx,-cvt+} t1=,PQX= ,5Ȣ,L,h݁V,U ,V輛 =,uuhh^5,hh,h u5,J 1ۉ,j h,% ZYu,e[^_]UVSQQMq ,=,u  ,=ܘ,ut95P,hPh=4YZuBj h+2% ^Zuj UR@PgM te5&DN@tVu=x,u=ܘ,u1ɉ ܘ,t=,u5P,h+P, XZz ,eY[^]UWVSQ4MY= ,}=x,}=,u  ,=И,u}5P,hEfPhn^_j h+$ ZYtj.h+$ ^_th+aW Y+uKjhvVZ u7Vhz5P,]R f+20h+h5P,?R + 1}VV ZtVh5P,R EPhVA tEEP]D _uu ,u\] ,gu=x,u=И,u1ɉ И,t+=,u"5P,h+>P, XZE ,Ex,eY[^_]Uuhj2h@,u hj@,UWVSP}u jjhjWh6V@ƒu&WhPV@ƒ uWhjVm@ƒ USj觊Ee[^_]Uhh,kvZYu,UWVS,5 ,x,=,u  ,hS裩_uSj h+! ZYtA8thUWS$]؍U1EEEEPShu\ƒ1uu8\Xe[_]UWVSu] }VuS6\ u1N tuJtXfN lSHL ZHˀ; uLUJ9uD Đ&y h&,? Y&H & t@u҅tjff t1҉e[^_]UVSQuhP,K [áP,?vPhjuhPF CƃP, 1҉UUR@)RP,Ph&yhuh5P,xF jr8,19<, U e[^]UWVSD]} S\j j VhRuW. t&hh(4R= j h(4V= ,tzW9Vt vuvvS  @uT5V 8jjjhSvv:.thh(4S#= U 8ShOY[4jjS ƃ u(PPh&hPjS @uPPhfDž=,~"jP ,XZuWS @-U 8$}uU 8A^PPh>] >jP+‹Y_+y@Biy1fDžRjP uYT 8u=,~{fT 8#tLVjSƒ 1BPPhnu$T < tQDžPPhhS$@uS S e[^_]UVS]u S?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL Muj RP/F 5,5,h#j؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh,M t Džh,)ȋDPS4F hY[< u5,5,h%Ph1hn))=w(SXZDžh,Phh,S 5,5,h%1_1ss C1C1҃u\#u~nu ,T,@ fl,l,5T, _1+0,=,u8#uxnu ,M 1M I t0,,t]Ut @uKf 0,-t0,1ɉ X,=l,;G l,,t1BJM pЍe[^_]U ,@ t=\,t/=`,t@HyP YuԋJ5 ,PtXZ1UWVS|u= ,uQh,8u==\,t h(j ,&,,&,),, ,tQHyP4 Zt@ J5 ,Ps5 ,h$,h(,4ÃYB ,=&u 1~1Px [=`,tdh`,R h`,5,Թ t $l |,9,r|,kP5,,XZ=,k 5,1,15,{u5,s{Y[ =,uuu =,z ,t5,CPj V u,H @))Ӊ,SPV谮 Ij5,5,h,;jjhh,j5,5,h,Fj5,5,h,\ jjhh,Aj5,5,h,) 5,sc,<,@=,&uX=_&u[h8 Zt8tP__&X9TPhht@j5 uVft_&_&<=_&u _&t 11<tR<@PP7Ht%tv$@P 1DžHP u?F;5_&r5,hc5&^_5,j$r5,j e1.W6YtKWN8ǍZ;_&r5,hc5щ^X15,Hj@C tfWz6YtZPhh 6 _ZNj_&,t;_&r5,hc5XZ1@HЉ0,Ph)5,),B 90uH@)< F;5_&r5,hc5袈Y^5,j$5,j ,@ @7 ¸:t& P$;P5,h"j, ,u45,5,j5, =,t5,j _XZjh,g^_1ɉ ,jjhh,rjh,,@=,5,5,j5, =,5,j XZ=,r,=,BHPj W ƅt*,4),,H85,5,jWy =,t5,j ,Y_8,4,, ,u45,5,j5, =,t5,j XZj`|,9,r|,kP5,9,^_=,k 5,CFP) YFG=,%=,CH@u. ,t$P9Qs@,R5,Ph)j}5,j1ɉ@9^Z"1ɉ ,,1҉HLC0tZt,uH 9Hu;Ptj0Wh,CP Qt,pP @9u9t)HL1LH9L}jjQh,t,PHσ)HLL'Hj@$YZ"L HjHWh,9Q tUAQ )HLLHj@YZ t,QNu9AuAQ 똋 ,j)ȋ5t,PQh,~CP t,P @@DjH+@P@Ph,8 t,,,,,,t󥡼,,Cxt45,5,j5, =,t5,j XXZsF uq=,u~uhh PBF @t"5,5,Cp ;,t Cp jhCp躡 Ht1 ,=,1,[=,h{uhh s褢C @t5,5,sG ;,tshjjhs Hփ=,ujjhh,o\,,,,,,\=,,Hw{5,=P&t 1,,,9IFTu@1*jjTPkH<9Hs B@9u[0QPVku 0uՋ@9s3<jp$(Ph,.<jjVh, )H*t,,,,,,t󥡤,,5,h5,# $, ,u45,5,j5,? =,t5,j [^?Cv1s ,ue[^_]U塠,txt1҉P x{u@jjhh,US];] ttCtE8t  1:"u#C@؍e[^]USPYt@Uv‹EBu Sh*j蟸]UVS_&tt2JughVP à `jh!jhVP薔ÃDh&hV?à u h*jMj P ZYth*jtS$hjVq ؍e[^]UWVS Ӻ*_&uRPh*hVƋ{sCsCV <$jjjhRWPVs ssJPtPh*ZY1@QRBPBCVX $jVp hjRp $V:'Xe[^_]UWVS։Ϻ*_&uRPh*hS ËNvBvBS ZuQQRPSGPP+tL8tߍURP9jjPEu׃UtEuSh. EuR3:XZ1e[^_]UWVSxjj@EPjVQuVh "h_XIDž||PhF8Sz @uS莖h4.jVh?EUY^ uh>._h`RPA. tPhgY^0E  1WV%1RPhI.6=,t_EPhXZ=,vFuhX.uhc.U .t*.tBPh^_ &yh&j ;ZY&P& SpXe[^_]UWVS vFt Yhd#5Yu(hd#hp.j裮{ jh|.W0 tV<ZuS 1҉SjPRi ;uWh.Y[뭉 8uዅs Cn]VX1e[^_]UWVS E׉M=,vQRPh.JEE1E}G ut`P8Ëw(,XtJ9G$tR G(ErUf9Y9EUurUa8PS UuŋZP$ w83jjV;XZE|jEXijw7h݁P] uh.VPE:Y^Uu h.jcR`ZtPh.jvPh. +jj;‹G$Uw v6UBZ,B tJ H,B,1B Uԋw,G$uEV7EV7S7ES7]܃SVu؃VPuu,Uth/u/Uuu6u ۋUu% PhD/^_}t u7[1ɉM1}t EBE}t uS7XZ0]{Ee[^_]UWVS u V0ZtP)_uVhq/!Y[K SjECP6Es6 =vh/h hNXC1E<GPƍGEPVSu9th/h hh/E D>EPuhh&juV躶 Ht hdjh& $&fZe[^_]UWVSu }th/h hh/vEw*vhW4à uWhy-XZ6}uhPVf V FSh?PS<e[^_]UWVS)uFv}h/Vph)jhPjE 0Ãt^DžPhF8S @t5 t'E 0h 0S  DžPcS_E phS L uShy-u(hLS9 S޲P. E p-[uuPz,XP"P tX$YX&Zuh$0_"X@_&t$t Ӄt t@0DžP1\E T@X@tP3[XH PE @\SUXGYWLT0ZX@HH$  jjh ST肑y h30PS`P pP=Tsq=8 f=T[=TPStURPh PTy h!]^=hM0JX= 8=T똃uXX1u!s1CV1ڸe0XLt%t [0us1{V1js1ɉKVx1jڸe0aXZVWg1ZYHW0s0s[0^_HDjjh PTЏyhu05fUjjh PT虏yh0\DžH4`jh>`PK^ tHuhu僽l\u1p`BJ13 9u@th0YXTIu\@@싅TT>\Xu PuE6؋[H!ʅuP tHJHPX1҅uӅth0Xh0_X@ T迉[^X# T袉XZ1ɉPPe[^_]UWVS(,,50,uE}9s_ t f t!UEE =~ @  9u ` B뚀}tU ,u5,[^_]ËD,<,B4,B0,,,8,UPh9hp&j@UWVS<,u3j <,_u 21ۉ@,15D,B@,S9D,r14VP<,ZYtT01@,e[^_]UVS]g<,tD,49u>u"8t 0,8,J 4,JD,$,[^]US]t5<,tD,;u1҉{t s7X]]*]UEt?1҉PPPBPP@1ɉH,<,t D,;u]0]UWVSÉs 8S3C(<,Zt D,;t C 1ɉK$1tfVftPw ZC 8e[^_]UVSu j0Yu 3Ép VCZtCUC؍e[^]UVS]<,t D,<u'D,<,4h@5,rXZ<,t D,e[^]UWVS =,,,,=(,u (,=,u ,&=,u ,&<,t D,<u'D,<,h@5,XZf=0,8,(,}E f t"U؉}E ~ @  9u` Gf@ u}tEأ ,Eܣ, u=, , u5,),8,=0, $ 8,=, ,5,6L,X,L,,P,,L,,P,,L,,P,,L,,P,,L,,P,d,L,,P,F,L,,P, (,L,,P,  ,L,,P, ,L,,P, ,L,,P, ,L,,P,,L,,P,t,L,,P,V,L,,P,8,L,,P,,L,,P,,L,,P,5,5,%L,_XY(,b%,5,5,Z%P5,/&,L,L,15,(,a,T5,j5,5,諧 "+,HE8,D,<,4x,uP4,,@,P 4,M0, ,MM9rz}Elj=0,if t ,=,@ Y ¸ 9t  ` 5,u=GYML 9s ?3M)ˉ]x(u K|EHE1M9s ]@x,uH1ۉ4,XmZ u؉B UԃPQyUԉB[Zt2]أ0,]X u"J0,)ȉEzu1ɉJw3 v 1ztd,HyPl YuEJ <, D,tJʋMDF9uMH1 F54,l 1҉5,SjD,<,upV4,u4,@ @t)q 8t 3+] 10,f` 띡4, D,<,B1ۉ]u7}u5,`YED,<,@,E4,Uڋ D,<,4A9Q s4MӉUSPMAYZxUu 3nX 4,@@D@,}t$}tm}lj=0,e5,uN1҉$,t ,0,(,H>=$,Z5,MXID,<,4,Bǣ0,¡,E31,@ @=e[^_]UWVS]tU<,t/D, jVj@Pj@PSP4(u1EPj E+Xi@BE+` e[^]UWVS hp&h$5^ME Y[E EEEUE0hp&j.yXZ0u]]ՋMEe ʉSQRPcɋE‹E )Й1)9~Nuhp&hrLXZhp&hcLY[e[^_]UWVSƉωӅ~ Vj KXZuWhL5Ve[^_]US ÉUMEt8Ph?EP @MUu jjuu9XZ]UWVSÉU}E PmEPEP E ~USj UJYXWhSW Mt1ƃ19}~G2~(Shb5KXZ~USj UJXYUSE8PGUBYXShQ5DKXZEEe[^_]\e[^_]UWVSNjA tX΃y$wPPPhShT5W:F$4 hShf5W,v,h=/1҉XZe[^_]Uj ,1҉PP@ @1ɉHHHUWVSP]{uC{uh*.OC_{ t1StJPP^1k$_&WRUx ZYUuG C Fu3Phy55 e[^_]U9U]U*UP]UUP ]U UP]UWVS}WPhc uCVh ZYuCVh" ZYuCVh5 ZYuCVhy~ ZYuCVh&f ZYuCW8Y{u Vh5'XZ؍e[^_]U-UP]UUP]Uj4A1҉@@@ @1ɉHHHH H$@(1҉P,P0US]t?sss s s,s0]]X]US]t&3M sE s CE]뀋]US]H{$L uh5 {uh6X1{ uhE6{uhp6ك{t h6X{t h6X{Wh6uh7띃{t h57}X{u h_7|{h7u h7\{t h7<X{u h8;{h@8t ho8 Y{u h8 {t h8Z{h8Kt h 9X{t h99X{t ha9X{t h9X{ tLh9X?t h9yY{t h:hZ{t h-:WX{u hS:V[0]UWVS]uhy:GP Ǿ_&XVW# ZYt $t`&u3 Ph: Cuh:[1e[^_]P Y15,tW4  YZtFWh:XZ{ uh:몋CEe[^_]EUltU]UVS]u H$h CjhCC PCPCPhFPRjhChFP;Cu(h:jVbCZYuh;X [0S1e[^]USM1ҋt8u X0P0H0ЉU[]UVS]؅tsQw$ hG;hl;7Yx th;@0u C C$C(jh C,u[0tFjuVaeYZ@u h;6돍EPEPV_E tPh;XZf1e[^]US]؅t\Qw$ hG;hl;dX:x uh;@0ƒ;ts, jh C, [0u1]UVS]u utFPwCFPwCF PwC FPwCFt PCPM XZFt PCP: YXFt PCPXZF t PC PYXF$t C$F(C(F,t PC,PXZ؍e[^]UWVS}6WPh;6 uVh; ZYuVh; ZYuVh; ZYuVh=;ٿ ZYuVh;¿ ZYuVh;諿 ZYuW~Y;u Vh<nXZ؍e[^_]US]u ZE ]]$U@UP]U0UP]U UP]UUP ]UUP]UUM t‹@0uJ0 ]UVS]u uÅtet PSYXFt PCPXZF tC FtCFtCvsLCvCPiVI؍e[^]UGUP]U7UP]UVS%u Ph/<# uC$C({$u Vh@<XZEC EC,؍e[^]USu5ZtF@t?xu@SP0xtj!CSJH1ɉJP0XC1C؋]UWVS]h݁SϴY^DžuDƀ;/t0Shr<h)hS-h݁S虴ǃu Sh{<2W4W蠪 XZe[^_]UVSu]NSh<>YZP$ Sh<}>vh"+1ɺUSh<Sh<L>Sh<<>v<U v#U v <U v(U vh;8M 1҉ U Sh<uSh<Sh<=v<U ;vh;8M 1҉{U YSh<v= Ph=XZv01e[^]US]3LP:1ҋE s4P*=1ҋE s 4=1ҋE sٔ1ҋE CPwQ$ hc!hh"h5 hyh&>=1ҋE Yu js PhL=XZ]UVSu] &t;thES YZtE ue[^]Shk=l/XZe[^]UWVS uE 1҉1ۀ>1E E@tZt u t tEBP[VƉE_X1hkEP詼XYt(UPhkM ZYUuGR耼DY1VE MZ؍e[^_]US1;] }E4{CX]USEU M9t0@B[]Uj觼1҉PUWVSu} j苼ÉxGWKC؍e[^_]UEp0US]t3X]]]US]3E X]UWVSjËE @UBC@PU2JB} 7OC؍e[^_]UWVP}u VWEWPVJEe^_]US]S $S]UE]USjauhxP3C;u jjt؋]UE ujp03 UWVSu} j É8WCJ؍e[^_]UE0pUS]ts^X]]Q]US]3E X]UE@]UE]UWVSM] 1;u&9tqC8u B1҉[^_]UWVSu} j'ËY9sЉPjZCXZ19sʃ9sVO2K@׉؍e[^_]UWVP}u VWEWVEe^_]UWVSPu~W葹WP6a~uh=$6h=ʍ 9sPRh=S1RCPES Ee[^_]UVPuVkEVEuUWVSutiPERU׸ËUUEPøEȉCvNjMuuURS{uu0S*XZ1 PuESu Ee[^_]UVPuVMEVtEuUVSu j+É0VCuj QRPHt S*X1ۉ؍e[^]UVSh݁u ZYtu PS ؍e[^]UU>} uU E]UVSuu PVE ]e[^] UWVS@EEEEjjEPEPjEPtE@tEȉEEE1uԉuEjjEPEPjEP-11@t4XZEEPj[^@jjjjuuu ujEPuWj4hp&j.EPj͙@~Mȋ]̋EԋU9u9u u9u~Q9ȉE)ڋ]9]}19}v MDEEPjSZY@jjjjuuu ujEPuWu4hp&j.EPj@Mȋ]̋EԋU9u9u u9u~ 9ȉ|~)ڋ]9]}]419|uGv ]hp&hc!3u9u1EE8EUe[^_]PhD>jmht>jmh>jmUMU tt&1u.>t%>>t>;t>]UWVS0]u SzYwzK0<C,9s1S8U1҉UȋS(U}ԉEE܉MC4u9sMSuV _ZuVYuEVSXZEče[^_]UWVSLuE}(u(Q_EEE(EEEEEEEE E1EĉEȉẺEЋEEԋE E؉u܉u1҉UUUE8Eu4EPEY^u[}$t }$ދM(},tE}0t?u4EPu0u,"t&u(Ssu0u,hSEu(SMS Ee[^_]Ujju,u(u$ju uuuuu uUjjjju(u$u uuuuu uUjju,u(u$ju uuuuu ucUjjjju(u$u uuuuu u6Ujju,u(u$ju uuuuu uUjjjju(u$u uuuuu uUju"UjuUjuUWVS]uSZYu&s;119t]  2 AJxe[^_]UWVSLuV= ÉEE$ljESEZYtOtKE EEEuVuVG 1ۅu0]uh‰EXtuSV- 1ۉEuuS Ee[^_]Ujuu u-Ujuu uUjuu uUju uUju uUju uUE#?#w ]UWVSjuZYP [u!u u Ǎ\3u u j ؍e[^_]U E D$D$E$" ]UVSÉ1ɍU@EEU T uXZ[^]UWE }_]UWVu }^_]UVS]u 1ɋ΋T11TAu[^]US] Ee…u)҅uURqEtH))H11)1E}t E@ƉEE1ڋM1SQRP?e[^_]UWVSUt_ztY1;BsP1ɉM1;Zs8EE܉]EE1uuRU^3CE܋UE}u@1e[^_]UVSU/:#zJ zutAJzu JzutAJ$z utAZ,vwKwgJ049rTz(tIt@w3J4t'wB@z<t [^]UWVS}u 1;^sj1ɉO@_DjHWhPF G@jHWhP F@ ChPXZe[^_]UWVS} r}hj@SG0jVS#GjVSG, jVSG(jVSG8jVSE$jVSG jVSGt%w PS GDtw w1G XZGjVSpG t wPS\ GjVSGG t%wPS3 GDtww?1GZYG$jVSG t w$PS j@uSE e[^_]UWVSH]} tKtG{(hs SWƃu1s W}W0jEPSWjHW$e[^_]UWVS$1ҍ$h3$h[$l$h$luNj$󥋄$PD@@5т歁RQ$$$PL@H5l>+h$$$PT@P5kAك$$$P\@X5y!~[D$pT$t$h$l$$$$$p$t$$$$$$$x$|$$$$$$$$D$xT$|$$D$hT$l DŽ$6_DŽ$:ODŽ$+DŽ$rn<DŽ$;ʄDŽ$gDŽ$ɼDŽ$g j$$$$3$3$\$`L$d$$T$`L$d$$ˉ11ΉP$$$$3L$`3\$dL$ \$$$$T$ L$$$$ˉ11L$\$P$$$$$$3$3$\$XL$\$$\$Xt$\$$$13$P $$$$3L$X3\$\L$\$$$T$L$$$ˉ11L$\$ P$$$$$$3$3$\$PL$T$$t$P|$T$$3$3$P$$$$3L$P3\$T $\$$$$L$$$ˉ11$$PL$h\$lL$x\$|$$3L$p3\$t\$HL$L$$t$H|$L$$3t$h3|$lP$$$$3L$H3\$L$$$$$$$$ˉ11L$x\$|P $$L$\$ Ή3$3$|$@t$D$$t$@|$D$$3t$3|$ P$$$3L$@3\$DL$p\$t$$T$pL$t$$ˉ11$$P($$$$Ή3t$ 3|$$|$8t$<$$t$8|$<$$3$3$P,$$3L$83\$<$$$$$$$$ˉ11$$P0$$L$x\$|Ή3t$3|$|$0t$4$$t$0|$4$$3t$x3|$|P4$$3L$03\$4$$$$$$$$ˉ11L$h\$lP8$$L$\$Ή34$3|$|$(t$,$$t$(|$,$$3t$3|$P<L$x\$|3L$(3\$,$$$$$$$$ˉ11Ή@= $$$h$lD$pT$t$$$$$$$$$$$$$p$t$$$$$$$$$$$$$$$x$|$$$$$$$$D$hT$l$$D$xT$|$$$$$$$$$$$$1ɋ$T3h3l3̨3̬$ωTAue[^_]UShP2XZtCXC\CPCT]UWVSU] tPtLr@+1  1uIMu}141|@u1ZY[^_]UWVSD]E tP?v 4PEE1EEEEUu1MuԹ1uRSZYe[^_]UWVS]u U73+KT KPM<})D`uC@SDC@SD19Ms11sH{LS`1EE؋EEEE܃m䀋E}})=vKC@SDEUC@SD1E9Es11sH{LU܉s뗋E-kU‹u)ƋD`lj1[^_]UWVSUM tA?vREH?w}t߈4]5Dž61ɉ:>B4F߹󪉍0T1󫍝dVRU[^U`t ߋ0ߋuMhSRhS1e[^_]ÍL$qUWVSQHAEQ1E}1};ST SP1C@SDC@SD1CHSLtCXC\CPCT)T3`1S`Uo}E}j@PhURj@S1eY[^_]aUWVS] u}UEu tlK?w}tut@wޅtPRSPSPZYxWVV xSuVbà hP؍e[^_]UWVSt]uE @wRPW5ZY1jPW VSW u uW j@WZYjPWH VSW5 j@VW| }E XEE )؉@Ǎv4jjj@Pj@P3xC jjj@PSPx󤉅hR|e[^_]UVSXp@J!ȉ!ȍJG!! ȍJA! у>у+?҃/ [^]UWVS É׉ιE1EtuEE9}saEE11E9t/FFǃщU?6CCUwʅt)щ?CEE [^_]UWVSEU1EE1KSz) ЍS!кZ) ! ЍKк9) ҃! +҃>/у? ‰ъA! сt>FEȉEEHwMKG];;s.U}G}ك}wMЅEuE81[^_]UVS100 wwk r@9t90uA9u1[^]UWVS]u {CEjuYXd>$u}FRUs $EURVӍ u\MC8jhBV賍 uFU<ƅt+EC8jhBV舍 uFUƅu EC,jhBVS u܍FUƅtˋEC(jhBV( uFUtUS0S48$uH}CUw{US8$lHEEUMƅOEC1CCC C$Ce[^_]UWVS,]} juuEЃ f$CE̍_V _9H}U)Ãv$v=BE̍SUȋEp8h.]SSw U9sIH}̉M)ƒv3$m=AẼUȋEp,h.SFS. U9r EH}̉M)ƒv,t=AẼUȋEp(h.SSه U9sH]֋}̉M)ƒv,p=AẼUȋEp0h.SS荇 U9[H}̉])ƒAf$CrEHpY)ƃf$VC}weZ@EЍe[^_]UE1tu@]USE vA1[]UWVS ÉRPuSP~PPU}tPPXZp x$P`d`ҋ`dډX\3C`3SdSDC@`d`ҋ`dӉ`d11߉XҋX\ډ33`ҋ`dډ11Ép(x,P @`d`ҋ`dډX\3Ch3SlSLCH`d`ҋ`dӉ`d11߉XҋX\ډ 33`ҋ`dډ11É $p0x4P@`d`ҋ`dډX\3Cp3StSTCP`d`ҋ`dӉ`d11߉XҋX\ډ(,33040`ҋ`d04ډ@D11É8$(j jʍ YXCE1҉} }}33 PQE PSs 0 {0u}jXXG;{n 0t001҉1RP !} yjte[^_]UWVS]hL,2Z@ t@@,@,D,L,@,h@,hlW Sb^ y hL,2XhP,K2_@ t#hP,h@W@S/^ y hBj-hT,2^@ t"hT,h[W@S] y hT,(2Yh,,1Z@ t, ,h ,hRW S] y h,,1_h ,1^@ t,,h,hRW S] t h ,1Yh,j1Z@ t,,h,hRW SD] t h,q1Xh,-1_@ t^EPhYW@S] h,;1h,11h,'1h,1h,1h, 1h,0^@ uh,0Y@ uh,0Z@ kh,0_@ Vh,r0^@ AdEܣ,tEࣸ,E䣴,,,E裰,tE죬,E,,,h,/Y@ t/h,hWW @S[ y)h,0h,/_Xh,/Z@ uh,/^@ tvE 5,V,YtAh,hfW Sh[ ǃ t;u 8#u5,31,ZMuyE,e[^_]b/e[^_]UVS]hL, /^@ t6hL,hPWSZ yhBEhL,.hP/ hT,.Y@ t;hT,h\WSZ y hCjI*hT,.hP. h,,y.Z@ t@ ,h ,hSW SSZ yhCh,,@.hP. h ,(.^@ tC,h,hSW SZ y h4CTh ,-hP,. h,-Y@ tC,h,hSW SY y hQCh,-hP- h,-Z@ t9h,h]WSdY y hlCh,N-hP- h,6-^@ t9h,h^WSY y hClh,-hPD- h,,Y@ t uVhYW@SX ydhC#h,,Z@ uh,,^@ uh,,Y@ uh,,Z@ uh,w,^@ uOh,a,Y@ t ,Eh,H,hP, Etbh,*,Z@ t ,Eh,,hPQ, h,+Y@ t ,Eh,+hP , h,+Z@ t ,Eh,+hP+ Etbh,+Y@ t ,Eh,x+hP+ h,`+Z@ t ,Eh,G+hP+ VhZWS(W y hCz1ɉ ,h, +^@ t ,h,*Z@ t , =,tch,hXW SV y hC,th,*hP* ,th,*hP* e[^]UWVS]h.\*^@ t!h.hW@S@V y hDh`,**Y@ th`,hW@SV 1=.h.)Z@ t .h.)^@ t .h.)Y@ t . =.t#h.hW@SU y hDj@%1=.h.)Z@ t .h.h)^@ t .h.P)Y@ t . =.th.hW@S"U yhDhc&)Z@ t<c&hc&h WST y hDDn-,(15,h,(_@ t ,h,(Y@ t , =,t!h,hW @StT y hD1=x,h|,V(Z@ t x,h,>(^@ t x, =x,thx,hW @ST xhh,(Y@ t!hh,h W@SS y hDChd,'Z@ t!hd,hW@SS y h Eh.'_@ th.hW@SS 1ɉ l,hp,t'^@ t l,ht,\'Z@ t l, =l,t1hl,hW @S.S @um 8t h E1c&e[^_]UVS]h`,&Y@ t9h`,hWSR y h2Eh`,&hP' 1.h.&Z@ t .h.&^@ t .h.w&Y@ t . =.teh.hWSIR y hBEj!.th.(&hPh& .th.&hPG& .th.%hP&& 15.h.%Z@ t .h.%Y@ t .h.%Z@ t . =.tch.hWShQ y hRE.th.I%hP% .th.(%hPh% .th.%hPG% hc&$^@ hc&hWSP y hiEhc&$Y@ c&k c& 19tef0f9,uQfpf9,uDfpf9,u7fpf9,u*fpf9,uff@f@f@f@ hc&-$hxEhc&$hP\$ 15,h,#Z@ t ,h,#Y@ t , =,tch,hW SO y h}Eh,th,#hP# ,th,v#hP# 15x,h|,V#Z@ t x,h,>#Y@ t x, =x,tchx,h W SO y hEx,th|,"hP1# x,th,"hP# hh,"Z@ t9hh,h WSN y hENhh,"hP" hd,n"^@ t9hd,hWSRN y hEhd,<"hP|" h.$"Y@ t9h.hWSN y hEh.!hP2" =c&15l,hp,!Z@ t l,ht,!Y@ t l,l,thp,!hP! l,tht,k!hP! =l,t.HfJfBfJH5.PfVPfVfFPcfFY.HfJHfJHfJfBl) v SO0EEEPZxf.4Mx .1. tʁw9 ` u 4 4 ;.s-.P.p.P..P$uɸ4Bt 5..؍e[^_]UWVS..5.uE}9s] t f tUEE ~X   9u ` B뜀}tU.u5.[^_]Ë..B.B... .UPh9hp&'NjDUWVS.u3j^{._u 21ۉ.15.B.S9.r14VP@.ZYtT01.e[^_]UVS]g.t.49u7u"1t . .J .J.[^][^]US]t5.t.;u1҉{t s܂X]]ς]UEt?1҉PPPBPP@1ɉH,.t .;u]7]UWVSÉ] 8S3C(.Zt .;t C 1ɉK$1tfVftP. ZC\ 8e[^_]UVSu j0oyYu 3Ép VRyCZtCUC؍e[^]UVS].t .<u'..4h@5.rXZ.t .e[^]UWVS =..=.u .=.u .&=.u .&.t .<u'..h@5.^_m=. ..}E f tU܉}E ~X   9u` Gf &u}tEܣ.Eأ. u=.. u5.). .=. $   .=..뎸5.[u5.hSf.o%=tс p5..YU.J^w RhSjPh T5.j5.5.C 1+.HE ...4x,uP..@,P .M. .MM9rx}Elj=.^f t .=. Y 9t  ` 5.uGGML 9s ?3M)ˉ]x(u K|EHE1]9s ]@x,uH1҉.PmZ u؉B UԃPQ zUԉBY[t2]أ.]X u"J.)ȉEzu1rw36 v 1ztd.HyP> ZuJ . .tJʋMDF9uMH1 F5.lGW 1ɉ5.Sj..upVPD.u4.@ @t)W 8t 3fV 1҉.f` 띡. ..B1uu7}u5.N[E..@,E.Uڋ ..4A9Q s4MӉUSPTxMAZYxUu 3X .@@D@.}t$}t>}lj=.\5.uN...H 9...Bǣ. ¡.E3=.@ @ie[^_]UWVS]tO.t/.jWV!C 8,ukpjWVC 8,uNpjWVC 8,u1jW@P̽C p <:tu _>t50.hvTjPh$W=2 y hTjh@.%_@ th@.hPT hD.^@ thD.hP+ hH.[@ thH.hP hL.Y@ thL.hP h0.Z@ th0.phP e[^_]US]h\.FZ@ t!h\.h W@S*1 y hTh@.Y@ t sDhD.Z@ uhH.Y@ uhL.Z@ uh0.Y@ uh .Z@ tEPh'W@S0 yChT5h$.Y@ uh(.wZ@ uh,.fY@ ukjh .LZ@ tE .h$.3Y@ tE$.h(.Z@ tE(.h,.Y@ tE,.hd.Z@ t ؋]ph`.Y@ uhh.Z@ uӋ]UVS]hX.^@ t=X.EEPh!WSw/ yhTLhX.dhP hT.LY@ tBT.EEPh#WS)/ y hTjhT.hPQ h@.Z@ t DhD.^@ uhH.Y@ uhL.Z@ uh0.^@ uh .Y@ t uVh'W@S. yBhTRh$.jZ@ uh(.Y^@ uh,.HY@ u%h .2Z@ t .Eh$.Y@ t$.Eh(.Z@ t(.Eh,.Y@ t,.EVh(WS- y hTh .Z@ th .hP h$.^@ th$.whP h(._Y@ th(.NhP h,.6Z@ th,.%hPe hd. ^@ t 4"h`.Y@ uhh.Z@ uՍe[^]UWVSSƉӍ<9t]Vs? ZYUue[^_]US 9tZ9uBPhFjhl.g2l.]UE.E .]UWVSS=.5.19~uu61? ZYtCuhjEe[^_]UVS ..19~Xu9ptBhUjQe[^]UuZH UWVS ]E tP3h 2 CiQd%,tnC0h;-|fswZ$ C0hxU==h=C @t&C0h+x&LPh#2Y[aC8u hc'1۸tugSRh1 1C u x&댹Dv&뀋%u&Ph1C0XZ1۸!t t&PhD^1_XC u1;>k ^f;u$f{uf{uf{u f{j 00WhV1 f=tP8Ph=0 CP Ph=0C f9Cu f;Cuf;CtQPPh=0C f9Cu fKf9Kt)PPh=}0CPPh=h0GDž`C#t.t&OuzPRh 0 1`utIdVCp Y[t hSn/Zj .V Ph'Vjj .Xe[^_]UWVS}] uGhL(t<tQ=a=iEPh+S* Ht ShGUEPhxS* Hu؋GUtslwS_Xho_j11u1:tqUA 1ɉj EPUR耲 Et ShNVjMA 8"Mu w؃~QhjVѸ ƋU: uB7j.S] ^ZƅtFu&EuShV끋Wj.V ZYÅtC t&Eu VhV]pCPZttHthF]hR] hb]hn]oXCPt hz]o_CPt h]o^CPt h]oYCPt h]oZCPt h]oXdCSRPh]R(CRPCQPh]>(CTPh]/( {Ty h^/oXCT@t h^oXCT t h#^ oXCTttHth4^h@^ hE^hQ^nXCTt hi^n_CTt h^n^CTt h^nYh^nCxPh^v'CzPh^g'C|Ph^X'C~Ph^I'$Ph^4'Ph_"'Ph_'Ph%_& {XhmCbPC`Ph5_&C^PC\PhO_&CdPhf_&${htPClPh~_&CnPh_&CpPh_z&CtPh_k& CrPh_Y&XZh_`mY1}E9iFș~F ș~ Pvvh_%v vvvv v6h_%F$0*uE uE*ut WuQRh_%E,=t9i9AyNjA y Pqqh`>%CUPh"`,%XZe[^_]UWVST]SYEfCf @} f@W@GGfC fGD1ju 4`  u d F,u1} }tjPW E @E PD 1f;Wu$Uju 7莦 Uu k (  F u1u ~}tjPW E @C ȋu ~4}PhB`jW"E @$C} GLCGHCGFCGGCGPCGQCGRSdtBdu FSCFTCS i fFxCS i fFzCS i fF|CS i fF~CS i fCS  i fCS! i fCS" i fC~FU1҉fC#EEEMt>Eċ ƅt)E k,}  BE Mă}uC&EčC6EuȉEt7E u)E k,M  BE Eu9uuC;EčE]CS Su{ ak ECK %K ȉCM[ ˉ]EEHE% ME@M %MI ȋMĊIU։u؋uUЋuUԉ]؉EU0 ؉EU0 Mƒt‰ЃtЃEuȉE n…t E E k, E CE NEĊPB<$  }uE @CE P$1 E @XE} fG\E@fG^E@fG`E@fGb ]ĉcfGd{GhCfGlCfGnEf@ fGpEĊ@ EfGtE@ fGre }uVE u)E k,}  BE Eă 9tuȉt몃E]9]EEEE $E 119~k,u 9}BM yXtQd9}fAd} fGdEEe[^_]UWVS,UEEЃEtE @E EE1Ut}E 1]{}E܋CEE ]}48E1 JM1SQRPiM1)ډӉ11WVRPƉ׉E@EiE@B1ډMȉ]WVRPj‹E]E ]ЉEiEEMȋ]́Ƥ~WVSQ+M1ӋE1RPSQ։щʋM1Ӌu1WVSQEU1}t}E1}E܋EH @]S)iU1҉UCMejh@BRPgӉƉ+u}؁EԋU)ڋMeʉWVRP!HE܍4EUEUE}G ƻd1)‹EPH p}xE%E ]C}lj߉C؋]_ } xi@B1jhuu脿jhuukRPWV_]e[^_]U$EEEEE&EXE(EEujEPuu uUVSÉыS t%[+YH$<$+Q$T$,$e[^]UWVSÉ׉1t )E1XJ~D>Ph=f^YX؃t w t u F17tA9MuuUM7Ph*XZUM΃`Ѝe[^_]Uhp&hAfDj>4.(.t9W|$wUWVSH.1B(.1@y&% 0f0 s fL..s fL.P s1fL.f .f N.X.t0 1sI.L. ut/H.8. <.P. T.fP.1=Xy&OfH.@.ffL.fN.=.tjVfEȣP.EȣT.ZYXy&X.l0.U1EH.]5..jh.5H0:ƃ x9u hg藘XVS5D.hg0HujhTy&jr .... .u...5Dy&=Hy&u؉}mrqLy&E؉ .. ..E . .=ɚ;~ ..-ʚ; ...we[^_]g_UWVS4ƉU)'h@gY>^ hDg]FfVRVRPWSPh^gj j.]SFPj.auj.h(4S Shg4j.SFPj`uj.h(4S{ S]F^(ZU)ڃ<,wJ<w1tR<CSPSPhg<+hg"<:tI< xe[^_]UEtu.@. .@.]U0Pjjhh.jRBu.(4UWVSE93t+9tOhhgbu =v3Chhgbu =#CCkXZ eTp\G뉅PT@O9u~TX\H9s&) &DQtx=RP"CYXDž8\P9H0sZPhh  H9\saTHSH\Zuh[.8utS YƄ0\x01hkXT@Z<t"<t%T@02hyh kX~^T@0j,XT@uFShGk[_8uD\9Huj,hyk_X)syShZkShikj,hpkT@ZY9Ptj,PT@PhkI0P(PWh T <x2<w><tG<T@8Ph%lP $ <uT@<w*$$ hkBhk;hk4h-h8&Phk,T@t <uhh>lcG^ PhTlBY[THLhqlT@Z<t%w uhl<uhlhl_hlPhl[^T@8PhlTHmhmhmhmh,mh1e[^_]UPEPhh 0h@0uƒ1uEUWVS} uHu7uuW1ɋUà =$0u u1Ɖ>1e[^_]UPEPhh 0h@0uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ2߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס0EС0E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU $URj#W $WjV $Vj$S ZE] Ee[^_]ސUVS@ÉjjjQjRP虓 tN9tLtHVPe ZY@u:) j@]S01͏hShwtPdy&=0t 1e[^]UWVSSÃ=0tO1t 0<!j,ơ0!0)Y9sRU,0Z9Uu)@uÅu,0!1ɉ1ƅtÉ5001e[^_]USX?090r0É0 4t1[]À=|0UVShhhhtdy&hhh htdy&dy& =}0tVnN=~0t` =0tQRPhtӋ5dy&=x0tt-=y0t=z0tt={0tSQRP֋dy&U0hhPhtӋdy& UhhPhtӋdy&U0ihhPhtӋdy& U0AhhPhuӋdy&U0hhPhuӋdy& Uhy&hh\Ph%uhhhh*udy& e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSS000k(0h @P 1ۉ^,0~0XY1;0s6U1h GP KGU C(XYk(|0009subC[^]á0uÀ=0>UWVS 0DžDžDžjjPh0jSu@u 0Ά 0P01 @H0hShnu胋 tƄ181ƅGhu XtU' uʊt͍B<9;$ 0R0F}0:}0.~0"~0hy&0B9Hhy&@hy&|0|0py&Hpy&0J9@py&ly&Hly&0J9~}@ly&u{0l{0cz0Zz0Qy0Hy0?x06x0-ƅ:hsRhuPdy&Ct0n3F 0=|0t hYpy&9ly&}ly&=ly&‰0 0 0s5000)I 00H 0tH 0 hy&0X0 0Ɖ5050#0tA 050)0={0t*1҉j Pha, h h0 j$000h h0q 1100}ã0u&0 1t01e[^_]1À=0u1á0u 0UWVS@É;0;0j.#¡0_9u739u0P#Y;0u;0)00jVSb 19Z;P 0PPh0 =0XZVSZ Y_@u: j@}W0蜟8hWhwtPdy&=0t 950u"tX 0PPh0( XZe[^_]UWVSEЉʋ0!Ë 0)){ MA L>D=}0tMjRPQ M950sxu@)lj|| >;0Fs"J| u| | DT>| T 9Ss$EExSWH ED CSWC ;sss{uISC P XZ=}0uE@,t 0EX,0؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC 0‰ى[^_]UWVS¡0!9t> 0)su܋tu 9t)D @!u܋D UEPh0 @ZYe[^_]UWVSQӋ0!‹ 0)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋0!9_C E؋ 0E)puЋ|~0Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w  w) w 1;SsS |C@C;Fu ;u1ɉHt SFP XZN]H9t9sxt PFP Y_SVv XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPh0 Ph0 =~0t KZ{ SC 00e[^_]UWVS90t09kjjh0M ǃ t؋_ jWh04 EWh0 0=0;0r;0rw1ɉ Åuj}먋 01ÅuP=0@u1j?Nj0!‰)[9tP0Y9uō30t]EPh0 XZt>G 9r7 39s0jWh0W EWh0 0=0}뾉؍e[^_]UWVSÉU 0EC1t}9xts@Ƌuzơ0EF}}1U9sK)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=P&H9s?MjB,@Pr(蟮 Mu e[^_]C(S,z{,f P{<t[F &01=P&H9s &29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)Ey&HuVQM蜿 t uMQ ZU9ufG}uf 1e[^_]UVSË@9r{uC0C0KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uC0C0[^]èu'B &fAf'f` ЃðUS1u4݀!/ ZYuCC u1]UUE ft҉U|!]1]UWVS É1=P&H9s33C8C,E &E&E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjhrwV5 u 1ɺjhywV u1ɺmS j@B@Pr  u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3K&9)BC9S9{uC0C0S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uC0C0{uC0C08Dz@U׉DRO^fE11=P&H9}"uQMBZYMt UGjE@$E@PEp 胨 u j}G W$JO$f4PY{uC0C0EH9G8:>x]49r{uC0C0<]t<-u{uC0C0=ȋUC9r{uC0C0S9sH9s8=ux]u {C~8-P9x]x-t  -f9=P&f9~0{uC 0C0f9UG1=P&H9|f9jE@4E@PEp0薦 u MA0Q4f8fpBQ4EV~{uC 0C01E, U%Gu48-u@-U;Cr{uC P8]u 0C0{ Ex8tC @tEHP&E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0tEp i1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF &f tNt & t< &ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uC0C0Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC 0C0{ 0щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6J&DJt%9~{uC 0C0PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC 0C0 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uC0C02SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $P!^[m\p{|;{r{uC0C0S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)u0C0 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uC0C0Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx &Dyu@<,t<{uC C0 0}{uC 0}~{u9C 0@}t{tE0C0+uN+ue0C0-0C0C 0C0+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJ&DJt%9~{uC 0C0PSY9s8}u @48}t#@9r{uC 0C0 {9s9r։v!?t{u#P9sP&DPt o1e[^_]UWVS} U0E tEp9) WV [jLYt3SUUw$@@EjP|1҉UYZuSX ]lp1tEEU1}EuDžh111h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9Y&EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ&DJ<_&9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,&DJu _9wu G9w NDJ_9< u AЋ &DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hyNC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV( uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tP&1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡ&f}UfMQPf_tIf}tAf}uf})E@&Buf}_uڻzf}&EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY &E@Af}_ fE@Af}_ 8uY8E&DBuf}_f}u7E&DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} &1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y&EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ&DJ<_&9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,&DJu _9wu G9w NDJ_9< u AЋ &DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hyNC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVk uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT&1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} &fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT&1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU  tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} &fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y&EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ&DJ<_&9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,&DJu _9wu G9w NDJ_9< u AЋ &DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hyNC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVV uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=P&lt1ۉ]tMEAEW:o YE}M9M) N,F4EF8EtwF}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$5U6DžDžDžDžDžUE@fE@fMIL$D$ tD$D$$JHt$ D$D$ 4$&HEDžDžDžUE@MIMI Ɖ ȉ } Dž UE$^D$D$Ɖ$!C D$:4$ Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%Kwҋ0<V9s%u9sF?V?4 r9i_oJNN9sVu鋽D$ OD$D$$EV9sNu鋽E@D$ D$D$$HE^V9sNu鋽*N9sVu鋽NN9sVuNN9sVu=Ex( @`=ዕt9NN9sVuNN9sVu yNV9sFu鋽Dž6pSNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ @ D$D$ $>BȄLN9sVu鋽AD$AD$AD$D$ $!D$D$ $AlBD$D$hBD$D$ 멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ d!D$D$ $@dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ "D$D$ $?N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ D$D$ $>N9sVuA D$A D$AD$ D$D$$k>{V9sNu7@D$ D$D$ $=N9sVuD$ D$D$ $=N9sVuZD$D$D$D$ D$T$U$)"N9sVuEDžDžDžD$D$ D$D$ D$L$U$)tN9sVu*})mUE@D$ D$D$$;EDžDžDžDž DžUyzUWVSt~ 3U11 rEEEEEEEEEH>U DEED$ED$$0U}ĉ|$T$E$F ƃtdE$UE ƃt'D$ED$$1҃ډO MD$|$E$mF N MN 8D$ED$$N 8t[^_]N UVS } ů Y; D$D$ $2t@ $̄ǃ $ǃ ƃ 1 [^]N 0ǃ $ǃ ƃ tM 0ǃ $Pǃ ƃ M UWVS<| éuD$/4$D D$@4$ƃ%D$T$$M 4$Ƅ=D$D$D$D$ D$D$ D$$ tVuw: ul<[^_]À uM3Ɖt$(D$ *D$D$4$7==L ? %L UVSz )u 3D$/4$ " t$ $0D s D$D$ $/BD$ D$D$ $0 !Ѓ D$D$ $1[^]Y RD$D$%@4$ D$t$ $1 fƉt$(D$ *D$D$4$5=pJ ?)AQ$"4tƃ YDJ 8#t0J 0z$J 04$ƃt J UE$]fffUWVS Qx E@ E։υEE y ]]U ] }ED$D$ $D$3ЉM;MM }$UM T$L$ U$D$ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSPv yD$T$|$$|$D$$&D$,H*)R)L$L$|$}<$&teEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8u ǐ}܉E؉Uȋ&8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,} &UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$]8 1E܍3'D$D$EЉ$]; t#tWuՉD$EЉ$]< u݋FV }؉WF2}S1}؉}+E܍}̉;D$EЉ$]3< tu}܍{D$EЉ$ < K?D$EЉ$]; Hu݋E܍}ȉHD$EЉ$]; u݋}Љ<$]`7 |?sE܍D$EЉ$]f; uE}u8}DGt.E܍,D$EЉ$]$; u1ۋEЉ t.u}.E}Q} auD$EЉ$]: usu̅u#D$EЉ$]^: uݸUWVS4p ٢Ƌ'<'wwEVN)щȉMEED$$`ct_FMȉFD$F$;ct:F]؉F>FDF 1[^_]ÿ'E {UWVSio D$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PJD$LD$T> L\$XD$Xtt$T=qw 9>D$Lt$Xtt$T=qw 9>tD|$P\$XL$HD$TD$dU ID$Tb\$XL$HrDNT$X)Ћ$‹RD$\T$`F3W=D$|t$xt$X$1>\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$>d$$/dD$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$O0lPT$|@A$D$\T$`AQ T$TeD$T! L\$XL$XD$|)ЉD$|$)ى$OiJtсqw 9>LM;$rD$DD$|PT$|X$A$D$\T$`AQ MD$T\$XL$HƉL$HD$|;$rD$DaD$|DPT$|X$P$T$dL$hPH MD$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$OE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$KD^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$XDD$|PT$|t$Xp$B$\$dt$hZr D$XMD$Pa LD$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$P" $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P>D$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$P WL$T\$XL$l\$pӉD$ >DŽ$DŽ$DŽ$D$T@D$<t ] 1uUT$$]=tFuɿ [^_]UWVScB uДt:̔>t M1uU T$$K=tFu̿[^_]UWVSA át0t:,>t M1uU T$$t M1uUT$$( |qE D$E$P2 D$ED$4$貀NjE8tB 8"tnC uOt$ E D$D$$҉[^_] 8"u썇vC뱋 t[^_]ÍvҋE D$D$$`UVS= puF$4F $44$4[^]UWVS= CpE 1t 8u$+E]M $CNjExlD$4$/MA XEU PMEED$<$)Dž?nED$=<$BHE u M D$<$7uM+E UR V tMV}9~t!Љ1OMV}9~u oSEK1ɋE g t&}G$2<$21ɉME[^_]É|$PD$$\$2̉<$2E$2ffUWVS8; Snu" D$-D$4$uD$:4$DžD$3D$4$hF$ $m)D$$D$D$|$ D$D$P4$;6$(AD$D$|$ D$D$4$5w|$$hƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $ $¦D$$ |$$蟲ƅOD$E D$ ED$D$$$KYD$E$PtD$$ }$/$/m 8[^_]À>/uEt$D$<$ t'D$<$Ԥ^ 8E D$t$E$}8[^_]ËE D$p3D$E$E D$D$D$ ED$D$P$3BE D$t$E$gZ E D$9D$E$ZDž1D$ \D$E D$E$lDž1` E D$9D$E$10$E t$ D$E D$E$<$ 1TD$E$=D$/4$6 E D$"D$E$6DžDžk E D$- E D$-US(-6 hEEED$D$ED$ ED$D$E$^1x E([]øUS(5 fhEE>ED$D$ED$ ED$D$E$0x E([]øUS(U5 gD$ D$$?D$D$D$D$D$ D$D$D$D$ $0x D$([]øUS4 ÁgED$D$ ED$ED$n$"x E[]øUS4 (gE$-Uf4 gUt ]Í̘]UWVS04 f}|$E D$E$9s [^_]~ ?|$ t$"D$$[^_]UWVS3 df}|$E D$E$=9s [^_]  ?|$ t$#D$$[^_]US P3 eE$#t []ÉET$$EUS 3 ïeE D$E$St []ÉET$$EUVS2 aeu4$ t[^]ÅtEt$T$$EUWVSk2 eu} |$4$$t[^_]ÅttE|$ t$@#T$$EUVS 2 ðdu t$E$t%t[^]ÅtEt$T$$EUWVS1 Xd}|$E D$E$1u[^_]É 0|$ E D$h#D$$[^_]UVSH1 cuE D$4$t[^]ÉEt$ʕT$$E[^]US0 ÖcED$E D$E$5uEەT$$E[]US0 CcED$E D$E$75uEەT$$E[]UWVS$I0 bD$ D$EUD$T$EUD$ T$E D$D$E$^Ɖ׋D$ u $[^_]j L$ EUD$T$EUD$T$E D$ ED$#D$$$[^_]UWVS$/ ,bD$ D$EUD$T$EUD$ T$E D$D$E$ȺƉ׋D$ u $[^_] L$ EUD$T$EUD$T$E D$ ED$#D$$$[^_]U. paU!Pፀ]Í]Í]Í]Í]Í ]Í]ÍL]Í]Í$]Í]Í]Í]Í'v]Í]Í6$]Í ]Íf$]Í]Í]Í]Í]Í ]ÍK]Í]Í]Í]Íb]Í.]Í]Í]Í]Í?S]Í]Í ]ffffUWVSP X$Hp)9s L H 9r,P 9s P P P$@(@,[^_]Ë #p VpUWVS- _ƉUx HEU D$ T$ED$9s)L$><$~F [^_]D$$ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVST, ^E}>11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<]E;EriEE؅eEU9s UEUȃE9sv ED#UȅtEDgET[^_]ËU#EE%ju}ču܋EU$T$?uẼƉE wt ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EyUE9U9v UD#Eȃv UDEȅUDwMaEEEE}ωu΀FE:j=*}_]̋MEU$T$ڋ}i]EE߉]̃{u]bO?_]̋EЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?~w<@p]fEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEf@E%#jxE%#joEUE_]̀}FGG9U}1 CEt'E;Es MĈEEU̍JMu܉E }EEEv_]̀}fGU}1 HE;Es U=E]̃EQpEЋU t1҉EU<@GE̋E"0]̉EUD$EUD$ T$ED$E D$E$p]fffUVSr% XuED$ ED$E D$4$D$ED$4$U[^]UWVS4"% WUEzlj(aED$/<$>t<|$ D$ED$ ED$ED$4$/4[^_]ËE  E|$ED$p3ED$D$ED$ ED$ED$4$u8upED$ |$ED$ED$,D$ED$ ED$ED$4$|Mo8u ELR8t ED$|$D$ED$ ED$ED$4$USg# VEU MÀ)]]] ]][] USEU M]]]] ]][]fffUWVSt" ãUD$L$<$xt$gD$<$1 Dt$D$$ũED$ 5D$D$$!rt.UWVS 6SD$ED$$Ct{NjE88/tbD$/4$…tL)JBU=wsG|wdD$}|$M$pEs(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS +R}UtlƍxD$4$_tD%=`u'$U tĄ[^_]O1Ą[^_]|1UWVS ÄQ}U)tlƍxD$4$q^tD%= u' $U tĄ[^_]O1Ą[^_]1US(= PEEED$D$ED$ ED$D$E$nx E([]øfffffffUWVS fPÉUM&ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS( lOEUM؋ufUވM݋U 1ɋU EEԋ}&Et$$UEx}P$u܀G$脮Ut}EMU E1‹E Et~MލAf qCP]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS úD0t t~9t $sK EED$D$E $`uI tG@t  0  @x [^]É댋E[^]É @uUWVS(J CUEtBEE0E}<$UT$ D$D$<$-u蹵N)),YU܉e)‹M),YUѸg4 )3 gD$<$}EtTH tCp$1҉}܉ 9t-~fuUE܉D$$=UuF([^_]1([^_]ËP 3g([^_]UWVS( àBUEtBEE0E܋u4$UT$ D$D$4$5,}kLЍB)XUeЍBM)XUѸ>Љ)<;eD$4$*E܋tRH t>x$1҉u܉ 9t(nuME܉D$$MuՋGy([^_]Ë;e@x([^_]UWVS( LAUEtBEE0E܋pu4$<UT$ D$D$4$*}-?L) RЍ)ЍRGEeE)  IȍE) GE*SRЍ)<;YD$4$E܋;YAQ tJy$E܉u9t(~suED$$[uދF E܃9u؋E܅tЉ)EeD$<$-VUE}<$mUĉT$ D$D$<$%Mĸ-?L) @)ЍRAE-?LeȋE) @E)AM*SRЍ)YUD$<$Ute}tu}cu }ugFEE3g$z<EEe$J=Y$0>렃}u E$/1҉UffffffUWVS1 9E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUIUƍp@Hπw09}맋E D똉UUUWVSn 948,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$48C,s0K40u4 8$4 8 @0@4$48G,_G0Gƅ`%4& Dž,Dž$Dž(Dža`0:~LJwDɋ44hXKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4hW0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4iE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4t8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$40,OPDŽPUw}7D$$Z>D$t$$-‰E$20UtYEE[^_]Í$臜ƅSE1ҋEEut$$D$$|M$-@ x Utb}ut$D$$Y|EJ$D$$8|$臘Ex t;MEt$D$${,$D$${ED$D$ht@E$5tEftUft IA(Q uEt E19$t!D$D$$6RB(D$tD$D$$6RB끃}P$D$$zrD$$zUVSW &EtD$ E D$ED$E$ƋEt$Q,[^]fffffffUWVS Ö&ƉEωD$$ٽtB4$蕹ƀ?u1)9tXzzt"D$|<$…uۉ<$_9t 1[^_]Ét$ED$<$3[^_]ÉUt$ED$<$3Uu[^_]UWVS 1 %uEUt E<t] [^_]É΋Ex %1ji˃1҉9rExtftEx(1}fWVu~9Vt"VT$<$]mljFVEptft]CPSD  Ћ]XgËuVf;h{CftMWҍTRӉEf}]}^ Qu F 8vE9uڋE}f8Pf]s} H u yf}uHD$$%] ]C ExD$$!]‹EPn!f8t;Pft2]{u0 ftXHt݉f8pxE;x T@$`|$D$$]Ex E@$E11MȍV HnsffvrRPMu v@@1҉P 9rjD$$]]C(11ɍ&mC}G G$t$]G$uyf fE@$$]cEx D$<$]]C$f$ffs@sU@@Jru9U@}t*JrHUznnJrfM6fy'bUWVS, * E׉MT$ D$D$  E$?=v(ƾ軾8,[^_]D$E$CƅtʋE$βUU܉T$}|$ D$ED$4$tJUMt@:tOE$Eǃu(EPEǃu E䉃 14$,[^_]ËE܉D$ |$BD$4$u΋MUD$|$E$ܤE=D$E$JƅUWVS։Dž)t Pv9s:ut<:t׃u)u͋[^_]ËrtftƄE$txDžiDžUWVS  ñǃ $8/u$S… ${Ŗ$Đt!4$‹ [^_]Í$葐t,D$ ӖD$D$<$74$ [^_]Í$.TI/@$Rlj($<$uDžD$$Nj$^OmtQ<$)4$‹4$|$$)t4$$<$t 눍 wUWVS .EEE EUUD$$rtƋM‹E1lj4$tKMUEt8,1ED$E$t' uMȃ[^_]ùȃ[^_]Í,HPEEE[^_]US X*Eu[]ÍED$E $#[]UWVS֋N ufS[^_]Ë~Of JN fJy8VӋ6s!uu [^_]äftuutYyZfUVS iƋ$F$F$vF@$kF$`F $UF0$J4$B[^]UWVSS }wu G9r [^_]Ått$$tw[^_]É4$YUWVS ǠU MuR u+ftO؃tXf;0t&nt(suXDu/1ۉ[^_]ËEx DC볃UWVS x E 0@ Eu Ct8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVS5 uNE|F9sXtd|$$tH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$렋}<FUWVS< 2E@ EE@ 0t$$sM4$'E@E܋uFX1tftE$u}D$|<$_nHM|$E@ $E$衡xDMED$E@$0M;UBNju`P0@|$E@ $k$E Ǎ@ED>D$E@$Uu$EE<[^_]ËMAOMփEtfEtǤ$E܉$EP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$Ep@@LEMA@AHADALudfxG111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$E<[^_]px1113u܉4$֨u8uDMUU_$EU r}fm몍S$ZE0GU7UWVSS UJEtB9swt$U$Ut]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$U]EfUWVSH uVzF9sHtT|$$t8~VM f FHNMLF [^_]Ëu1[^_]É<$#UWVSX g ED$,E$} D$|$]Kx_xD$|4$]hPU4$]= t<$= E$]= D$$P]sÉE܅F@ t$$<Et E 2t E D$,E$qEN EEE&E̋EE u<.tjDy@u붋}]D$ED$4$]ËE8g E E܃x f_EĉUED$ EԉD$E썈җL$E $@EċUڍwEJЀv)ύ)ȍlD$4$Pu [^_]ÿU6 E=w ]1]UWVS  éu4$ĎUT$ D$D$4$i}-?L) RЍ)ЍGEeE)  IȍE) GE*S)ύɍD$4$>u [^_]ÿUWVS4 ÿufF(}ȉ|$$Kkt4[^_]É<$?@1t9LufV(4[^_]UWVS \u 0fV E0 4$@V(EfD$FD$ $U=UwDE |)ʉM싆t7T$UD$E$U9sUJM|M))‹FtIT$UD$u4$eU9r4[^_]1$0[^_]ËUыU|UVSm utgF$/F$$F$F $F$$F,$4$9 t 1[^]ǃ  @ ~ @tÍ fffffffUWVS Flj$U_D$$ ̋Et$UT$,0U$C09UuED$$ 茋1[^_]ÉUED$$ lL$2UD$ 2UDcUWVSd k1EE1EEƍLEE> tqE9D$t$U$Z0Utˋ$g10$X1UDŽ0试5Euu ;t1< tHv0FIU$s00$d0UDŽ0+UWVS<# Ǡ1U11ɍLt6ufE+<ȁ<[^_]Ã0u@W@0ƃ:uVƅ/lFu,$a\9L$B\2(  Ή$.D$.D$D$ oD$D$o4$s~{qD$@|$/$y:tRP:uVpƅz빉1$-Ή$0Ή$-D$-$|-D$0ω$Y-D$G-U$VU$M.E$/fƅD$/4$a/tY1ɉL$oT$/T$T$ L$D$4$t$ND$$0F'1҉T$oT$ L$D$4$p빉o8vFUWVS < u}D$:4$Qt!D$p3T$$@t|$E D$4$+ [^_]ËU t考 [^_]UVS 蹾 ^uD$:4$Qt!D$p3T$$tE D$4$  [^]Ua Ew0t ]1]ÃL]UWVSh þEu 1MU1ҍx,U0ED$ ]D$D$@U$UzUƒE9~ЉLEΉ )t$|$ʉUM$6)MUӉϋʉU$<*uD$-*UD臎!L}|$t$$(uU+u h[^_]ËE%UWVS`譼 REM Ǡ1U1ҍp,U0MED$ cD$D$@U$U6yUD$$ tEED$ML$ED$&;EUT$$ u@< f!L^ut$L$$&U+uW`[^_]LU$(ED$(UED#UWVS`K EUǠ1L$\1ɍpwb0tNT$E UD$ T$iD$D$@T$$T$wT$1t>$LuT$ U MT$L$$qL$\+u`[^_]ø"UWVS ~ #Exw|,M0t_oƃtAkƍLU$:'ED$+'UED [^_]ÃLu$&Ɖ [^_]UWVSp׹ t}EU Ơ1uM1ɋ]p3,M0mQm8@E4~Eߺ81xEM}EL )|$t$ʉUM$]$MUЉ΋ʉU$]%}D$%UD !L\$T$$]Lo]U+p[^_]ê0f%.t&CD$D$ ]oD$D$@}<$tGj뉉f>~$E~LSC9u1Uf~7g]]USt EPw*0tֈ-[]ÃLu$'[]US EPw*0t聈-[]ÃLuU T$$Z[]UVS ¶ guD$:4$ It!D$p3T$$tE D$4$6 [^]- [^]UVS J uD$:4$Ht!D$p3T$$QtE D$D$4$&" [^]ËE D$D$4$ [^]US ĵ iEMPw*0t#- []ÃLuL$U T$$$" []USa UBw0t1[]ÃLu$X[]UVS  þuD$:4$aGt!D$p3T$$ ~tE D$4$  [^]B- [^]fffffffUWVS虴 6}E1EL xt=1}t ƒu@u[^_]UWVSĀ ǻ}E|1xƋE 1L: EL* E|1E]ELB Eƒx  EB A ǁE9uʋE%u EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËUL 1ۍ̧UL @t?Elt鸓$I )9uu1믋}L: E1ۍlEL* EEEu1}}}8ktDAuEƃ@E}t,ى%I$))9D E9u }u _]uE ^@]L1҃DD [ u̓E9uEL& a:!@t$E Du۸@u܋}L ƇL LE}8 L8L 0u}L ], ]Ec M{ }~Et M  ЋU 1ҋMDŽ,  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹Elt 1itEUEEt @FEǀ ]UWVSXk uE EM1ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EEL& EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHE EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋL ]3L ]3L ]3L 3L 3L 3L ]3L 1EEԋL ]3L ]3L ]3L! 3L" 3L# 3L$ ]3L% 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}uL u3L u1E䋼L u3L E1ljE3L 3L 3L 3L! 3L 3L" 3L 3L# 3L 3L$ 3L E3L% }m1]E%MɁ ȉEE%MɁ ȉE1E1L EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËME$ 4UWVSP4 E̋uM M1EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍s}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍vdEEEEEyD$ D$$<$]7D9tD$ )D$|$E؉$nf}2ae}sha1f}1 }argo}argo}argo}n2d}M̈, _ȍ0 , MEE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍1 MEM̍M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍, MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍D $,EfM ȃ?9K?9K ?9K8EfM ȃ?9K?9K ?9K8CEf?9K ?9K 8CC EEԉD$4$I2}n2i] UWVS) EǠ1EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë] UWVS,豤 ZE؋U1ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]- UWVSDͣ vU uU1‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$d @D$$ t@D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$D$$襼(D$$xRP489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$qQtD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1UWVS莟 +Eu 1‹E1D$D$LB $DžDž4$8$u t$4$wkƉ$dDžD$$6k8vu[x=uUT$$ D$$j DžDžDž DžDž|$4$zj3ptjtmt2$~1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$N$fuDž!t$N$fDžID$$!iƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$gt*D$ D$D$p$W$蕑 4$p`|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$?D$D$4$!D$D$|4$D$D$p$$%D$|D$&$GZUVS- uv$Z‰)Ѓ[^]øh`UWVS4 ÉED$ut$u 4$bu3D$ ED$$KhEE8$E $]ôh`)‰UE E h`9tt$u+E E܋E$]^NjED$ut$u t$u܉t$ D$D$blD E$TLD t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃D$D$b}<$ETU^D$O O ȉD$$9EPU9uD$]^D _D  LD ȉD$$EPU@D$D$4$E4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS Ʈ9ɍl  dH USHf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂ E $2?ƂE aH E Ƅ E $,T$ T$D$$F7D4$O`D$HD$T$ 14U+u{[^_]Íxƅ??tOlEȉDRH\UWVS åu(} 1E14$N$?$u 1H$9u勅)ȉx  @4$[$D$(|$4$pD$D$4$VT$|$4$:}<$$D$(L$<$T$T$<$$D$(L$<$ۄ|$0, $K$lj~T$,D$4$苄Dž0Dž4Dž8Dž<$,D$4$Bt&D$uڋ(D$4$uڋfǃE $1ƃE $ D$D$E $ C?D$xD$ B$t$,$-1s$D$(D$<$腃 ɋ D$,D$<$O|$,$ńB<$ʉ)Ѹ%I$))Љ)‰ :D$,D$<$ ɋuo$D$(D$<$荂9$D$(D$<$l D$D$<$E $D$(D$<$p D$D$<$ ?E 򉓌E D$06 < ȉD$$E E D$17 = ȉD$$=E E D$28 > ȉD$$E E D$39 ? ȉD$$E E D$4: 5 ȉD$$wE E D$;T$$ME PE @D$D$,$fE+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž DžUWVSX MMUu1ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$-yD$@|$<$KyE D$D$<$2y|$$z<$xD$@t$<$yD$t$<$x|$4$szE+[^_]Éu4$mxUT$L$4$xt$4$zDž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TfUWVSQ~ utJD$ED$4$MNjE9t.8u)O8"tE 81[^_]Ãu1sOUVS} EU ]~Í,у? H9u[^]UVS} EEU ]~Í̹у? H9u[^]ffffffUWVS8Q} ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U| MEt t&t1]ËM t6N]ËE tO]ËE tN]ÍK]ÍN]ÍN]UWVS:| ߮u} 4$9uw[^_][^_]UWVSd{ ×u}$}(E($"jEEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$qUЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$7qjfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSvw u4$xu1҉[^][^]UVS>w u4$@u[^][^]UVSw èu4$u[^]}[^]UWVSv l}u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSXFv M $;ƉEE$ndljE4$adƉEE EEEED$ML$}<$1t.1EM $lM $l4$lEX[^_]ËuE$cEtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSt y}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSct }u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSs Ò}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úUs "E##+pፂR]Íq]ÍX&]Í&]ÍR]ÍO]ÍO]ÍO]ÍO]Í,%]Í\%]Í%]ÍP]Í%]Í%]Í&]Í4&]ÍR]ÍR]ÍsR]ÍaR]ÍPR]Í3R]ÍR]ÍR]ÍQ]ÍQ]ÍQ]ÍQ]ÍQ]ÍQ]ÍsQ]Í$]ÍO]ÍO]ÍO]Í O]UWVS 'r ̤EwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$`7tffffUS oq U T$D$U$賱 []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVSWp u Ee…t5҅u.URу+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS *D vu} FEFED$E$O?$ug$E D$EUT$<$ u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSXYB t}EE 1UE1D$E$wƋẺ$-E+} f$OME Eĉ4$U9PMMȃ/MU)ƒ$v=yM}BEŰB8D$(>UĉT$ D$D$u҉uȉ4$V4$‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$4$9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$D4$ ‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$4$‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fEUMR)уtu]UVSU ṽщcw[^]ffffUWVSc< o|$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$` T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSLS/ auE Ǡ1U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFT蜖UWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS+ ^lj(UE uà1, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(UWVS\) 9\ML$} 1D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$~-!D$0 "D$0 !D$06 "D$0!D$0f !D$0Hy!D$0* [!D$0 6=!D$06@ !D$0I!D$0 "D$0q!D$0v, !D$0Xa"D$0:bk!D$0M!D$0|/!D$0g!D$0N"D$0!D$0!D$0h6!D$0J{!D$0,]!D$0?!D$0!!D$0,!D$0m!D$0"D$0x !D$0Z!D$0&D$ D$ D$&$ &D$ D$D$$ڕ4&D$ D$D$$訕l&D$ D$D$$v&t$D$$Mt$ D$D$7$3o&D$ D$D$K$0!D$0&D$ D$D$̚$軔5&D$ D$D$q$艔&D$ D$D$$W&D$ D$D$$%&D$ D$D$&$]&t$D$$CLt$ D$D$7$谓&D$ D$D$$~&D$ D$D$F$L&D$ D$D$X$&D$ D$D$^$&t$D$$8Kt$ D$D$7$襒&t$D$$Jt$ D$D$7$b&D$ D$D$'$0fD$1ffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS U-]E81}8CC twS(s$tbD$D$$ЉƅtpC@8@4?E D$$tEt$S($S$CE[^]{EK$TEC C(1uиɸUED$ E D$D$E$]UVSEM tYX tRP$tKPtD;u@B-4?w3t)x6(r@1 w#EB?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍}WPGX ,WTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍.U܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍&U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍'U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍.U܉BE@Q?}/]ԉU-}E̍lEPD@B?} EEUԉu@}E̍?]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍U܉BE@Q?EЉEE}U̍ěM܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS ` }u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ _Eԋuu1E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVS CE}Mx11 rtE xfDU9uEExfG0UofxZUWVS4پ v}̉ÉEЋ@,E܋{t-Ek@^S,sɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVS ß} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}LDDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$Cdž   9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 蓋 <EuE EM}EEEEE U$o81f8]vEFF ^$}uEEG} }UD$D$F($V ÅUF0@*P@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]A|A13u3 eE{EF$ETEF F( [^_]øCE%@F4$}U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@ CL{DMqD-{uvuju^CMQ+QS $ | 0 E[^_]älfb.t&ft.t&`fV&ft&fu5AfY{8f3f+0f(-f%*$ E1E%>  UWVS8$ ͶEȋM }׃}T uĉU 2A3؃u߉߉UθEEEE]ȍ ỦuEʋ1E؋u3ruԋM3JMЋ}3z }}3z}܃<EEEEE܋EU U҉3tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9D$U:^NjFD$U$>tE 8( [^_]1 [^_]UWVS -W ҉}GtUD$U]ƋGD$U$ؖt+4$P=yarauE 0\( [^_]É4$r1 [^_]UWVS V U}GtUD$UW]ƋGD$U$[t+4$Ӥ=tciduE 0' [^_]É4$1 [^_]UWVS3V ؈ED$E D$E$ tSEt4}D<$\ƋED$<$ȕtE01[^_]Q'[^_]9'[^_]UVSU Eut$E D$E$r t.yaraUFƅu [^]&0[^]&0[^]UVS1U ևut$E D$E$ t.tcidUƅu [^]l&0[^]\&0[^]UEU E MMM] UEU E tcidMMM]UVST )E D$E$vƉ$Ǣ=tciduE0[^]1[^]UVS4T نE D$E$EvƉ$w=loobt 1[^]É4$ŊU[^]UWVS S ÀE$ډt,ƉD$E D$E$vlj4$M [^_]1 [^_]USS &E D$E$uUT$$dA[]USHS E D$E$YuUT$$A[]USS ôE D$E$ uUT$$A[]USR {E D$E$tUT$$)B[]USR BE D$E$tUT$$WB[]USdR E D$E$utUT$$`B[]US+R ЄE D$E$8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS ZL ~E$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS K Ü~E$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS K :~EU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS 3K }E$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS J t}E$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS kJ }E$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS J í|E$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS I J|EU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS CI {E$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS H Å{E$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS |H !{E$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS H ýzE$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS G ZzEU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVSTG yE D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS F ÜyE$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS F AyE$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVSBF xE D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS E vxED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS oE xED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVS E òwE D$E$gƉ$P=gntst 1[^_]É4$$P$U3DžtڋUT$D$4$$t U:[^_]É<$l;UVSD (wE D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS &D vE$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS C pvE$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS pC vut*t$E D$E$%flj4$ [^_]1 [^_]UVS C uE D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS B luE$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVSkB uE $jxt%ƉD$E$蟊lj4$[^_]1[^_]USB ýtE D$E$ˆUT$$/[]USA ÄtE D$E$艈UT$$F0[]USA KtE D$E$PUT$$0[]USmA tE D$E$UT$$0[]US4A sE D$E$އUT$$0[]US@ àsE D$E$襇UT$$0[]US@ gsE D$E$lUT$$%1[]US@ .sE D$E$3UT$$p1[]USP@ rE D$E$UT$$1[]US@ ürE D$E$UT$$1[]US? ÃrE D$E$舆UT$$1[]US? JrE D$E$OUT$$1[]USl? rE D$E$UT$$ 2[]US3? qE D$E$݅UT$$ 2[]US> ßqE D$E$褅UT$$2[]US> fqE D$E$kUT$$2[]US> -qE D$E$2UT$$2[]USO> pE D$E$UT$$$2[]US> ûpE D$E$UT$$12[]US= ÂpE D$E$臄UT$$22[]UWVS = GpE$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVS?= oE $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS < ÈoE$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVS< %oE $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS $< nE$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVS; gnE $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS g; nE$D$&t,ƉD$E D$E$膂lj4$ӆ [^_]1 [^_]UWVS; êmE $D$&t%ƉD$E$3lj4$x[^_]1[^_]UWVS : OmEU$T$,&t,ƉD$E D$E$Ɂlj4$ [^_]1 [^_]UWVSH: lE U$T$%t%ƉD$E$vlj4$軅[^_]1[^_]UWVS 9 ÒlE$D$o%t,ƉD$E D$E$ lj4$Y [^_]1 [^_]UWVS9 0lE $D$ %t%ƉD$E$蹁lj4$[^_]1[^_]UWVS 09 kE$D$$t,ƉD$E D$E$Nlj4$蛄 [^_]1 [^_]UWVS8 rkE $D$N$t%ƉD$E$lj4$?[^_]1[^_]UWVS q8 kE$D$#t,ƉD$E D$E$lj4$܃ [^_]1 [^_]UWVS8 ójE $D$#t%ƉD$E$;lj4$考[^_]1[^_]UWVS 7 WjE$D$4#t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSP7 iE $D$"t%ƉD$E$~lj4$Â[^_]1[^_]UWVS 6 ÚiEU$T$w"t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVS6 8iE U$T$"t%ƉD$E$~lj4$[^_]1[^_]UWVS 86 hE$D$"t,ƉD$E D$E$U}lj4$袁 [^_]1 [^_]UWVS5 yhE $D$!t%ƉD$E$~lj4$E[^_]1[^_]UWVS w5 hE$D$A!t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS5 øgE $D$ t%ƉD$E$?}lj4$脀[^_]1[^_]UWVS 4 [gE$D$ t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSS4 fE $D$ t%ƉD$E$|lj4$[^_]1[^_]UWVS 3 ÜfE$D$t,ƉD$E D$E${lj4$b [^_]1 [^_]UWVS3 9fE $D$_t%ƉD$E${lj4$[^_]1[^_]UWVS 83 eEU$T$t,ƉD$E D$E$Wzlj4$~ [^_]1 [^_]UWVS2 {eE U$T$t%ƉD$E${lj4$I~[^_]1[^_]UWVS {2 eE$D$Ft,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS2 ýdE $D$t%ƉD$E$Ezlj4$}[^_]1[^_]UWVS 1 adE$D$t,ƉD$E D$E$xlj4$&} [^_]1 [^_]UWVSX1 cE $D$"t%ƉD$E$ylj4$|[^_]1[^_]UWVS 0 àcE$D$t,ƉD$E D$E$xlj4$e| [^_]1 [^_]UWVS0 Et1닋F$lʉ<$b1oUWVS s$ Wu} D$|$4${u 1 [^_]ËED$4$yt|$4$| [^_]UVS$ öV$ Pƅt'D$4$(oFF F[^]UWVS# `Vu$ …D$$UnUBB BU4$-EE$Ut]NjMs"EtfEtBEB Ѓ[^_]׍FtAD$$UU [^_]H4$l [^_]1 [^_]Í UWVS >SutJ9u@~ G$…t,Ft/D$$UiU [^_]1 [^_]Í U, REt 9t1]Ë@ ]U REt9uP@tt ]1҉]Í ]US aREt 9t1[]ËU tH Q9Ur@tD$E $[]Í U^ QEt 9t1]Ë@]UWVS' Q}t;9u1G $S ƅtGt"D$4$[^_]1[^_]Í U hQEt9u @t]1]Í ]UWVS -Qut 9t 1[^_]ËU tM 9uFtA F EP$U DžtŋE HɋUtOFt@L$D$ ,D$T$<$F~}~ t$s 븍 UWVS iPut 9t 1[^_]ËE FtE $XF EH $M …tFMtI} |$D$ ,D$L$$U.FUV}~ t$o 믍bD$ D$D$;X'$LUS ÁOEt 9t1[]ËM tM 9uL$$)mUS :OEt 9t1[]Ë@tU T$$a[]Í USA NEt 9t1[]Ë@tU T$$ []Í US ÒNEU tG9u=t99 u5Rt@tT$$[]Í @uፃ ٸfUS (NEt.9u$@tU T$$W[]Í fUWVS 3 Mu~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$! DžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ ƅt'D$4$eFF FE 0 [^_]É<$D$D$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]US Et 9t1]ËPH9иrE ]U ¡>Et 9t1]ËPH9иrE f]U [>Et 9t1]ËHPwE ]U !>Et 9t1]ËHP@uxE P]US6 =Et 9t1[]ËM tM 9uL$$[U ˜=Et 9t1]@tHxUxU M3P3H ]U L=Et 9t1]@tHxUxU M3P3H ]US^ <Et 9t1[]ËHX@u xExȉ3E 3U []US ±<Et 9t1[]ËHX@u xExȉ3E 3U []UWVS ^<]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$@D$$~tU [^_]ù RAu_Uu>fUWVSP S;<$eFH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$G_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS<1 84$}cB BBB$BBB(B8O)Bf^.t{BDžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upBSxauZxluTxsuNxeuHxBJB(zxru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%lBB(уzc<$N1USEJv[]ÉuUS  z5E ;Et1 []ÉD$ED$E$C []UWVS 55]u}E E $<‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]Au?/ F(<>tt uHvf~ t{ lqG u\.x$E]D$ D$D$L($ t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS0K2EEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE$0p(r EpD$t$$t}(u GtXtA1(u~u EpENjE$[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVS î+$Qlp$3thD$D$E$dp0xD$p$Û$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$eƋt0<$eplD$T$4$iE D$4$NjtPD$T$p4$oipT$4$m7t$XĬ[^_]ËlЉhdD$D$p|$D$ D$D$$dƋt0<$"dhD$T$p4$hD$D$D$D$ D$lD$p$vdptdtAT$4$[6t$F1p$hct$#1UD$E$]fffUE 9E]UWVSå(ƅtBD$$UEt E$@DžMu% $1\$@DžtED$<$@D$G$iEG,w0G4G8G<[^_]US@'|F $g[]USÿ'sD$̕$j|F $g[]USÁ'D$|F $gLD$F $赥1[]US9'ED$E $z[]USg 'ED$E $J[]US7&E$hE $zh[]UWVS(æ&UM܋p4@,EEGEt@E<E tD$ LD$D$($rUWVSå uFt09u&x<$@bƉ<$/b[^_]Í(D$ D$D$($UWVS- Ƅt1fƅtptC[^_]ÉUx<$a1ɋU5ƅtpt<$a[^_]Í)D$ 0D$D$($_USÔE xt"D$D$E$C[]ÍD$ `D$D$ ($US-UB4tB4R,…t8$ 8[]ÍD$ D$D$($蔳םD$ D$D$($jUWVS4ÝUM@8t 14[^_]ÉƉ׍@E$-`Mt9pE}<$6Ex4$C7E$_4[^_]ÍsD$̕$a|F ljE؉$]UT$F Mԉ $kE܅$6<$]V09V4E$`6N4F,E؋U<}Nj2UЉMԃD$E$ǴMԋU|A)D$|$E؍D$XEF,}܉8MHF4F<E؉$\E$+E܃,}<}ܜ$yEMlD$ $I5}|$MA$EU܉PU؉$t\|$}ԉ<$E܅$5U؉$G\E@,vu1<$Z0[^_]D$4$=t؋E EtɃF E䍃lE؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$D$4$3~D$4$<4$<U܋T$4$P tEO49H1Eq<$YD$4$>Ɖ0[^_]Ë}4$(<E$5mcD$4$v9n}э'D$ D$D$($}E$l5n 4$;EԉD$4$J=.D$ D$D$($軫UVSJE 0t$F $蔘F,v }><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> D$ ,D$D$e|*$ə=2D$ ,D$D$,|*${UWVS î$HD$$UUBB BE u Ѓ [^_]ËE $UtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS 9u} tEt=$jt%T$$EAE@px [^_]11UWVSwuE u@1$DžtD$<$GwE G [^_]ËE $tDǃ} s E uE u뛤ƐfE tM E tE o1UWVS úu} tEt=$Ft%T$$EE@px [^_]11UVSTutG9u=Fu!F D$F$tH[^]É4$[^]1USEt 9t1]Ë@ ]U+Et9u@]1]UWV¢Et 9t1^_]ËU tP 9Urptt} suuɤfuufUWVS]EtH9u>P pt0t{$U~t!NjUs*ut[^_]Åu!1[^_]ftt鍃*D$ dD$D$|*$!+D$ dD$D$|*$U0Et9u@]1]US_Et 9t1[]ËM tM 9uL$$US ýEt 9t1 []ËM9H uU tL$M L$@$E  []UWVS `u>t=~(u7Ft=D$ T$VT$$t F$ [^_]ËFD$U$11tՋ}O $M腺EtFVT$U$MUK9}D$ڢD$4$I$ƅD$4$FEF~ E 0%D$ED$F $ljEt\UF$F 9:" D$ LD$D$|*$膒E$ [^_]臜8"uE$$4ƅtEE$1 1UYEt 9t1]ËM tM 9u9]UVSt t$F $ƃF t$F $~ƃF 1[^]US!E xt]C$$[^]fffffffUWVSÓƀ8$tD9t- P9/t9rq/u9t9t8/t)ȃ=%׋ƄfDž.$sP /.pl@istX@XXXXf@ X $ڵƃtb|$D$4$9 84$$r1~8[^_]~?1[^_]äƄ3f P4$c$Clj$Bׁ|$4$0D$$~84$UWVS~uM ^t^F9tX^ [^_]ÉMD$$衟…FFM빍WD$ D$D$9D-$=soD$ D$D$:D-$sp-D$ D$D$;D-$r1<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$Buύ'T$ T$D$#D-$nt][^_]UVS-]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍'T$ T$D$DD-$mE >][^]UWVS<]u {uZ~uvDD$$t4u~ tku btXD$$Yu1[^_]D$<$;t6utwD$$u븋vt%u tD$$u댸[^_]Í'T$ T$D$cD-$lD$/$;E >][^_]zUWVS ÕUEx } $ ƅ$tzFFF E Ft.ED$4$ׄu`$>14$4 [^_]Í<D$4$u뵉4$1 [^_]D$ 4$ztFu2|D$4$kD$ 4$ESD$4$-;>@D$|D$4$-D$ 4$Ex UWVS KED$E$5t>Ɖ$hE tU4$ߙtU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSqutFwyM MJ]ZMJ [^]$\t|] X]XMH ]X뼍D$ Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9r91u1[]$T1[]US_91u1[]$T1[]US%ʿ91u1[]$T1[]USÐ91u1[]$OT1[]US豌V91u1[]$T1[]USw91u1[]$S1[]US=91u1[]$S1[]USè91u1[]$gS1[]USɋn91u1[]$-S1[]US菋491u1[]$R1[]USXI ?jIF  @tM:u DŽF с?x"I ] F \U1[]ÃӅ~F 1  9~:u뙸#[]U越WE@M F 1]U蔊5E@F ]UwE@DŽF 1]US]Cu U C1[]US /Լ91u#ED$E D$E$5u []$xQi[ []øUSωt[]US赉Z91u -[]$Q-[]USu$AUSW91u1[]$P1[]UE 9E]1US îE EED$D$vtE$?[]USшvED$D$wt@E$?xEu[]øffUS胈(E t ttY[]ÉEED$D$tE$)?[]US &˺D$D$^t E$> []UEU P(P$1]UEU P(1]UEU P$1]UE `` gPP]UE@(]UE@$]fSL$D$ t9tEA.&f€tuuuu˃t@Au<.t&€tAt9AtAt9Au΋D$[US ֆ{I D$E D$E$( []fffffffUSEM -~@R`b҃⻃rQY҃ⶃwQ@H@vu xYQƒ ҃⻃rKƒ҃ⶃwS!wxu xKSƒ҃⻃rƒ҃ⶃwQ%== AAxf []Áus닁@/st> uhctBu wue[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$mD$L$8D$9\$(N"D$8D$e[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(#D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$( J"D$8D$D$=u4$9)EE8EE1҉MԉU*}D9FEE>tHED$|$U$<0uى<$,}9EuEEE>uMԋE܅Ex‰ENjp,&t$E8:tED$ED$$G;G910E<-<+<:?eB9FB 9F <;uEy69EB &tE8:tD$W$:91WE<-QEx:T:Fw E؉Gw t01EE4[^_]ËMԋUEE$*EME8<:y)EEw vSẼuE MЋM؉2&t(E8:t ED$L$T9EEЋO191EuEEyU؉: P}:EЋutE $MЉ)E)uK&t$E8:tED$ED$$n891GyuE&8tE8:tt$$+8910&tE8:tED$$7녀z:}9E~} }؉ &tE8:ht$$7QG Iu UWVSb$I u$ǃI E ;M8-p$xI - $D$-E$TǃI --|$E$.tAx:ǃI >u[^_]Ír$I :u>u t E8:?부xt $됋>uMx:tE9M $E8:t} t+|$ D$H.:1I $[^_]|$ D$=D$&$!'E 4뤿:US o`D$ D$E$m []US9`ޒD$E$]]US `òE D$ED$&X$ []US_{ED$ E D$ED$&X$[]US_=U ED$ 1D$T$E$[]USZ_D$ D$D$E$[]US_đU D$ 1D$T$E$S[]US^ÅED$ D$ E D$E$[]US ^LED$E D$E$І []USv^ED$ ED$E D$E$8[]UWVS<^uD$4$.nx$P8D$4$7[^_]É4$US ]ÆED$E D$E$v []US]UED$ ED$E D$E$`[]UWVS,v]Et8uj}ԉ;(o$#FFF )t$|$$,[^_]ÉEԉ$"E؍cEEu}uwW끋,uU\PEx9(o]Ë,]ÍW]UWVSTo\uE }}Ǡ1}U1҉ tP9utLD$2@D$u4$4$!PEu5ME+ЃT[^_]Áuqp4$!PEtˉUED$t$E$FU뭋@E 7tSED$G$n%ut$ L$ ݠD$D$2u4$+4$!P7'bffffUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UE@)@3U u@ @]1]USEU ]xuQwLHtCu?HH LZYZYR Q X SP ҍ1[]øUExuxw E ]ø]UExu@ u<.w]ø]UUM zuB u<.w~ 9| D ]1]UEU xu@ u<.wx 9]ø]UEu E D]1]UWVS XMuU }EuEE 8tr@‹Mϋu sptftuM)ȍx)lj;>M)C E [^_]EE [^_]ø‹Mϋu ru!u)wsyPfUWVS]M}4{ 9)1UD!ЉEUE)‹E1UU֋E M )Q)ʉUEUE)C [^_]1[^_]ÍsmUVSU] z)uGB1w<v5J q 9r#L tH8tP9r P9s[^]ú9r9s)8tP9rP B9[^]UVSU] z)uGB1w<v5J q 9r#L t^8tP9r P9s[^]ú9r9s00;ut.tP9rP9rغB뮉1UUE ttuB]ø]UWVSmREEEuM<vwwٸu[^_]9rE|0tG)ϋU t9} rˋEtɋUUu_B]ZU [^_]ËE t9} r]tEMDċMnE]D몍BtYZUYM\$D$$]MUʍBjUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVS]U Et9u4څt89stEt+p9r xD89s2E[^_]ÍCōH9rHD9r밃뫋U U:}7)[^_]UWVS}M UEEt7u2t99st1B9rr9s+E[^_]ÍWĸ9r:]t뫃M1u)UWVS] UЋ}uރstft[^_]uuBfUSNKD$D$ED$ ED$E D$E$![]fffffUWVSPNNƉ1E1ƅD$D$D$D$ D$T$4$t1U+P[^_]Í1ɉ  rFDžDžD$ T$D$<$#utjƅD$D$D$D$ t$GD$G$ut$$tu<$V" $C""UWVSTLkƉ1E1ƃ J ƅD$D$D$D$  J D$T$4$D$D$D$D$ L$|$4$;DžDžDžDžDžVDžDžDžT$ D$D$$'!tjƅD$D$D$D$ t$GD$G$ut$$!thuGtLD$ D$ /D$$J$3 1U+u)T[^_]Ë묋$ UWVSJ-}EE uEǠ1E1D$D$ D$D$$ PBD$ D$D$$,Kt6D$ D$D$$ï$yD$$3{D$$_$1D$-$+$$f$^$躵t$袵D$D$$}U+Ā[^_]ÍѢ @$8zD$<$u D$$DD$/$Pt4D$3D$!$%8PD$D$|$D$ D$T$$CD$D$1$$@D$D$!$օ$$D$$螅$L@$8u ]D$/$6D$|$ T$D$$=D$D$|$D$D$ OD$T$$D$D$|$D$D$ n볋D$D$ۢ$tD$$GэD$$-芭D$$$ UWVS EïwElƠ1E1rf|tffDžpD$D$$DžxkfDžrpD$<$x*rflE+u6Ĕ[^_]l<$[l|UWVS DvEhUƠ1E1pl } t2} [/E+Ę[^_]ƅpt BtE qD$D$E $ެDžxfDžrlD$<$xIrfhoƅptBxB |BEBEml<$ wl.U D$E D$E$]UWVSBSuƉtE|E xE1E1貫DžDžDžDžT$D$$>SDžDžDž&D$FD$${DžD$D$<$9FD$FD$<$cc<$s80.t&8=~4$@Dž)o8#tf=$vD$D$$E+Ĝ[^_]ÃH/$[똋F?ƅD$D$D$D$ |$FD$F$|$J$~vƅD$D$D$D$ |$FD$F$Ou!|$fD$$D$S~D$<$D$S~D$<$A$=D$ @D$D$&$ 8D$FD$$DžD$$D$ D$D$4$l4$FD$t$<$MƋ$9fDžfDžD$D$$D$L$$Ƌ$貪0<<4$7D$t$<$D|4$D$t$<$#x4$D$t$<$D$D$<$ D$D$$D$D$D$D$ D$D$ $(u(4$&\=4$\=/$/D$ D$<$Dž t$z$<$!D$t$$触 tD$t$<$芧tƋt$뉍h/$Ez$ahtD$ $z뛍/$V$yUWVSl:ÏmuEEEEEEEEǠ1E1E fD$ 7D$D$ UЉ$U|EEEEEEM MEEML$ D$UT$$ukEPt%D$T$,N $UUEML$ML$M $M'ƋE$6E+u1l[^_]É$D$D$.$UD$ED$ED$ED$ ED$E D$E$h]UWVSlN9kuEEEEEEEEǠ1E1E fD$ 7D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$7E@t"D$D$,O $UUtD$$ tM 9Ht?ED$ED$E$MEcƋE$r E+uhl[^_]ÍE$D$ ED$ED$E$ME 8뭉$ D$D$.$ UD$ED$ED$ED$ ED$E D$E$ ]UWVSX7ilEdE TEPEX1@E1D$pD$DžHDžLph&` &\dD$ D$D$h$l% D$ h4$l9p< `\?.< t.cЍLDSt< A< u< t< t< u< t< tuh9>uPp<+<-hq<@oHLDD$ D$LD$r$l؉DžH<+ti<-,t$X$lPH:f41@U+}[^_]ÉFg<@qs<@PHLDL$ D$D$r$lDžH hUTd \4$l uDF)<@t$X$l DD$ XD$D$4$l4tthLqUTqUT؉DD$ XD$D$4$l|ADžHDžL1cUTLUTLƅpl虚UWVS=2dE,E(E<Ǡ1E1ǃI U@D$D$ D$DD$<$@D$@ D$4$9D$D$4$E84@@ $@P T$$l@@$9D$4$~0t$D$4$3q0|%=I $F8$(4$:E+O[^_]þō9D$$…tG(D$E]Xω]ߋu1!1߉EyZϋMTω1׋u!u1EyZlju}l1u1u1Ɖ׉]1!1׉u]yZ߉uMu}1|1u1ljMϋ]1!1ωuyZ׋Ul}1x1u1lj1Nj]!ߋ]1߉uyZM]h1ދt1ދ]1މÉƉM1!1Ɖ]M yZΉ]d1ދp1ދ]1މËu11]nƉlh`1NjE1Nj]1lj׋l11ωE]n߉d}1NjE1NjE1ljl11En׉h`|1NjE1Nju1ljϋh11߉ulnljl}x1u1u1ljh11׉unϋlh|t1u1u1lj1׋l1׉|nllxp1u1u1ljhl11ωxn߉Љt}1u1u1ljl11׉thn׉p}1u1|1ljωd11߉plnlj}u1u1x1ljd11׉lnωU}u1U1׋t1׉‰ߋu11ljhd2n}U1׋U1׋p1lj}11ωdn߉M}U1׋M1ϋl1ωNjU11`Un׉}M1ϋ|1ϋh1lj}11߉\nlj]}M1ϋx1ߋd1߉ÉM11׉XM nωU}]1ߋt1׋`1lj}]11ljT2n‹}]1ߋp1Nj\1lj}U11ωP]n߉M}U1׋l1NjX1ljMϋE11LEn׉uE1Ƌh1ƋT1Ɖu11މHnƉ]|1d1P1ÉމM11ӉDMnىMx1ً`1ًL1M щˋM!ˉ! ً];ܼى|t1\1H1M !׉! M}MܼMωuxp1X1D1Ɖuu !! }ܼ։׋tl1ڋT1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋph1ȋP1ȋM1E ؉!! ȉEEMܼEuld1L1u1MM !! u>ܼΉ׋h`1H1u1‰U ֋U!։! uܼӉƋd\1؋D1؋]1E !! ؉EE]ܼEÉM`X1ً]1ً]1MM !! ً];ܼˉى\T1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋXP1É؋]1؋]1E !! ؉|E]ܼ|É|TL1ً]1ً]1M| !! ً];ܼˉىxPH1ڋ]1ڋ]1‰׉‹x ډӋ|!Ӊt‹x!ڋt ډt7ܼӉډLD1؋]1؋]1؉Ɖ Ëx!É! ؉p|ܼÉ΋H]1ً]1ً]1| ։l!! ً|x;ܼˉىD]1ڋ]1ڋt1‰x Ӊh!! ڋxlܼӉƋE]1؋]1؋p1E !! ؉lEhܼlÉlM]1ً]1ً|1Ml !! ً];ܼˉ]}1}1x1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhlh}u1t1u1Ɖ11߉ublUu1p1u1‰֋h11ʉub‰Uu1|1u1‰։ډd11lhbщMu1x1u1΋d11ubˉhEu1]1؋]1Éh11Љ]d3bƉ֋U]1ڋ]1ڋl1‰Ӌh11ʉ];bdUt1ڋM1ʋM1‰щd11‰MhbӉEEp1ȋM1ȋM1hd؋M11hM1bt|1ȋM1ȋM1E11ЉtbӋpx1ʋM1ʋM1‰щh11p]bډ|M1ʋl1ʋM1‰ыh11‰|9b׉}xM1ȋM1ȋt111؉xh9bȉߋE]1؋]1؋p1ËE11Љh3bƉu]1ދ]1ދ|1Ɖ}11Ήd};bM}]1ߋ]1ߋx1lj11lj]M b߉ ;E]1؋]1؋h1ËE11]bЉЉEEl1؋t1Ћd1Љ‰1M1ȉUM bȋMUUEU1Ћp1ЋU1bʉU1ЋU1E1؋|1؋]1bʋE11E]1؋x1؋]1<bʋ]É11؉؋]83uF,lj~@ F 0A41M+u [^_]ÉoUE#Eg@@ܺ@ vT2@@@]UWVS UJEˉZs Zȃ?H]Ã?@)É]< u EEuzEJL$$UPE);MU֋} T$4$&ڃ@;Ur)]] E< u sHtft [^_]äfEwu^uDMEMuPuX] uD0Ezfmu KMfUWVS$C8Eu] 1ENjE1U1Ƀωу| uىUD$}䍇hD$$C%=Ut,yD$|$$C%=u݋UD$T$$t!1уuuE+u$[^_]Ë]lUWVS(:7E؋}u 1EԉËE1tX|$}܉<$]o1| F TFuF(}ԋE+u!([^_]$)][ƅuՋ]ElUWVSÎ6EE EEu}1U1ҍ $sD$@$o \19ȋ})׉ 9}PD$T$$n~3D$T$ $319|vj90$o$0t 140$o0D$ $U+uw[^_]D$ D$L$$3$o1몍D$$!tыptv jUD$D$D$D$ E D$E$]UWVSt04UUEEǠ1M1ɍu4$BM L$UT$4$ED$4$U+ut[^_]siffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVuMMMEM <wE)Ѓ9uEEED$D$|$ ED$D$4$؃,[^_]8 uEƀUGffffUWVSN} Ơ1E1D$D$HtHE$ t=ED$D$<$裔;Es1U+[^_]ø"㍅D$E$tt@D$E$~u[ED$p3D$<$3;EsED$|$ H%D$`d$T$aUȬ.t&DCUWVS / D$P \$E$Ɖ؅u [^_]Éo01UWVSh~ T ut$$T @B1E}E1uNjU:ME1uEHt$$xxT @B1Ƌ}E1NjExME1EH D$E$@.u(T ]ٸ@B1E1؃h[^_]øh[^_]$'k2T UVS W uED$D$D$D$ ED$E D$E$XU [^]UWVSQ D$_DD$E$^uE&@t&tD$E$`u܉[^_]D$D$E$X^t 1[^_]ËEpD$D$4$(^E@<-u?EP&DPtEPD$ ED$$UgMU9p9g^My+th)ƍF߃1BD$D$4$z]E@t<+ !M?!UP E?w&t u]Ë u@u1]Ux EP>w &]1]UWVS(8 u}܉|$D$4$ xINE uG>wl41EظE! EED$|$4$輟([^_]Ã>w241EظE E UWVSp u@D$ toOD$D$T <$)y)T &t@T [^_]ÍU T$ t$)‰T$$螒뵍 D$D$T <$躒fffffUVSX=v^ot.&vnuucts Ƀ E u p}+t}}-t}=uP[^]Ã+t-uuPU #UP[^]ÃXtguu-tH@+؉M @ @+؃밉M 뫃P묃PUWVSEu gt,C-X.t&u!E I@t pguԉ%+t[^_]ÀouuPӃt>Mt }#x!t }#x!t }#x!rt #X t #X ރI#H ΃?lP!փ&EjUWVS\Ou>;EEEE}|$EԉD$$>$wi$EliD$|$$d>E詤D$D$Ẻ$觐腤MẺE0EU&DPuHщMEE1EEUM]L$\$ $T$](9tu׉EUM]ىeщٸ9и| E ;ED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]D$E D$E$ ~9} P[^_]ÍEEEEEE EqMUJ2DrUWVS¹gDdhpE\} uElEX1<E1f9r9f>*uf~*u1f~*@DFP9\XD$lD$ PD$|$\$phd…hfDžHdf8,D$DsrD$$`q`l@ @$TP `T`l@ @D>Tt4p8`$TЅlS t%XYLYL! x . h9pHfKfu9p}H@u5l4d76|%= P\hS89sfC/fXD$lD$4$pd}hfDžPDž@DžHdf8tld[u|%=@tp1ҋf?f[uZp!!f90f[ʃfu‹ffP uO f?ʃFW Ӏ_ Y9t fx*f*ʉك |$|$<$jU+*D[^_]ÍJfzuf[Qy f2f]u답f[!u pf@!Wf]tI׉΍Nf%ff-uGf]HfF-Nf%fF_Wf]uH Af]O9]D$D$ D$D$$(|nP f 99sWfPfu9t.P9fx*P9fx*ʉW 9= (T$ D$)L$pP$62I$(R…AD$D$ D$D$$6@u\1W-f[!ʉfH98MUWVS Ӊ9x)ڍωރ׉HPftPΉ1ff}t[Fftf[tYf{uFfu勝M E1 [^_]ÅtJF뜍~Ff]fu{rZf]tFr^9r1=f[uSf]zfً9@S{f{f,uu91ҋLf fuM A}1xDf5f}4vd!qQf]tyىC)D‹΃s tfFu@ύSً{ fsJfPUWVSÐƉ׉MB tA PQ wif>{tBEEft>f{uED$E$ZuۋE[^_]f~}uf~uM[^_]xUWVSU}DžDžDžDžE uGE E G EGG؍uE uM}fH9z مtz\uJtE@̓fH9tiJufE tc[^_]É\@[^_]G4}뫋}UWVSëEPtF@E䍃E7~fu6~fu0NUDJ@uu\ *ƀ8t;>otĀ>ouw~nuqNUDJ@uu]\ ƀ8uŀ}#] >D] D$ 4$W3t\ ([^_]D$ED$4$ juNUDJ@u;t7D$ED$4$iu,NUDJ@t\  \ tD$ED$4$iu2NUDJ@tz\    uD$CD$4$BiuDNUDJ@\ @k$1f|D$D$4$hueNUDJ@tQ\  F$6OvƉ\ 8ǃ\ ftD$ED$4$]hu NUDJ@t \ tD$ D$4$hu'~=u!D$=4$%1] AD$vD$4$gu~=tUt$] D$ FD$D$0$FsivffD$=4$0] UWVS ð}F$D$<$gt ƅu㋃] t$TUǃ] [^_]U蠝IF$V]US聝&] u []É$Tǃ] []fffUWVS.}M |u1t‹E1t E]ƅsM\L$$ @uIEL|sxED$D$<$S|1EEċEEȋEE̋EEЋEEԋEE؋EE܋EEEEEEEEe0fEEĉD$D$$OIƅrt<$aD$|$F$||EEdDžhƅxE`ElUEEAdD$D$`$ttu{l<r:sDžllE$(ul0lLEDll2D$lD$$xEUJv9|UJv9UJv9JUJu92UJg9UJY9UJv9wUJv9^UJv9UJ9jUJ9aUJ9+UJ9UJx9=UJ9UJv 9h;MExQhEtEEt3ЍLX& DQt &XЈUEt3ЍLX& DQt&XЈUxtOE@u,E tC&DB4DD$D$D$F$EƅxnƅxDžltiE\D$D$$KEhDihxEs^tE+VĨ[^_]EEEEEEEEEEEƅr|4UEh Qx9rsD$1ɉL$ $M<$U1EID$@a$EE EƅsuPgE$1ug0yD$D$F$J$.Dž E|ƅxDžll$']g1E`DžhECD$6D$F$7E!EEE1ƅsu3ƅxqFTbp~EL$X<$?…EhxhXM >l/hHhωxD$xD$F$%sދhEDžhEeY1lrs2lƅxrhu"E ?ƅxDžlƒhE`D$T$F$RE<Džl|DžlmDžl^qsƅx1l31lEƅx1lEUD$D$D$ ED$E D$E$[]UVS艒. ] t<] D$D$D$ t$D$E$ t2[^]$FƉ] t$m ] u] [^]UWVS Ü,] (] $] ,] (] $] R9rVt $s (] 4$$] t } |$t$$詘‰,] u1҉Ѓ [^_]ËEЃ [^_]ËE D$|$ $D$D$$U,] "UWVSÚ`<$vD] t%0] u1<$Y[^_]Í0] D$0] $(x ǃD] 뵉<$1UWVSr`4$D] tL0] <$V9E s"4$[^_]Åt10] } 9r1D$0] <$S(x ǃD] _a84$hUSŏjE$&ǃD] []UWVS8蓏8D$$D$D$D$$D$ |$(|$D$$̊tIM w:E t(D$411\$t$l$Uƒ9r؋E e[^_]ùE ffffUWVS Æ$4tƀ8u^ UD$L$ D$D$H] 4$nKUE tE 8 [^_]D$ ED$4$lxT}untHuG<&wt$٤$bD$$bt$$bH] Wu @9|w뵍>9,s@뽍ЉED$ $3bEEUD$ $ bMEbffffUWVS8ã1E11҉la rl] w._a D$ D$D$$$aa T$$ XD$\|$4$A08t߉la 8#mD$\|$4$@t8t㉃pa D$\|$4$@t8t㉃ta D$\|$4$@8t߉xa ǃa ǃa D$\|$4$Q@t>8t$+a D$\|$4$&@t8t$a D$xa D$4$CD$\D$$?ƅ8tщ4$Puċ|t| >t|$$Tuቻ|a ?xuxu U+8[^_]Í\D$\|$4$?.8t߉la 8#kD$\|$4$>t8t㉃pa D$\|$4$>8t߉|a 8xuxxu x xa 8sxwxta D$\|$4$B>tM8t$a D$\|$4$>t"8t$a |a uea D$D$$]Qǃla BzT1mǃxa ǃ|a /T$$RuUVS虈>a tutKla [^]ǃa 9D$._4$Ia ut$ʕ$1[^]UWVSúuǃa a t-$`t$la $QtEu1>9D$._<$"Ia uщ|$ʕ$1la [^_]UWVS耇%uǃa a t-$_t$pa $HQtE/u1>9D$._<$Ha uщ|$ʕ$1la [^_]UVSÈǃa a t$O_[^]Í9D$._4$Ha u҉t$ʕ$h1USqa t$=ǃa []fffffUVS2׸Eu tt#W[^]Åt u 1[^]Íw$[^]UWVS…g}u D$<$Ot*wD$<$Ou t1[^_]ÅtVUWVS8G1‹E1D$ D$ED$E$KE…uZDžDž${${E+0Ё8[^_]É$r T$ D$ED$E$ƒ$rnEDžDž9~&t$$fwt$|$ D$ML$U$HƃD$|$ D$ED$E $Y9D89trtftƄD$D$ D$ED$E$rƃ9T1҃8-DžDž1Dž1UWVS@XUE 1ƋE1D$ D$ED$$-Q…uZDžDž$x$xE+<Ё@[^_]É$oT$ D$ED$$ƒ$owBDžDž9~&t$$ett$|$ D$ML$$$ƃD$|$ D$ED$$29D89trtftƄD$D$ D$ED$$Hƃ/Q1҃8-DžDž1Dž1vUWVS@NUE 1ƋE1D$ D$ED$$Q…uZDžDž$u$uE+<Ё@[^_]É$lT$ D$ED$$[ƒ$lwBDžDž9~&t$$[qt$|$ D$ML$$ƃD$|$ D$ED$$9D89trtftƄD$D$ D$ED$$ƃ%N1҃8-DžDž1Dž1vUWVS G|}`"D$E D$<$ututf [^_]UWVS {Ì}`"D$E D$<$SutuFtf [^_]UWVS {,}`"D$E D$<$ututf [^_]US ){έ1D$E D$E$ []UWVSzÖ}U Ơ1E1EteMyu )čD$UPtMP}y:u}D$<$X{U+ue[^_]øUWVSRzEEM Ơ1E1EtgEǺu )ԍT$ MJtJx9uD$T$E$vU+ue[^_]úEUSyRED$ ED$E D$E$EUS {y ED$E D$E$;US PyED$E D$E$H<fUWVS !yƫƉUt/ t"D$4$^0uM) [^_]&DPu 1 [^_]É4$s [^_]UxREt8t 1]ø]UWVSX|x!1EEED$D$Ẻ$-la }e1󫍃a EЋM̍a |t:tEЃ9s EЄua t$.D$Ẻ$pFD$dD$Ẻ$pEЉED$D$Ẻ$epx,uЍ$D$4$Ab 4$CnD$:VD$Ẻ$_tb EԉEȉD$(WD$Ẻ$jsDEԉa EȉD$fD$Ẻ$t}4$6T9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vLc 9u(ƄLc [^_]Éր>/t>srLc ǃstftƄLc [^_]ÉڍgffffUWVS1p֢E$5}|L&DB &fkfbfg@?AD$ ED$E$CEUE8E9t8u|@8"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs @[^_]þUSnzD$ E$m[]fffUWVSnF}tz?tu<$X4D9u p9ti8/t9t`sc~/t9u)=vLg ׃rtftƄLg Ѓ[^_]øsr€8/t Ƹ봸gUS}Ѝ~}E@}GEЅ>MUЅM E؍ZE&D$ ED$T$<$ƉEMEU$c1ɉpƉEE M]ȅt)ExQ)؍)MEH}eMEoMMЅGEP$1ɉƉEM =MEU$nƉEE}GEЅMMU$5xƉEMwu?%}ЅMEU$ ,ƉEE}GEtYMUЅKEP$ ƉEEx @uMEЅM E؍QuЅETMEЅE؍HM$=1ɋU[ƉEEMEP$1ɉ.ƉEE gMU$ƉEM踓$I )؍))ыEHEMPЀ E MEEЅMU$c1ɉoƉEEȅmEHQ)ȍEE}GMEP$;1MEP$ EEЃ} uG' MEP$1ɉƉEEUMuDBuMU$c1ɉwƉEMEMpMElU$'1ɉ5ƉEE-l}G}eMvMEMEЅ7E؍:%]ЅE ,}tz]ԋEpE@El‹}̉)ЍH$I )Ѝ))ыUčD)֍D)}G؃Eԃك}}}Gw}Dy@&V؃DY@u] utU܋DB@UЃ@)FUDBb3v%ME)EERUЃAD$1$E؍lډ[t"UB M)i]D$1<$E$&ډM]K U¤1cULO&D$ ED$E D$E$b]UWVSDOûEu lk 9PMP M܋HP UPUPUElS *(0T$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$0 9D[^_]ÍMP MMIH??? F??? F?? ?F ?:??F:?? F????fF M늍H09gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ l0D$|$4$A 9T1D[^_]U&Mlk D$E$]US8MåEЉD$E D$E$tUT$$8[]US4LaEЉD$E$tU T$$m4[]USL$E$Ctlk T$$4[]fUVSEFt$8V tQFtB1ɉωMT:0$8V T:($8V D: $~8M;NV r$h8F,t$Y8F4t -$E8F8t$684$.8[^_]UVS?As4$k D$E$LJ4$裳[^]UVS@ßs4${k $3J4$e[^]UWVS@`s<$qU&E܍uu<0 )E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruuTM؋ut}u9tvwn<.uQy<0#BÃ߀XtXtbEf)Ǎ|&uԄIEDX@; [^_]BuԍE9t1 1UWVS T=o聧D$OD$&<$$E tED$E D$<$hD$$ E$US<ÂoTUT$ U T$D$E$qqffUWS<GoLl 1󫋃Tn t D$ D$D$$H[_]UWSM<nLl 1󫋃Tn t$ǃTn ǃPn [_]UWVS;ÝnTn tELl D$ D$D$4$x;Č[^_]ÍD$4$Tn ($SxT$$pTn E Et[T$ D$D$Ll 4$uLl utmp Tn $1Č[^_]ÍLl fǃm Ll Pl Sl T$ D$D$4${Rl 0Tn n n  n $n D$4$Tn 9D$4$Tn t:ǃPn Pl xfm _Ll Ll UWVS9nlufFt%=Ll FftFfwfu1[^_]f9t'wufwwF 9ll uٍLl UWVSH9k5Ll E$Epl FwD$ ED$<$Gtũ[^_]ÍG܃[^_]UWVS88zku1‹E1D$$󥋳Tn O$D$ D$D$Tn $D'DžTn D$ D$D$$31t7Tn $D$D$ D$$hE+I8[^_]LqTn t7Pn mLl $ǃTn ǃPn Tn tPn 1]Tn $Ll NjLl 󫋃Tn t D$ D$D$$C$ƅTn $GD$D$ D$$ >D$ D$D$Tn $B<DžTn t"Pn uhD$ @D$t$<$"tcD$T$$j}ԃ iLl 2芝1D$ |$D$ $/6$UWVS 5ëg}D$@<$t=D$E D$4$4$ϡ؃ [^_]D$D$!@<$ĠƃtqLl 1fǃm Ll Pl Sl D$T$4$+K84$38^UWVS 4èfu4$=w|xt 1 [^_]D$t$$fLl 1󫋃Tn t$.ǃTn ǃPn  [^_]UVSUE HJH J$J(HrDprHprLpZPXH X$[^]UWSEU H H JJ$HJ(xzDxzHxzLXZPH X$ǂP1u>uDtftǂDǂHǂL[_]êtfUWVS(e2 eD$D$ D$D$@E$+E EED$ ED$ED$$UR Uu^}uGEtR}u츬u`umtftu$R([^_]$OU1މU$EUu11ExfUVS$A1cD$D$ D$D$"@E$tKÍE EEEEED$ ED$ED$$S$S$[^]þfffffUWVS0Fc}Et5[^_]à M ME} #>E11} ;cg EEE}u#Ћu0}91dtt<u|7u9tȋ}*E T&U &DPttE 7] Ј} #} U &DPTu Vɨ=E bE 0<KE] DЋuQ} -} ^E n,E T&3E 0EEu } \JEt } %EEt } &=Et } =]E E E} ?gU  Ћu9E T&7E 0] E } = ]E E 0<E] DЋuuE } ;U &DP"EDBE ]=&u DpuE /E 0uE E EEEE\EoE zE iE XE G}d}ufEcmduE 0 E P] &WE &W ti1WL AUWVS,*P]} EEEP]tsMM؍MM܉UE< )؉EED$ E؉D$ED$E܉$wAMEE@uEYYυtl+E,[^_]É{MAt>U9t-ECR uEyt E됉UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$^]UWVS)ê[utn />3)Ѝ)Ѝ:~ 9w$&|n um"U$Ѓ|n U4$Ѕt?w$WD$ D$$UUЃ[^_]É4$uw$Wt$ (>D$D$ $UE Ut1҉Ѓ[^_]Ë|n t;U$(*NjU4$CЃ[^_]Ëǃ|n 뫋U tuW3ǃ|n dn ^D$$=tn Jǃdn 1+1UWVS 'ïYupn ))Љ):~ 9w$&xn um"U$Ѓxn U4$Ѕt?w$WD$ D$$UUЃ[^_]É4$uw$Wt$ (>D$D$ $UE Ut1҉Ѓ[^_]Ëxn t;U$(.NjU4$CЃ[^_]Ëǃxn 뫋U tuW3ǃxn `n ^D$$pn Iǃ`n 1+1UWVS%óW}E$Džln fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$}MAF$U 1[^_]Ë|n VD$ ED$$E$@F$맋|n u$Ѓ|n $('ƉuE$@O|n at $Ѓ|n @~u㋳\n uED$$=Ɖln lǃ\n ǃ|n IUWVS#ôU}E$Džhn gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$}MAF$U 1[^_]Ëxn VD$ ED$$E$ @F$맋xn u$Ѓxn $('ƉuE$ @Oxn at $Ѓxn @~u㋳Xn uED$$Ɖhn kǃXn ǃxn IUWVS!ôSUEtЋtn t'Ǎt$9uǃtn ǃdn ln t'Ǎt$f9uǃln ǃ\n ǃ|n EE EE1[^_]øUWVS$ RUEtЋpn t'Ǎt$9uǃpn ǃ`n hn t'Ǎt${9uǃhn ǃXn ǃxn EE E E1[^_]øffffUVS$2QM EEEUEUfE4tvu} fUUT$D$E$肋$[^]ÃuMfEED$D$E$Vt3f}t u9u61$[^]ú땺l#fffffUWVS*PpUE DžXE/tBD$E $p8%E $uv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p])%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $p荇Dž`&$`pcD=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5p=?t9E tX$pc1nىf t~uf.륃8/utщ$pjE tE XfE pHE /t/tp p?p>1UWVS"K}E ttrD$<$c xX[^_]Et$<$}X DžMtAt$$# ymt 58"tƉ<$1[^_]1fffffUWVSqK}<$)n $n ǃn 7ty&E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ën t$hǃn ǃn  yEUVSE] :tu1҉[^] 8ut$8tù@tσ}:t$ u}:t;MuPx@t[^]Ät:u‰[^]UuIU]UWVS}u 8u u|t1:t,t(9s:t|tu[^_]1UWVSlWH] 1‹E1}! Mu$n t\$4$,$Dž  DžUD$ D$D$4$DD$D$ D$D$@4$$D$D$@$0E<DžDžƉ1ҋ9slpȀ ':Dž\1҃ t t DžO9ϋ9rD$D$E$@؉؍pȀ Mx@<#D$$ߍAbDž|D$=D$<$… <:<uz)ED$T$E$qƋtg<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $vT$t$<$`$y@E<$gDž:ύO9))|$$)ljx1kO1tCȋ)Љ)Ћ))ӉL$$ÉNjÉC:{DžtE$})P9rg8E+l[^_]D$ D$D$E$DžD$<$xn $Džqt$$"DcƋ40<$%0Džu*$NE$^{ËE$K{jnƉ<$$D$ \$|$4$V tBt(Pu2Dž4$VDž$EH $DžL$T$${4$Vf18Dž<$tE$y/ <$n 4$Vċ$Bu/$% {tE$0yUUD$ED$$M E]US È>n t$\ǃn ǃn ǃn ǃn 1[]UWVS, />EE 1E1Džn n &9n tn D$n $j6D0Dq@:#n ux|\u ǃn ׍:\tWut$n $5lDҀ|\tǃn ǃn n $AƋn $^ǃn n Pn @L$$n dǃn ǃn ǃn f:wu<:tAt<|uD$t$$ƍ@E+/,[^_]Ën $uhn $*ǃn +n n 09D$n $n Kn t$贿ǃn ǃn ǃn ǃn ǃn Zǃn ǃn ǃn -$?ǃn oUWVS1:u} n t$ǃn ǃn ǃn ǃn } u[^_]UWVS &9]D$=E D$E$$d>Dž<:}dUN<\Έmt>}<:tk_]J<^uF<:mu‹]U)ӉߍCdD$$],ljEEd<:uU_F<:PЀvH2Mɋ]0FE1U]ND9ut 0vU] :U]؋})ptD$<$]EtcE] [^_]ËU }1볾ʋE$]뵋] <$]UWVSÍ7]D$=E D$E$e$dƅ<:d <:t?Ytru)Cd]D$4$]Mtƺd<:uȉƍX)ˍ{t7Ή\$4$]u 4$]@ȉ)ˍ{uɋE[^_]1밿4$]ы]B UVS D$#E D$E$6tv80tP 1F<w1F9~ƒ1F< w9E1 [^]ÍF<wF@ctftƄ/0DžDž)S$J9>:7 81Ƀ4uA )čD$]pxr󥋵t$D$$lD$ D$$j|$t$$jD$)D$$judursr1srrBvBDžfzngU 11D$E D$E$]UWVSÈ1}U Ơ1E1EtqMyu )čD$UPtMP}y:u}1T$D$<$2kU+ue[^_]øffffUS30D$:$Lr D$ $kHr []UWVSHÆ0u} }ԋEE1EЉE1D$,$Jsr u}MfMUT$U܉T$ D$ UT$$buM vU܋9Eo} ur t%9r t1uЋE+H[^_]Á} u r uD$D$$UE؅thEċE؉$YKfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$UDžuED$UȃT$Ẻ$;EsE؉$X % ЉD$PD$ D$ED$Ẻ$߸;E1B9EBf9EwB U؍yM|$D$Eȉ$EċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$7W3")UuuB r EfFcUS-D$n \$ ED$EU $T$u؃[]1[]ffffffUVS<7-M uEEEQEUAEt8MEȉD$L$E$)uUȋM̉NU܃V<[^]ÍuD$t$E$<[^]ÅuUS,Ë,EEEEE܍ED$E܉D$$duE,[]US,7,EEEEE܍ED$E܉D$$duE,[]US>+EEEEEE$#d[]ffffff=̀rS[Ô+[ḽ̀rS[t+[̀rS[T+[(̀rS[4+[L$S[+@&[t'L$̀rS[*@&[ US (*D$E D$E$^ []US Û*D$E D$E$Gl []USi*D$ ED$E D$E$][]1UWVS(*}E 4M0M( 1E1,hEED$E$ziD$h8$FjhdžPdžTdžXfDžD8H<$蓼L$8<$褔L$8l9t$LbYD$<`T$u%f贌 (fqX1U11҉#UVSʺcEEà1EE EEEMED$ UT$UT$$1{xEU+u [^]1"UWVSOEEà1EEEEEMU ED$ }|$}|$$xEU+u [^_]1"UVSǹlu t44$D$ UT$UT$$1ҍE[^]1UVSuut54$1U D$ ML$ML$$ED[^]1UD$ ED$ED$E$M 1ҍE ]UU D$ ED$ED$E$ME]UU E D$ ED$ED$E$ME]UVS舸-EEƠ1EE EEEMED$ T$UT$$1BxEU+u [^]1e UWVS ñEEƠ1EEEEEMU ED$ |$}|$$xEU+u [^_]1UVS菷4u t74$K}D$ T$UT$$1ҍE\[^]1UVS:ut84$|U D$ L$ML$$E[^]1UWVSÈ}u t74$|D$ T$UT$$1҉[^_]1U胶,D$ D$ED$E$M 1ҍE`]UCU D$ D$ED$E$ME]UU ML$ D$ED$E$ME]US ŵjEEEEED$E$!E []UWVS$$DžE = t߆Iƍ̔D$D$ t$|$$ tyDž 9AD$E$~uƋI} t9rcJ8 uv9t<$5$螢Dž谅9t4$Ё$[^_]ÉUE D$E$K]fffUWVSfƃ ‰ ‰ ‰ ‰ z|$F$tF~1[^_]øUWVSY9H rn~t PRuF$D$ D$L$M<$=^ڋM΃tyE:BGuETB[^_]ÉUy(MRED$|$F$SpM.Uu ~ MLЃ[^_]ÉUWVSyljօxlxD$$UtE3G4U3W0 u|3G}/Ef@H!V(EċHDhUWVS$E} bD$,$]eƅ EF$~(E }1҉u׉$]{l9sǃuuV(F$} }܉Eq@DEE1}EC]E  $M]kÅMV(F$ÅP@DECCTCF(fufCHEwCMEX]E e}}UtEv NjV(F$MtKxf@H F(E$[^_]Ë}]v$]țuE$]趛F$]訛4$]蝛1뤃&]]v1s}D$D$@]sr$F6N(-E$]%V(F$M71EUWVSê}tH@JHDy$貚VDxpup$藚VDy4$舚wtv$tuGt$aG$VG(t&<$H1[^_]Ë@$$hdG$ ƃtG$D뻉ttEG$&<$EttUUWVSÑ}7QG(EVLfFLNHtlfv$fVDFLf97tȍD$ D$D$ī$iQffu@tUV8N<3O3W tEFJ Gt uƉv$՘uuGfFHuE[^_]ËOMt+tKG(uΉv$茘uuGEGu0G)tE뛨uNjGEGGMIQ(rI|/u/uV,UT$VTT$$v7E[^_]Ã1ɉCfFHpu$贗~DWMA(AD]uFJF$G(u$F$$ My fAHG(uG$F,F(NTD$ML$G$D$/M $At;9EP$Ue@MD$UT$E$HMN,GFFF8Ve[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(WD$$T$ D$0T$4D$T$ $D$ D$L$8D$9\$(=h"D$8D$@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]ffff̀rS[$[UWVS E<؉EUt`ME9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu [^_]UE]UWVSTΊwEU }+ &E EẺ׉U }G$]xEȅU Eȍ 8MЃƃЃ)UӋMщMԋUT$U$M‹EUȍD]Љ]\$EED$]$U1ɅMM9MXEEUȉUEEE؉E܉}ĉuEM4u}ԉ9du E9s#ED$ED$4$U9Etщu؃9M؋]U+uED$T$U4$U}9NjUt +EMC6ˉUE‹E9r]U}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ċu]9.EEE}}čGU9 Eщ}U܉EA‹M)ʋ}č M9~ȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅?U!ED$\$<$UU9~]E9rՋE9M̅qU܋E 9r}G9C)EE܋M܋E}89uM܉E}9}M9M M]E̅{U܋E}Ћ029r}GU9IЃ)E܋}EԉE9JEԉEG׋E9EEĉ$]i}1T[^_]ËED$E$MEEЉEȉEċEE뱉ˋ}M 9sWEƉ}Q+ME }uڋEE‰]M؉EE HZ9Eu]M9r}M3E}ljMU]XJM9uˉM]9sMˋMUzUuދM9U]ۍuM9ƋED$t$<$UM9Ӊً]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Yu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}ZM]U9UU̅U܋E}ԋ029rUB}9G)WUE9}܋u9rUB9)]E؉ËuEߤ9uu]]U+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE'}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UlEЉE}ċuEMЉvE؋MuuEU)ЉE؉ڋE]XJ9u]uE}9EŃ}tu|$}ȉ|$$]} SUnUT$rBD$ ED$E D$E$c]UWVS -ֳEuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]*ot"N^HXVP MF [^_]ÃUWVS蠀Eu91uu[^_]=F$$4$*NjF$$[^_]UWVSD}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$6GWG1D$<$tG9F [^_]fffUWVSFuQ8F}9FiF FD$ D$D$$d6FVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_]KP1}9P81F u1UWVS~=}91t2G$$ D$<$ƋG$$[^_]D$<$Ɖ[^_]UWVS '~̰OEO910E@$$D$E$,ƅ@ ‹} >HE@$$OtlEM 1 [^_]D$E$ƅt[P } uuuFNuN}8눋E@$$oNuJdN}8E YMNIf뱤&fvftN [^_]E xDE xfffffff̀rS[Į[ḃ̀rS[ä[UWVS${ÆEEE EDM8D$D$ED$ ED$D$E$ wt 1$[^_]ÉL8 uL8US]{Ey "9~)ML$&D$E $31[]ÉD$ D$ED$E $A1[]UVSzÍEy ";}.D$@&D$r 4$R3[^]ÉD$ D$D$@r 4$@[^]UWVShz EU MtF &;4ut/M9t(\_rtwf9t)[^_]1[^_]fffK̀rS[Ô[UVSyztu,imNA90%[^]Ë40(9r,40[^]9r싋,UWVS]y},p^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓l40419|[^_]Ë]싃l40u޾ UVS@x 4$tu,U4$[^]ËE4$[^]UWVS wÈ,E 4$Xt,@}C}wSǃtǃpǃlE ,(E MH1} 4$E [^_]Ã}?vB}<6,0)ȉЉAUtplE P,щU쉋(EU0U)Љ?}҃?}}}Ƀခr4$EUWVS9vި,EẺEыE)ȉE䍃 E$tɋU,@tp|lEH,t)̋Eʉ014(E$E[^_]Ë,0)ȉGfUWVS/uԧ <$7Ɖ<$[^_]US tÛED$E D$E$ []UStjE$g[]fffffffUWVSt6ƍ\ Dh̀rS[4[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS cÕu}F9r+)F|$E D$F $Q~  [^_]1 [^_]UWVS bmu}F9r+)F|$F D$E $~  [^_]1 [^_]USbEU ]tHPP UP[]Í fUWVS1b֔}u t$<$t t&t 1[^_]Ãt$<$À[^_]ÍFD$<$}t̃t$<$l}[^_]UWVSaV}u t$<$ku 1[^_]D$ FD$FD$<$ntԍF D$<$,tF t6u$FD$<$|tt$<$|듸[^_]ËFE }F[^_]UWVS`Û}u t$<$u[^_]D$ FD$t$<$赀[^_]US `ED$E D$E$ []UWVSl`}u t$<${u 1[^_]ÍFD$<$ t~uD$0D$ F D$t$<$tUWVS_Ú}u FFt 1[^_]Ét$<$d{tFD$<$~~tӍFD$<$>{tF D$<$+{tt$<${USh_ UE JttH[]ËJuL[]ËJ t't@H[]RP[]JHRP[]ÃwJ8 JHR P[] | q f[@HFfffffffìrS[[v̀rS[[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^UWVSEu MtXMX89t=JuMtBu {U tr9uu 1ۉ[^_]ÉCu1[^_]1fffffUWVS(]ÏƉ1NjE1D$ |$T$$er<$"@9EZUT$|$$<Fu1U+([^_]E @NteulN u`L$$j '$!HN tD$ 7D$D$ $4t9urD΃sztft%D D$ 7D$D$ $ _u-ujFfUWVSZMƉЉU Ǡ1M1Ʌt=~t3E+ȁĈ[^_]ù۹Dž9Ff tvEtoEfD$ 7D$D$<$<$v9EXED$|$$&Vu5F~uN uF=tu ~tMEEcED$ t$|$$a4$9ExED$t$$F1@FȉC:9<W<DžEtL$ L$D$$8<$9EED$|$$d$ a+D$D$D$D$ D$؍ DD$<$Stk0$`ED$E$F <tt oEu̓t,ED$ D$|$$_t14ED$E$B1襾UWVSFtPtC1M]\$ ]\$D$$>t@M똸DD8D4$DDD8,D$|$D<$8ЉD1<$(\w1Lu .8t189 u拽,t t҉11蝞UWVSpA6hƉ1NjE1>$[$$A$11 rFFtGGFEN]1ɀ.уu9`d9@ HDPDDžDžDžDž<$p#8=R7\3G u$1ҋ$`{[$*$*1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$4*$&*U+Rp[^_]Ë넅tJPd9\.$1ҋD$ D$D$$Hu~d@}뎃1@<tE12Dž$1ҋ Yu@ WY81.늋$1ҋ^Y@u2u9,XGHDPDLE%$'X1)UWVS0rcEhpPt%={DžthE11҉ rMd11҉`d r`VtA<$vWWt[^_]ËhMEEdUMEE$lu`11 rU؅tkhd<$hE[^_]ËhMEE뀋hMEEd<$hЉd|diX\P}`1}dX  r\ LOTdDpPIHXLƋX9H`D$ PD$D$L$$hL$P T$ D$HD$l$&3xWE11҉ rlUEE!$\Xvl$$9T#X\dwc\$U`U؉h<$h(‹dG뎋DA‹@uDFEu11 rE@t`EEEE<$ML$ML$D$ |$D$E$ttwEЅUp[^_]É<$MML$UUT$D$ |$D$E$ytt?E$m _p[^_]ËUE/tFE$> gMEԋAE܋A EAEAEAEAEEUԋE{EЉƋ@uj9UWVS\ ÇDlj 1EwD$ D$ D$ $ƅ8#3D$4$D$4$xDž< < D$4$苑xt$$t띋AAA AAAADžD$ D$D$4$~#|$$Lu@9D$$*1U+u\ [^_]Ët܉ljtHt$GxGu܋vGt$<$utlwUWVS4AEȋE0xU11  rŰ]ȍ9D$$9EЋ]̍EЉẺEtCË@uEuEЅt $]EU4[^_]UVSaAuD$F $tP PH p[^]UWVS@ú@ljE1EG ut$kt$$gtӋD$$tD$F $kue$!@=wI$‰@=wЋЉ==1U+@[^_]Ë~D$<$tu狵1DžЍtftȍtftD$D$ GD$D$@$&9OtD9AD$D$G$Kt<0L9_YB 9@3t9'9uۉD$D$ $jKut$ D$D$$A+u9u [u3fvfvBrUVS 1 <ut$F $LE $MUF t [^]ÉE4$(E [^]fUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPEE);UEމE} ]7Et@9rE)uu U<u sCtft[^_]äftu^uE[uOuW] ]u\3]|fu SfUWVS -3EE} Ơ1E1WEEG?7w}8)‰T$ D$<$D$ED$<$EX1u4u:tftE+u& [^_]úx)끪WtfhUWVS$J2}Ћ]E E1EƋE13&8}DGt`EE؉<01E 1҉M܉MLAt;}t^}׍T3y1]E+$[^_]Ã}u-t( fɃa) 3믍NȀw볋M܉<.u9twQ3ЋEDP{<0#s߀XtXEE1҉3)AtstEt)Eԅʉ s1EE EM M 뗁EM tEF]Ds@9o]VfU ED$E$u ]ËE]ø ̀rS[t0[UWVS0V0uE 1M̋U1xu1 t8t)űU+u0[^_]ÍMЉM11ɉEċEȉ rEč ۃTЃut( tۃ\"u|1w eUWVSi/E4M 0u,}Ơ1E1hEED$E$nD$h8$ohǀPǀTǀXDžDB$a8HDž@DžL|$ ,|$0L$8$ǃt>8GD$H$t4E+u=[^_]ËHt$E4 cU9-UT$ U T$&D$E$@]UED$ ED$E D$E$]U-UT$ U T$&D$E$]UWVS$G-u4$buE荓UEEEEED$&xX<$ZE؉D$<$`D$<$b $[^_]UWVS ï,EX1TE1D$D$$+cƍ`$1D$XD$$P4PT$D$i4$e4$t'xfpTU+İ[^_]Qf\$c\t~։P6tN~ tu틅XD$F$uԋPGX$XcP$v11A$X`UVS'+uF tF 1[^]ËF0$2F0F($ F(F,F$FFN D$o$:FtF 뇍9D$$Dt F ^YUVS[*uF uu,F [^]ËF$FF F tԋ$F F [^]UVSF)uF uetaF0$F0F u9D$D$ D$D$$ F0[^]Ë$ef 뷸US] $)1U C []UVS=)u4$F$VFFF0$=F0F($+F(F,[^]UWVS.(E@0} wML$$vop< t< t򍃒D$4$v?x4$pfM Ay EpE pED$<$HvtbP1tJ< t`< t\E@H9tTE xFE7ED$$utgPuuE @4E [^_]Ã됉U }OD$G$nDžUtBExE xzt7@ D$$ *ƋEp0E$ 01jUWVS$p'EuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]ED$UT$E܉$誰MuTMEHE Hb@ ]\D$D$ E$W5]#0E$E@$`E@@@0$DE@0@($/E@(@,01$[^_]ÉT$<$]DžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVS@$u F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]fffffffUWVShf#]D$D$}Љ|$ D$D$ 4$3EЉ$EąD$D$|$ ljD$D$4$}9E1E1Exu0P!uftf9XP 9rEMȃVUEЉỦ$]UAEET$D$ $M]æMMUfEMzu7Ju%uftf;rɐz }p 9rMM̋Eĉ$]uFM9qFE1h[^_]@t`X Eua M̍LM9Bu7fE 9_19Wr fuu11ɉ ruu؋JM]΃vEtfEtu|}}̉}و]vtft}kKu̍\]r!󥍳u 9)jE $]HEEĉ$],fH MEM1f]uutSXރ u]uE1f]] t]uӃ̋M؋}OM܉OGJOr u1ɋ}tރ uE1ۉU‹Et-EtMtkE uЋU}O M 9t"vtZ붻u}̉~ utftuN yu M}OElu}̉~utft֤ӻ]9(bM΃EMu}̉~utftEEEủp1MrEtfEt}}̃Eju]]]Lu'u MmfmKM뿋Eĉ$]"YUS2E$[]USôED$E $)[]UWVS E}} 'v?NBCDt]D1 [^_]ÁB u$<ƋEEFGEFWUV O MN$W$=WV(F,}E=V-~U V O(N1t)NEȉF99U9} 9U4E E= =w=w=?w=ED$D$ 11 +D$$D$]JWF4N:V;m]衹4$P]ۃV(F,}EF-~E F O(NEEfE= =w=w=?w=ED$D$ 11 +D$$D$]dIPGV0N8F9/r<11͸11UWVS_D$E$RƍxD$4$赉}и9ED$D$t$D$ D$|$$Tt4$2SttFD$@D$ E D$|$$t Ĝ[^_]É|$t$%1߉4$RA1ȉ4$R1UE@ ]UWVS5EEU ;P snH,X<3t;t-?19r09Pr+HE)E1[^_]?SӋ?̋]螶Ӌ]艶UWVS$ÖuF$ED$ F(D$ED$E $N~;N:]f4)ЉMЉF$)É]]]f4)MЉF$)É]Ef4E)MЉF$})lj}F-VMуtitT <ωf0ED$ ED$)N8N9^ )߉|$4$K$[^_]Z D$ D$E$<" []ffffUWVS ƦË&8DG1]ҍDBD_u]E.tE1E;lrc uE ʚ; E1 ~  [^_]ADGt4ЍEADGu-EE늉El롃tEcЋEDЋ}ENUWVSÒIuEϹ̉))lQ)Ɖt$T$D$ D$ D$}<$by[^_]UWVSUuEU&]|Yc1tX|Yu]@t|Y@u]|YX1uEtX|YuEu؋u@t|Y@u]DY 1E|XDYuE}}.WDAE}@u DA@tDY@u]}EX2wۋEL 1EE<2w} 1}BRDQ@u DQ@tDQ@uM[^_]EEx}))u؍4)u)؉\)E؍4)EE܍*EEE"BDAuE1ۍEBDAt6Í}܍GEBDAu(GE3EË}܍DЉEBDA UWVSù ljE 1E`M!t0ܡ$D$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,odlLDžD$ D$D$$e uet[atL$pr r; ut$ЭD$$qu f})ܡD$|$D$ D$D$$b)t$$$t$$ W8HI$ED$D$$螙$mE+Ĉ[^_]}nu p;8u}n  P;8udt$T$ D$D$$b8 <$ܡ=!ܡ$D$ D$D$$j|$D$ D$D$ $Ir|$D$ D$D$$ 4$r|$D$ D$D$  $q|$D$ D$D$8 <$qsr D$D$ D$D$4$tq}艽EЉT$UT$ D$`2D$$-A.&9$D$$)Ѓuf~fffrD$ftD$$腖1׋D0D$D$$?9|ҋD$ D$D$w$Ph1D0 DAu.L$$۬9|ȉD$ D$D$&l$gaD$$ 0D$ D$D$ $UgfD$ u;D$D$$"g D$D$$f1D>D$D$$e9ԋD$ D$D$w$rf1&D>DBu.L$$9ċK$GD$9D$$蠓:UWVS-EĉED$ED$E $>]&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,+\D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[ẺEEfEEEfEEEfEEEfEEE`t2 u&F UgMLU x;uED$|$ &D$2D$E$ˑE`t jED$$;E`FED$ D$D$j$cD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,bWu Wz?uED$ T$t$E$E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$D$ D$D$<$f D$D$ D$D$$UeU D$D$ D$D$4$e D$D$ D$D$$UveUP D$D$ D$D$4$>eK赛$D$UD$E$ Ĉ[^_]ËED$ D$D$$)]ED$ D$D$$\ED$ D$D$$\ED$ D$D$$\ED$ D$D$$\dED$ D$D${$W\ED$ D$D$w$-\@ED$ D$D$s$\ED$$ IUWVS$1uE }Ǡ1U1D$L$ t$U‰T$$xVD$t# $U+u#$[^_]$.1%0UED$ D$E D$E$]UWVSF}ED$|$ ED$ED$E $x8Ɖ<$7uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$EƠ1E1D$|$ D$E D$E$&…tD$<$qE+u Ё$[^_].UWVS/}u Gu 4 Gt*D$4$}uUt E[^_]ËEtE[^_]UWVSþut\~M u ( ~t9uUt E[^_]Í L$D$ D$D$<$`EtËE[^_]UWVS(u} [Vu + Vt!9>uMt Ev[^_]Í|$D$ D$D$4$`EtËE[^_]UVSÐuF[ Bt ;2u[^]Ét$D$ D$D$ $_v [^]Ét$D$ D$D$8 4$L_[^]UWVS4U} tdLUZ~U ~t;u[^_]Í T$D$ D$D$<$^[^_]Í UVSQuZu Bt ;2u[^]Ét$D$ D$D$ $N^v [^]Ét$D$ D$D$$ 4$ ^[^]UWVSÚuPYw$ wWvK B  v|@vF@[^_]Ávf[^_]Á &[^_]Á v,!낃@t9u~jtucOD9,.#̨ 31t$KD$ D$(D$<$S\ˮۮŮ/UWVSâ}XWYD$t$<$Wx [^_]É|$7D$ D$(D$4$[[^_]UWVS.}VML rt;:u[^_]Í |$D$ D$D$4$*[[^_]UWVSLöƠ1E1E <tmD$SD$ D$.D$M‰ $MZMt#PT$UL$<$RU0E+u4L[^_]D$ .M‰L$ME D$$sM'UWVS4FEEEE$E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMB&DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVS^EM HMHMHMXˁHɁ@ =+-E E-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$#EE4$ #EE $"EUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$2D$u 4$RE$>Et $-Et $E Ĉ[^_]ú)‰U:EESEW)̐ u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]Í4DE4D}\$DD$@4DD$t?1ɀ:.u9u*u|.t A[^_]Éȃ[^_]1[^_]UWVS0膷+ME荰EEEE$RhPlPHH8|$ x|$x|$@ D$L$T$ ZD$D$4$s~ Eƀ0[^_]UWVSÆuu Gt-D$4$nu?E tE [^_]Ë?D$D$4$fF@먋FuxUVSÑ`1Fu t$&XD$ D$ED$4$[^]UVS蘲=`1Fu tE D$ D$ED$4$[^]UVSJ`1Fu wtED$ E D$ED$4$x[^]UVS,â`1Fu *tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$k,[^]ÉED$4$:EUVSn`1Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EU`1U]Uް`1U]USeED$`1$r[]UVS蒰7`1Fu t$ED$ED$ E D$ED$4$9[^]US?`1$[]UVSý`1Fu Et2ED$ED$ED$ E D$ED$4$Y[^]ÉED$4$qEUVS 襯J`1Fu t9ED$ED$ED$ED$ E D$ED$4$t [^]ÉED$4$EUS,ED$ED$ E D$ED$`1$[]UVSÎ`1Fu t4$[^]谀D$$cUS薮;D$ L D$ED$`1$@[]ffUWVS QE8tj׉ƅt|$4$rHt@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS(辭c]Uϋu U MUL$T$ L$U‰T$$EU ;tMUuE@@P]]]])ˋ}([^_]ËUt M t.t?Myt6:u1|.t'PM9r$H.ȋʋ]]돍눋]2~EE}8wUWVS般-ƉЋ};stʉË9s/u!uuÉ)1[^_]äftuuXf}UWVS(ÈE׉΋UU؋UԋU$EM9L9MyʵE荃EEuuE9D$E$=t4$MEx4$Myu|EԉEu؉0([^_]Ë}E$E}9}uAP9s:)؃UvM {9Cs1[^_]É4$Ewx+[^_]ÉM]{EEMUWVS+ÍEuE(},M }0tǠ1xU1҉M$tt$$Cƀ?vE4$t^򋅤t)t"<.g]<0M|0.70J1U4T$L$E$?ƅ)‰U4E$kE$T$D$T9D$ D$dD$$C‹ $a{t$ $ K}Mt}w}M$U$ D$T$L$D$ D$dD$<$DB‹$9B|&f @)ȉ~ DžƋD$D$<$W9u׋)$$|}|$ $1ɺ0-kf; F01x JDNu.9uҋ‹)‹ $9Vt)ЋxU+.Ġ+[^_]Á}o}$M$ҵU$ew`E4$srx.D$$1ɺDž@f; @E4$Gj벍D$D$$U &yt)}$<$WD$ǶD$ D$dD$<$>‹4$t$D$E|$D$$U O<$wg|$L$$D$Ƕt$ D$dD$$=‹ $ GGD$t$ D$dD$$I=‹ $G$D$t$ D$dD$4$<‹$E_wG9D$|$ D$dD$$l< $y}$C4$ fN~F$$T$|$L$D$D$ D$dD$$;‹ $$n9%4$N $D$|$ D$dD$$;‹ $o4$$GD$|$ D$dD$<$:‹ $ $4$kD$ǶD$ D$dD$<$V:‹4$t$D$$U >)D$ *@t$L$$ /&w1E)0~0 $09t4$d‹$y}$!<$WIL$T$D$fD$ D$dD$4$8‹$.E$HD$ *@t$L$<$-B$$$#w1E)0~0 $w09"4$b‹$@yY$ƅ-lj$w}u9e$>7M$)ҵ<$WD$Ƕt$ D$dD$<$6‹$4D$t$ D$dD$$w6‹ $GD$t$ D$dD$4$)6‹$}99D$|$ D$dD$$5 $yw9u$VƉ9?$wy}+}$Ƕ=|$D$$U 6<$w|$L$$U <$)ƒ|эҵ}$ }4|$ t$D$$4$^Ɖ)lj}4GD$YD$ D$dD$4$3‹$G9!Dž1p`ƀu1$TnDž |$D$ D$dD$$2‹ $QP9 ~F$B= $I^|$t$$U %<$w4$L~$D$D$ D$dD$$1‹ $m<$ݽ~$KD$T$ D$dD$$0‹ $<$efF $SF $ED$|$D$OD$ D$dD$<$!0‹$u}$<$G$購D$t$RD$ D$2D$@4$/‹$4$flj4$w$}lj$,F$"_lj<$|$D$$U kE<$G$QT$D$t$D$ D$(D$4$-‹$7U$r VUUU)ʉЃ=J$n}$S4$F$$QD$t$|$OD$ D$2D$@4$,‹<$"<|$D$D$D$$U )1LM9/t؉4$D$D$ D$dD$$+‹ $y6$~@t$D$E$$%4$V‹$C}$.t&#E4D$ t$D$$4$UE$ VUUU)ȃ=Y $  E$ ҵD$ D$D$D$ D$dD$<$C*$|$t$$U p<$w9SF$葶t 4$肶4$wD$D$4$]4$CTD$D$$U n94MF9Gt1Gt`$D$D$ D$dD$$y(‹ $uPED$RD$ D$dD$<$ (}$@<w}$iD$Ƕt$ D$dD$$'‹ $ GGD$t$ D$dD$$H'‹ $GD$t$ D$dD$4$&‹$NhGG<A}4|$ t$D$$螔4$RQƉ)lj}49a)=$w}$E4D$ t$D$$4$P@t$$K}$<$fWD$ǶD$ D$dD$4$Q%‹<$<a}$@ҵwt9$:"<}3$w xYG GGDž====Dž$1lj9Mw>9Gt1Gt`$D$D$ D$dD$$"‹ $-GuP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$ Dž====fDž==e)ҵ3|$ŶD$ D$dD$<$‹$9SD9D$|$ D$dD$$^ $yD$ @t$L$<$T o w1E)0~0 $+094$VI‹$yD$ @t$E$D$$=q .w1E)0~0 $E_094$H‹$y'D$D$ D$dD$4$d‹$?9@Dž@DžDDžHDžL@)‰t(19rU4T$ D$t$$}4$+G)ʉU4@9<$w^x|$t$$A,4$|ljF$E|$(>D$ D$dD$<$$Nj$rD$ $1ɺ%c$ "<<$茧Nj$M4L$T$<$d‰)M4|$ $1ɺI<$ #F`$谦NjB $M4L$T$<$‰)M4|$ $1ɺm<$.j$ԥNjB$"Ɖ)lj}4S$wεҵ$srD$ @t$L$$Rw1E)0~0 $-094$X=‹$y|79S$wε+ҵD$wD$L$D$ D$d1ɉL$<$‹$"7$B UWVS8qvE  U8usrE}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]UupM8E#,0]UWVSuCu})R|EtG9E r'Gf|t+E D$<$膚yF([^_]9} r+E[^_]UWVSuEEu} lj~P9rCffVP9r1PffV 9r1Xff\V t9s]2F(?1ۉ}D^ fu61ɉLu}9uF$F(F,1[^_]ÉD$ \$ED$<$xUWVS)tҦEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$uF,F,^(NMD$]\$ D$ED$$] 7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~GF$gF(F,bCM]C]C(UWVS qEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$F,F,^(NM]T$D$\$ D$ED$$]蚣;F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,cuAN]]A]MA(ffUWVSoVEM} QyYm M0ȈE<ƒ?ك}Cu썶 ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u;Eu[^_]} Oσ7M)11}U+u\[^_]ø'UWVShsEE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EEu}: w( ]u#M EÉ$SrE}~=Ut3}& &w\DAtu܋E })[^_]ÍM U$WE6M E$DxgEEM E$HEx>EM EÉ$MM|xEM?fffffUWVSffu4$,H9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} O7(qUWVSeQE Ơ1E1D$|$E$xFD$T$$zxT$<$U+u [^_]XfffffffUVSd×EuUMx#L$ T$t$$y!x9s[^]ÉL$T$$+[^]fffffffUWVS d&utcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#f5UWVS cÔutcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$"4UWVS _cu t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!s4UVS b|uD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVSobu} tAv-u3D$4$$tD$4$`%F1[^_]3USbèEU tttu P1[]V3UWVSa^}u t' t:@trt0 wvONuI2[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVS`Ú}u tPD$<$#tD$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$t߹D$t$|4$bD$|8(D$tـ|\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$t "݄$4ݜ$D$P-otj݄$D$tL1ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$tn("݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$Mt$ $D$|$$$\$t ݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$tD$`$D$h${D$8$oD$T$c\$P0D$tـ܌$T$`ݜ$D$d\$t;"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـ\$HL$H\$Lـ0OD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$t "C$D$\$t$D$4$h$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tD$T|$h|$$$ځ$|$P3'p$\$tD$`$D$h$D$8$D$T$$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$ qMA=w$ʋ]Z ] Z]ZA1[] UEt u]ø]UUt< t< u u]UVS=tpu>t'4$D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US=oEM t.9t*ҶD$ $D$D$p4$=[]US<foM E%t.9t*ҶD$ $D$D$p4$[]UEt t]ËE ]1} ]US$<nUE ~;u;t5ҶD$ $D$D$p4$<[]ǂ[]Ãwǂ[]US;@nEU tt 1[] UWVSZ;m$ )Etc@@ D$D$4$ u E[^_]q 84$1b 8EE[^_]UWVS:cmuF~O9tHNM 1[^_]ÉU ED$|$E$U uFUF맸UWVS8:l}t;t-M tWt1$0;wr$0<$0[^_]UWVS9lEPt7E1U9}t#E4E D$4$u߉[^_]1[^_]UWVSy9lE@EEE19ut|E}1th|$ D$t$E D$L$T$ 4D$D$4$@D$t$$ ljUED$ D$E D$E$4UWVS87djEu}1E1>'T$ t$D$E D$D$|$ 4D$D$$Iu(u~E+8[^_].|$D$ D$D$4$uD$t$$蜡tLH󥋅D$ D$D$$5: ǃ$S…1A<+wluىD9u˃u뷃z럃b뇃Jl蔝UED$ D$E D$E$R]US5gUM˃wBtJ[]ËE E @%]3 ؉BtBt븋E E @BtBtUVS8e4 gEtyE5EEEEEUT$u܉t$U؉T$ D$E D$E$T=tD$ E؉D$t$E$؃8[^]Í8UE@%-@~1҉D$$$]؉=?w1҉D$$$]Ã1D$$$]ú1UWVSut%ӃKE tx9uu 1ۉ[^_]CfffffUWVS$ 3Ǧe}EU܉Mtȃ"uFEML$$](u]-K+EE0YEE E 1009]~Dx99Mع_SЀ vȍSW9]]؅t U܅t}܋u7$[^_]ExEFuu1UGM9\]"LSc7؋M܅u}bxEE܅t}818A V1ҍ=tftH<@ lj)99_ ΃r뀃< t< t򍃌D$4$ߤ1Ҁ8 Ht$$t9$7%$< tW< tS< 9szwD$ $H< u땸1$@ z)׃ (D$$OtljKD004$^@9]‹tft‰)‰ DžNtftR :)944$p@9o‹fBf 0mDž1 P$uTfF()׃ (D$$Tlj$,df\UWVS` þREEEǠ1U1ҋ@E` D$ .u‰t$L$E$(}EE4$pML$ML$D$ t$ED$` $Kt\E$?E@ U+u_`[^_]ÉM` $蚀MB΍ EfMUEFƋE$u4UWVS(ÀQE8@E苳` }teUE<$oML$ML$D$ |$UT$4$Pt,E$DE@ ([^_]Í뙋MUE{ƋE$t([^_]Í` $ut ` DUWVSxugx ua@@ HtHӋ}‰t"ƃ))u)9|[^_]UWVS\jPEuE 1NjE1Pt/1Dž9E3wG D$.$&8tGt3W\_u<.uuy.u}fD$:$肮'tOfu:t .\uـx.H}OAuVGq ExA9t$D$$!q@0@Ɖ $@)9P‰ȉ@ M:E<$t$D$|$D$)D$ D$LD$$jU+,\[^_]Dž9E1D$ D$D$$6/sfcui=x.Af~D$:$LZ1flUWVS\+K׉E UEE1E1} t>M1U+ \[^_]2$(( 9ƉyfQffQ 9>f4ED$D$ T$t$ $;@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$:Dž@ u4$Ѕ{8L8 9v<$9=fG$!=Nj$=Ћ9f}}$} - t$$}D$t$ L$D$$u9Džz@  99uQd 04$Z=$ CGvT'tO<$ONjE$N$+P|$t$D$ D$1D$$%1t9s;)d}dDž1 019tl!9hu狍Ƌf4JutJ9}A9p@ &‰))9V׋{z$<))9zrtft1iX@t$$9P Y}u,04$tx9_9v8Љ΃tft4$=Љ>9}űD$|$ L$D$$n4…s@ 89F9EP04$7=+Ɖ<$P)9| Yt$ D$LD$$%,4$p)9g[T$T$<$A8f~<$Ѕ)"Dž${1΋_9S GƋȉfpfJ2r 9t H0f9ًF9랉t$ FD$|$ L$D$$1…@ 9<$P9_SD$|$4$M1@ yyy G7)ʉ (D$ $‰pX<$2\D$|$4$.0111fR9s<0t4$`01*s)׃ (D$$<ljUWVS$ :=}EM@Bt $[^_]øEB $E-ƅD$ED$ED$ D$ED$4$!…xkG D$GD$GD$ D$t$E$ME2EE$4$Et;$[^_]øE9E$]4$G tE$#G UWVS@= ;}E 1֋UHJ @BPƋP}ۉ\$D$ D$)D$4$W~HƋ9sED$ ED$ED$E $Elj4$[^_]ËED$ ED$ED$E $EDžt뼋E1UWVS:6t@ËED$ ED$ED$E$ًU E|Ɖ$)[^_]ËE1[^_]UVS0d6Eu t"/10[^]Ã} u{MMUUUUuD$E D$ED$D$`D$ D$ D$E$SuE0[^]Ã} t`M9tPMZQOQt, t4#ffffUWVS q.ƉU&8DGtrUU]]܉U؀0tr\G0 1 4H\Gu2.utE]9tEprBDGu1 [^_]Ã0 vNȃ)ЋU9t|~&učDUM؉E 9uuM؋EEAEAEA EM.u&UȍrUU9rM؋UMn1et$| $M衊tM:fuM܅tRM؀9t‹uȍFU9rUffMEEEx:uPU؃:IUąmE؉EEȉEuȍEE_E91ffUWVS8&*։MǠ1M1HL$HL$HL$D$ nD$D$M $MU9ЋMs!T$L$4$趯U+u8[^_]|16_UWVS)Eu uu|}}Ơ1uU1҃t+tO/1uU+Č[^_]Ë}E+M|EČ[^_]M11rEEM Tu11MUut&tt}t~U9wuڋUuu}t 9|uU}E1E‰xEEB:u}tA}u}XǾL9}}t}u>Pu9:x)‹u9$t$D$|<$o-"uE1E‰xEEE)ЉNjMD$ ,D$|$$Ua9UЃ7}Mt9 U9}P}9sm:u}yEttq}b}UM)ыE UOtU$蠹UPu9r81u:}뚉}f[UWVSi&c1qD$E$KE@(t}}tlpdh9Ɖ|X1lp9cE@Lؙdh!l!D$ L$t$E@$t!Ѓ\E@@}G0tO@9t$E@0Ef` ߋdl)‰lt1E$E@l9})ЉGD$E$|1TE$yE@ 6D$ D$D$E@$tЉlp!ЃE@ E@)lplpE@0tE@<)׉lplpE UucEEPd$͋dE@fu`xT$$LE UEUԉdh`}wPTlp6E)}+GlpE@0LP}OtșX\GM8E8y}u]9s@zM 9hPEM8HuUЋM؅tJEԉ9rAE9EEt(9%BEԉE:BEuEЉUԉ9sM)M6uD$E$\EE}D$<$\|uu܋}}ԉu}U؋M܉A8uMFEM8M88MuEuuȉMBEBE؉M܋uEB]ωE$EE E ]E4[^_]ËM؅t$E9r9M1EUE<}܍DUԉD$E$(UVMUωuszEudEuH}8}EEE)9EM7E#E\E\Zuऋ}8}ErufuEtfUыuuZE8EtS8MuTu8MCE9EM܃9uu8ME}}ǃs)EtfEtEUuuauGM뽋MufumuumfmmffffffUVSGuF0t$ UT$T$$*tM F0[^]ËE F @u1ķ8Tu躷1fffffffU EE D$E$U]øU Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]U Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]UUM ttt1]ø]ËBM U]BM U@]UUM ttt1]ø]ËBM U]BM U@]U Ut)t?t1E EBML$$P]ËBML$$t͋EM ]U Ut*t@t1E EBML$$P]ËBML$$t̋EM ]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1U Ut2tOt1]ËE 1EBML$$P]ËBML$$t1UM ]U Ut-tCt1t&E EBML$$P]ËBML$$tɋEM ]UWVS d]M Eƃt )֋t4utSD$L$$R totNCuU ]@ .SD$L$$Rt?tCud U ]@ [^_] [^_]1 [^_]1 [^_]UWVSÖuE 8t8tZt 1[^_]ËEEFUT$4$PtڋMFUT$4$tUE9Us!ut<$KE 됃tQtڅuET$|$4$o>bZ}N<$E 8tuT$U$hNjE 8Ut E덍D$$UE D$ D$D$E$]UWVSu} EE]EE|$4$ot2Cu Ct9 uUU u[^_]Eu1[^_]UWVSþuEE 8t uto<$辣EED$4$BtU9UrtOt,t1ET$|$4$>t>[^_]É<$iE [^_]ÉЃtt,E뭅u}u<$)E 1룉UD$$NjE 8Ut E뱍D$$1ZU D$(#E D$E$]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]G=UVSV uED$t$ ED$E D$E$~>.t[^][^]USè ED$ED$ ED$E D$E$[]UVSh uE D$E$tE)[^]UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]USÐ E D$E$[]USf E D$E$[]US; E$r[]USs E$@[]S `1UB E M91]UEf]UE]UEfU f]UEȋU ]fffUWVS(v u}E EEGE؋U uу"E E1ɍEM[<U|$M $eUt~UM)ȍ<FD$ $eUUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$dUEE})C~x9F&}ȋ?DG~ruE9E9EEEE1ȉU}f]tEEwUD$ED$ED$ ED$E D$E$]UWVS46 E܋EEpu؋EkE@u8uEU1Ã}@9؍sL^uʋE EEEEȋ} EEEċEOuE;EU}ԋ M]È}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuẼ;E]U}ԈU]7UEFFEE]k+E fEp}1EpBfUWVS$r Eà1E1D$D$|$ ED$E D$E$t>ED$D$<$tE+uЁ$[^_]ú.UWVS$Z E MUà1E1D$ D$|$E$t-T$L$ ED$D$<$U+u $[^_]Éb-US]E M9r 9s9su[][]UWVS~ EU} E9slUP0ك@t$tNt<]([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVSǴ uE t*X?w#9r6 )ЍXt9Aхu)[^_]ÉK[^_]É4()[^_]UWVS8 EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]HuU270:ۅt9u1[^_]Ë]j[^_]Ë]O(1[^_]UWVS M u}E9E |2&6D$D$$HumtF;Gt1 [^_]ø [^_]UWVSE U2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]ÉG(뗉3$?UWVS4 EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]Éɒ[^_]É貒(F[^_]øUS ò E D$E$c[]UVSÇ uD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS$X uE܉U؅t A"}܉MGEML$$]uu]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0$[^_]ErEJ0AL$ D$D$${oGEME썃ɷE荃;Dž|Em2mDž|EnnlwVwgED$ ED$t$$ڋp4Dp4D_4D4Dl)Љ$I)ЃJEED$ ED$t$$1ɉڋpD$ELD$ ED$D$ Uډ$UTE]9M 9Pu1D$E$Dfe\$ED$ ED$D$ Eډ$ T-UWVSDž Uh0E] ]ED$ ED$\$E $MUEy9tEh0E+E [^_]Ég"1[^_]UW &D$ED$ED$ ED$E D$E$7]UWVSø &<$d D&D$ED$ED$ E D$ED$1$Ɖ<$ [^_]UWVS袕G &<$ DED$ED$ED$ E D$ED$1$hƉ<$ [^_]fUWVS= uU΋}JЀ wK1ZЀ w( 0ҍ J9~]mfT1[^_]9| u[^_]Ë]DfUWVS-tX+tL1u$1ɉN…M)::t#tЃ[^_]Ã1믃륍B$;1ɉ…t4M)::uB$<1ɉ…tE1҉Ѓ[^_]USJMt50 wsS$m1ttX8/t}C []S $ At%8.u S$!t8.t:1[]S$mzS[]cS$1QUWVSƛ uÉ։M uXi)\P=(\_NQDDD);QEN My *)R)ǃQ))|gfff)DQ)))Љ$I)))GF)4V}Ou} }싌)Ӎ\9K@9|)}] [U썒Ӎ | )Ѓ9uF}[^_]øQ))ƒt1EUV)F}[^_]ËFPLLD)F}[^_]ÃF)XENYDDD)sB9At DËA+BuA +B uA+Bu A+Bu+UWVS֏s |$@ƉD$T$`L$D} L$t@^~ VT$8VT$(V T$$v$t$$D$XD$\}t34 )Ɖt$XT$\))L$t\$0\$4L$X\$\ ʁыT$\))șL$ T$$L$X\$\)iiƸD$P%D$TD$PT$TyD$PT$Td$PD$ yމ\$0t$4\$Xt$\y<\$Xt$\D$x|$P|$TL$X\$\ʁ??ыT$\)уș׉L$0T$4D$XT$\)iʫiЪD$XӋD$XÉȃD$H%D$LD$HT$LyD$HT$Lt$H|$LD$XD$0yt$P|$T߅y D$|L$(*D$8D$8)‰T$XЙӋT$XRT$8)‰ЉT$0y D$0T$0$19>kL$X\$\1ҹ1)ӉL$H\$LD$@D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$KS\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$81ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$QT\$P\$UWVS b }썙]| uu [^_]Ë}|:dNu쉼0uMTډ ?-00tċu! [^_]UWVSt~| \$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$X}D$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$XD$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$XD$(iT$h)\iD$d(\ )\d$dQ\D$dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉0E܋؉ }<$11ƅE؍HF(EỦ9sUWVSPso \$|ljD$xT$pL$P1D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|;D$xD$P{D$D$x$\$|L-[\$|;8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|N(ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|Xf1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVSaå \$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$dJ$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$dD$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$dZtlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$dD$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$d$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVSUN }ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$]=v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjE,59tUD$4$]Uu_ɉ1DžuUWVSfT Nj U$=EU~|$ $ 5}# L40dž _y>u E [^_]ÅxE P$RAÉ 2H40dž 1뒋WZytىugb1ɍ @dN}D$|$ $LUVSR. 4$ uƃ 4$[^]UWVSDR EuM V~6hFhF1P9u dN9ut [^_]Ë]w#1[^_]UWVSQ} UM Z~/dFdFP9u09ut[^_]É#[^_]UVSpQ 4$$o4$[^]UVS-Q҃ 4$~14$o[^]USPÜ $[]qUWVSPp $R?t6ÉǹUu [^_]ÉE$aG"U1USmP E$6G[]UED$ D$E D$E$1]UWVSP‚ <$n$ D$ D$ED$ $Ɖ<$*[^_]UWVSOR <$ u$E D$ D$ED$ $ZƉ<$[^_]US8O݁ E $11ҋE3t HP([]USNá [ $11ҋEt HP([]UVSNa u  $1ɉEt tLP([^]ÍHUVSxN ] E$1ɉڋEdt tLP([^]ÍHUWVSNÀ D$$k$ t1$]ZEgƉ׋D$$)[^_]$1ɍZE/ƉUSM/ ME tE]Z[]$E1ɍZ$[]US3M ME t@ tE]Z[]$cE1ɍZ$[]pUEt@ E]UWVSL] ]} tC }1ɍZ[^_]UVS0L ]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍZL$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS ZK} u} D$$衿 t[ t$RXPL$ ;p H}yD$$] [^_]ËL$RlP)Ӎ$\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVSI{ D$ $i t< tOUM T$L$$Ɖ׋D$ $/[^_]Í$C uu} UWVSH3{ UE &9t%\_ptwf9t)[^_]1[^_]US9Hz  u#$ tЋE$UWVSG×z e=t:F$V FtD$$%4$>uƃ[^_]UWVSG0z }ƃ $5tCƉxtD$<$l%E FEF e1[^_]ÃUWVS]t1U׋u ։t$E$Ut!~uu u1[^_]É뻉[^_]UWVS F]y EU΍, <$1t?$4tYMHMHp L L <$1 [^_]Íl 1 #txu8u막<$輸UMU E]HUWVS Fƥx }, E$yH L 1ɍl E0EMt"L Ct\9S t~ߋuMMH E$H uMtω?$8Üq ED$E D$E$i []US>kq ED$ ED$E D$E$i[]UWVS>1q ED$E $%ƅD$ED$E$r=ifFf~ vkF$}kF,)lF(lF Eu [^_]D$ D$D$4$[^_]É$Ҫ>fF 1[^_]UWVS=;p }D$<$w fD$<$[^_]ffffUWVSA=o u 4$9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfϤUS <5o E9ErD$E D$E$ͪ []蔤f!̀rS[n [UWVS1<n u F0u ǀFFF tBNt;})9F~JnJM 9FtHF t t=[^_]É4$u:N})9F4$bu뤉4$Mt  UWVSm;n Ӊʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVS :íl UM9 ?p9s΃ttUU^ ED$t$E$_M: U)UD$D$$E}E01 [^_]ÉUE ED$t$E$M uUEU JHJHJ H JHJHJHRPVU{ 0U$/i 0`UWVSL8ok ljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw0l1ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%0L$1L$ 9<΃t$  9D$uʋt$L$9t4$R.1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$$L$L$'~D$|$UUU>D$;D$(` D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(\D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUL D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUU D$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*C PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$cD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUUs D$;D$(D$9D$D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(FD$9D$QD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$f|$UUU D$;D$(L$(T$$D$@D$L|$UUUDD$;D$(hD$9D$sD$D$$L$ D$ AD$oD$D$c|$UUUJ D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU D$;D$(`D$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$L$|$UUU D$;D$(rL$(T$$D$wD$9D$sD$D$$L$D$ AD$rL$@D$D$D$D$3D$OL$(T$$D$L$(T$$D$rL$(T$$D$SL$(T$$D$4fL$(T$$D$.sL$(T$$D$TL$(T$$D$5UUU< ;|$(rL$(T$$ 9|$s|$D$$D$ t$4D$|$UUU D$;D$(rL$(T$$D$@D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$GD$ |$UUUD$;D$(CD$9D$sD$D$$L$D$ AD$D$ |$UUUvD$;D$(RL$(T$$D$!8L$(T$$D$`L$(T$$D$A994$"+L$(T$$D$ L$(T$$D$~D$ v|$UUUD$;D$(rL$(T$$D$JD$9D$sD$D$$L$ D$ AD$D$_|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$QD$|$UUUD$;D$(lD$9D$sD$D$$L$D$ AD$D$Y|$UUU!D$;D$(rL$(T$$D$/u<$vt$1UL$(T$$D$X_|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$>|$UUUSD$;D$(L$(T$$D$zD$|$UUUD$;D$(rL$(T$$D$8D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$0L$D$$9 $L$D$$9$L$D$$9$bL$D$$9$ED$@tb|$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$~D$ |$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$fL$D$$9$0L$D$$9$L$D$$9z$mL$D$$9]$PVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$5L$(T$$D$ztL$(T$$D$UL$(T$$D$6L$D$$9&$L$D$$9 $L$D$$9$hL$D$$9$KL$D$$9$.UUUwF;t$(rL$(T$$9t$st$D$$D$ t$L$D$$9G$:$f|$1늋L$D$$9$ L$D$$9$vL$D$$9$YL$D$$9$<L$D$$9$4$L$D$$9y$lL$D$$9\$OL$D$$9?$2L$D$$9"$L$D$$9$L$D$$9$dL$D$$9$GL$D$$9$*L$D$$9$ L$D$$9t$gL$D$$9W$J|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$XL$D$$9$;L$D$$9$L$D$$9$xL$D$$9h$[L$D$$9K$>L$D$$9.$!UWVSX!\T $]$U T$D}|$4UT$L1D$0Nj$TC0u ǀƄ$D$D$$yD$,$C Sf DŽ$D$LD$$$$$DŽ$DŽ$\$4$D$PDŽ$$D$HD$(D$tDŽ$$D$@$D$<$8e$%$)tc$1$$ C$$$${$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZwF$@1ۍFЍPwFЃ v$ H$FZv$J$Ƅ$$$DŽ$1$$D$xDŽ$D$pD$XD$\D$c$t$$$9}ڋ$T$TI0$$L$du$$)tE$$A$$$9$$tJƄ$0$D$<B$$$ $|$dK$D$x)Dž^$$$T$xPӉ$$$$$t$$)ƅD$T$DŽ$$$$8$b:t$PtD$P$$$$@ @ft DŽ$t$09t$$n\$0$T+G$e[^_]Ë$<$$]DEG f /$fx$$DŽ$DŽ$ D$$$$JD$$8$$ǁPǁTǁXy 1AAtft$A f$f$Af$A$A,$AD$$T$$DŽ$DŽ$DŽ$D$LD$ D$4D$D$DD$$$ $P:$@%$fH @>;$)@uDŽ$$$m$$D$$$$ZDŽ$DŽ$$t"$D$c$2.D$d$$Z$$/R,ۼ$D$c$T$$T$$T$ \$d\$D$$$$KDž=$)D$HD$Pt$$<$$D$P=<$"~$$$tƄ$-$D$\=$$߃G|$c-$\$\\$xD$xt$d Ɖ$$L$t)T$\}.|$x$)\$P$DŽ$D$pD$XD$c<$8$FD$c$D$d$al0X$,D$cP$$=$$$y$$)u9 I,ۼ$$D$$D$$D$$D$T$ <$$FDžx;$)D$H$yD$HD$d$uƄ$D$Pt$$ <$$D$P3;<$${$$$D$c$,D$d$$$N$ '7v4\$$ $$$$$1۹ $ $$G.$t _5$DŽ$$X$D$xDŽ$D$pD$XD$\D$cDŽ$&$@.'ʃ⿀ $y$f$S$) $.$$$$$Q$$T$ 3$ [L$DL$ T$D$$4$$ o=D$x$y DŽ$$$Ƅ$1$$$$$K$ `'4[R$$$ Ƅ$1ۋ$DŽ$$$}$ $DŽ$DŽ$$$$y$$`32$[$$$$$DŽ$D$x${$$$$$$D$xD$Pt$$- $0$@$$!$J4$p.$$$$3‰D$Pw4$$$T L$DL$$TD$ $D$$D$$ 9L$PD$x$$i$$$Ƅ$ y$it$D4$$8@$4$#@D$t$8$Ѓ01 4 4Jу0 vꋔ$$$)$K0[$$$ۉ$$Ƅ$+mW7*A9FЉ1҃  4PwFЃ v뉔$3$$ $$$$K$ 5"0[R$$$$$$$S$ "0 [$8x$i$$$O-1҉$$$ƁƄ$x% À߉$$<DŽ$Ƅ$$g $$$$XT$tT$$T$ $T$\$$${$$)lj|$xd$$$9}$$$D$pD$XD$\D$cT$ $$$$D$x$-$+$@$D$x$$$$s$ |$D$$4$$ $)$9~$Ƅ$$D$x1$$,$$$$ʃT$x 4ʍRR$$$$$ DŽ$$w$$$$$$<T$LBJ$$$҉D$LaDŽ$$D$x$Ƅ$D$tu|$c$ D$PL$HȉD$xƋ$)ƋD$\9~ƅ~@$$q$$$$y1t$\)ƅ6L$\$$D$t$ $D$,$$$0@$$$$t$x$)Ƌ$9~ƅ~@$$q$$$$y1$)ƅ*$/$8$$$$Jƒ~I$G$B$vDž11ۋ$$$$8p$$w$XDŽ$$b$$$'$$)ƅ$@,$8$$|$d$Jƒ~E$G$B$vDžuZ11ۋ$$$$p$$t$D$dD$$$$虛DŽ$DŽ$jd$ $8$$$$Jƒ~E$F$B$vDžuZ11ۋ$$$$x$$$$D$$$$胚DŽ$DŽ$gN$D$$$$?DŽ$DŽ$ yDŽ$1ۋ$$DŽ$1ۋ$$$$$8p$$:t?$D$$$$tDŽ$DŽ$DD$T$$y$P$$p$$D$,$$$0@C$$$F|$HGF D$$ 11$$\$H)ޅ1$ \$(ZÉ$$gB$$D$$$$DŽ$DŽ$$|%$H$D$8$$Jƒ~E$G$B$vDžub11ۋ$$$$8p$$$$D$8D$$$$DŽ$DŽ$b$D$$$$贖DŽ$DŽ$$$$H$$$$Jƒv$G$B$vÅu11ۋ$뵋$D$$$$DŽ$DŽ$t?DŽ$1ۋ$$$D$$$$zDŽ$DŽ$SE$D$$$$6DŽ$DŽ$7$$1۹ $ $$‰%D$p$DŽ$DŽ$$XD$tD$T$ D$pD$\$$$$$$$$X$8$$B$$$u$$ $tB$D$,B$$$$$$D$PL$HȉD$xi$Y$$0@C$$~ yt?$D$$$$DŽ$DŽ$$$D$H$$yPm$ݔ$D$c$T$$T$$T$T$dT$ D$$$k1ǁ$'DŽ$$|$\ t$d9})t$d|$xD$xD$d|$x\8\$x$D$$D$c$ǁ|$p$$! j$X^$3$$$$ $u$$$3D$P8N$`R$Ș$$$|$d$DŽ$D$xDŽ$D$pD$XD$\b< DŽ$$$$$D$$$$[DŽ$DŽ$&$"$8$$$$ك~D:B$Y$uDžuUDŽ$11$$$r$$$D$$$$XDŽ$DŽ$l#$$$0 u䉴$$$t&0t!F0$$C$$$c$R$$$Ƅ$$11DŽ$DŽ$ @  !$[$$$ q$ $$y$Ƅ$-$$$$$1۹ $ $@$ h  $R$$g $DŽ$DŽ$$t$X|$p{l$pL$@@$$$L$t |$x)9~υ~2x$$$L$t y1)@ʋt$XVL$pV$$D$x9$x$$$8$$$$$у~D8@$Q$vDžu[DŽ$11ۋ$$8p$$$SL$t $D$$$$ DŽ$DŽ$fu;DŽ$1ۋ$.u{DŽ$D$t$U$$D$$$$聊DŽ$DŽ$$tIl$tl$X{$$D$$$$$DŽ$DŽ$D$t1ۋ$$DŽ$$L$t ~$$$Z$$$Ƅ$-$=$D$c$%D$p$$F$$$$$$ DŽ$$X$D$tD$d|$\'L$x\$|$$ $$$ʁы$)уș׉L$xT$|$$)ii̍$ȿƉ׋$ljD$h%D$lD$hT$lyD$hT$lT$hD$x1L$x\$|$W0G$$D$pD$d<9 $$9r$PD$cCD$dxtD$d\$xt$|$$DŽ$G$|$\$$$$$蒸$1it?$D$$$$詆DŽ$DŽ$y$$D$(É$$DŽ$$DŽ$1ۋ$$ADŽ$1ۋ$$>$$D$$$$څDŽ$DŽ$1ۋ$L$t $ZDŽ$1ۋ$$m$$8$$$$JƒE$G$B$vÅu11ۋ$뵋$D$$$$DŽDŽ$DŽ$tD$x$$m$t$D$$$$cDŽ$DŽ$.|$ct&RD$c$D$\)-ODŽ$1ۋ$$#$R$$DŽ$DŽ$"$[$$$ $D$$$$EDŽ$DŽ$$1ۋ$$vDŽ$1ۋ$$.$$$8p$$$L$x$DŽ$ DŽ$[$| O$$$$@R$$$R$$$?$ ݔ$$D$$D$$D$$D$ T$$$$[1҉$$$$Z$$2+$ $$3$@3$ +$[$$[1҉$$$$ @* .$[$$$$$D$dD$c$+L$\$ /$Z$4)0ȉуcڋ$C0O$9$\)ډщ$$Nj$$X)Ћ$8D$(t$dD$( L$x$ D$xL$x$y DŽ$\$P$L$d$DŽ$D$pD$XD$\7_DŽ$$$7D$LD$L$`se$Ƅ$1D$L( D$L,\$t,11L$\ 9 )Su߃݋$i$D$d$؃$$$1۹ ($D$$$$R}DŽ$DŽ$$D$$$$}DŽ$DŽ$$D$$$$|DŽ$DŽ$!D$HD$d|$c%D$HD$dD$cދ$$|$x$Jƒ^$G$B$vÅ11ۋ$뱍J$8$p$D$$$$.zDŽ$DŽ$^ $$$$aG $[ $$$$ . $[$ $ In $$$$ 3 $R1҉$$$]$u $vnWE $[ $$$$ $R$$$$$$$1۹ 5$D$$$$wDŽ$DŽ$1ۋ$$q$$T$ 󥋌$1$$9$rC$ǍA$D$DD$ $D$D$4$$Pv$L$Ht$\)L$dAD$d4f$D$$$$vDŽ$DŽ$$D$$$$vxƄ$0$! 9D$c$D$HD$d,$0$$T$$D$4,Q$D$L8$D$LJ$$8p$$E$$ D$xD$$$$uDŽ$DŽ$^D$L$D$LD$L$D$LD$L1$$D$LQL$Ly|$Lp\$L\$L$t$\$y DŽ$L$P$DŽ$D$pD$XL$d$O$$-{DŽ$$t$p$$Q$$$8L$\\$tt$X|$p7T$x\$x$y DŽ$L$P$DŽ$D$cL$\\$tt$X|$pT$x묋$$t$L$t$L$$$D$LX$$D$L$$}D$L0X$$D$LD$L8$D$L$$vD$LX$$D$L$$ T$LB$$҉D$LvD$L8$D$L$$ J$HL$LL$LD$LD$L{D$L( D$L\$L$st$LAJ$H*$$$T$ D$DD$$TD$ D$$D$$$b$$fH @DŽ$$4\$$;$[RW$$[R |$L$_\$L$$ $X$DŽ$$$$$[RJ$8$(1fDŽ$9ƃ$$$ 1D$c‹$$# DŽ$陾$ DŽ$钾D$L1ۉ$$D$L$$ \$L${|$L~D$L1ۉ$$D$L$$H|$L$$GD$LT$LB1*T$LB$$҉D$LD$L8t$Lt$LD$L8$D$$$$ZnDŽ$DŽ$*$1ۋ$${fg P$8$I$|$LOL$LJ$8$D$(J$8$D$L8hT$L$rt$LT$L $$BD$L$$jt$L$$t$LFD$L$@6$ $f$*\$LKL$LT$LB$$҉D$LpD$L8T$L $$BD$L$$ D$LP$$$$$$T$Lw$$D$P$$$WD$pD$X$ (1k$ $$֋$UB$鏷$D$L+Sf$$ލQ$膨 DŽ$ZL$LL$L_$fH @ٹOȃ0 [14ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSX }ED$E D$EE$uLE܋\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$މD$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$}$5Ɖe[^_]ËED$E D$t$5Ɖe[^_]ËED$E D$$5Ɖe[^_]úT$U~ t^E|tEXrUWVS,. }m|$D$%U <$U:ue[^_]ø랸뗸1ffffffUWVSxs t&j=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$D$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أ܋܃$݃,T$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h< "\$X,D$(D$4D$hljD$@D$,} <$@/D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$uD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$vD$8"T$DT$$AuD$XT$D$drD$XD$D$tD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$}$-D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$,D$`O}F|$T;|$PwHL$t |$@ "D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋`Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$oD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$sD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$$ *D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $nD$XD$ $L$h)*0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$gsD$D|$X|$$ptL$T6|$`94 vP9t|$8L$8=D$`0D$E D$t$(D$`|$PwuD$t(.D$0L$@ "ȃƉDD$XD$t" "T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$q&D$,0L$hT$8T$4$qD$P|$D$X$Bq…@ fT$T$04$pD$DT$0$4iD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$oD$D1t$Xt$$pT$hV9zT$,1t$4FD$hD$X$VhD$h L$8tt$89tD$h4$.hD$hƉ|$8D$8$hF(MZD$PD$D$D$X$hD$XD$D$D$WoD$`p1D$@D$X$gD$8lD$hD$D$X$kD$X86+D$p[T$XBD$i¸ )6D$XD$D$D$nnl$@D$D$ D$D$ hD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hك0ڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8 "D$Xr D$D$D$8$lD$81fu T$hvx0t|$8L$8 t$8F$Jd…Fz tftD$$kDžYD$PD$4HL$PD$h9L$("D$D$ 4$eƅ`D$8D$D$ 9D$8$eD$8,D$D$ <$eDž D$PD$4D$8L$؃\$HD$HT$LD$-@D$D$8أD$|؋t$`D$XD$8EЉD$@A$cD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@ "ƒD$X T$T$L$T$HL$L? "\$81tD$8 \$8uT$D$8T$0t}D$`D$D$D$t$OD$tD$D$h$V|D$lP1D$DD$d T$`D$t$BND$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$@RD$t}t$tFD$OƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$PD$H#L$hL$$OD$tL$h $3LD$tD$h)t$4t$D$H$zRD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$rJKWx q tftD$$QD$d~D$<؋t$lL$dD$D$h$vQD$hL$tL$$RuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃\$TD$TT$XD$$-@D$(D$<أD$$wi؋D$8XVH؄tJuU tu ؃[^_]11USÍ EHP$/C[]UWVSD譚V Eċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tFE4$J7E$&6ƅ@1랹fUWVS袎G $}<$辅04$QTD$tDŽ$ݜ$DŽ$E$E$}$-wӋ$ L$|$}D$p0D$dE@D$DӉыD$|DŽ$/1t$x1 tQЃ$ˉʃ/~J9E~փ؋$LQЉ$} tE }8e[^_]Ãt$Xt$x8|$xD$hD$TD$`eED$HD$xDŽ$D$Ht$T)D$`E@ D$h]cD$Lu|$xD$xƃ~D$XD$hD$ll$hݔ$|$x '؃$5XD$` x|$`7%T$x)ЋL$`95)4$$-\$x$E$EP+ -D$PE$EPZЃ Q$0u&Hȉ$I0tJσ|ZЍH$P΃/ \$HN eFE=D$`D$d D$hD$`uFi GI Nu($߹D$$4$M/ DŽ$E$$M t $} D$pt$t0T$$D$E$$%/$$2$e[^_]ËL$|A$ƒߍAX2‰$@X0tT$|t|D$d0D$PED$TD$`D$d D$h D$xD$Pn@$$@["$^^T$xA8tT$x,E$D$HK$ "LDŽ$߬$ݜ$$5 |$xT$`$$D$x)4t$ "݄$ ݜ$ m$ "@ 1ۋ$ % ?$݄$ݜ$؉$?$G ݄$$ "1ɨt uݔ$؍$D$ $D$$$K;$ $$$֋$)ޅ~1t$ $$p-$$$$ ΋$)Ήt$(MI$9MIL$P9w)΅xt:։$$DŽ$BBt$P$D$DtD$(9D$PD$(D$hD$tD$D$XD$ D$xD$|$D$|$$)D$@|$`D$Tt$H)!ЉD$d|$HyD$HDŽ$D$@ D$,t$@F$$u-D$t P F׋t$,) tft$@$$)-D$x $H Bύr  tft$$)D$X$։T$T$$q0D$|4 T$T2 D$dƋD$HD$T$CL$X))ߋT$P9~)|$Tlj9~9~~)))ƋD$dDЋ$)ȅ[ D$` ~#t$D$|$$3D$|yD$tD$D$x$$4DžTx p w $G D$|D$<$$A4L$Lw D$|D$<$$'كB؋$ T$XD$8\$0D$$ DŽ$D$T$$Ɖt$<\$hu 9$ $D$ $D$D$X$$6…E$2 N $L$TT$ FD$$-T$ T$$$X3$^T$hҋT$ u*K9H L$P9L$($D$TD$h$$(+4$ +$Z $$t$<9؋D$hD$x$$*D$t$*D$|$*<$* $|$xD$hD$TJЃ w.D$hL$`$C$SJЃ vD$`\ZЃ$V/~΃9~).D$HNL$P\$Hy0j˃$0t)ÍCD$hBσ$BЉD$`D$hD$T\$|D$xD$Xt$`FD$XD$h$}D$pP$XoT$|$}D$p͍$$T$ T$LT$D$U$MUZ$$1t$ɘD$$4$$g$$D$4$$u$DŽ$E@}$1DŽ$E@$}$8(|E@$$D$h$$ӍrD ~N9r1BBDŽ$$t$PD0$DŽ$!$$)Ɖt$h $D$hD$$$-$$t$h)$D$huD$x$$ 'D$t$'D$|$&D$@$&<$&E$9x@ $n$$$&DŽ$DŽ$E@}EPu9us#T$D$E$$ 5Et )n$|$hЋt$Dt0@DŽ$P$O"$1Z$ ȃ0y$jT$T$T4$$$HY9^T$T L$h$$$9D$huT$TD$D$|$$c)D$|tfT$xT$$'D$Gz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVSE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]c4"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]o3"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0a\ }u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSX[ EM]E TsCD9sϥ9r)؃L9s&)D$D$ $]G[^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVSZ7 >0)ˉލ u썊a)ˉލ u썊}A)ˉލ u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rEu)} ȋ})B9>[^_]ÉB$MUVSYæ UBJT19r & 9st9sEE$Ɖ[^]ffffUWVS XF 91} w+ M4tetB`&$2E$FƋEFEFuFF [^_]úMU`E )ȉE w`|`&$G"t`&$0|UWVSW- ut"F w"91u& 4[^_]É4$#N[^_]`&$UN? 4tU$[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVSM CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSYK} }tD$E $ƅD$D$E$轷Džtt ʃ9t-xD$E$t|E%=t`fp ttu ffp MfH@kP$}kP,)lP(ŸlP Č[^_]1Č[^_]1O1USJ÷| E UD$T$ D$E$[]UWVSI|| uD$4$nx$P8D$4$[^_]É4$mUS|I!| UjxH []É$6[]UVSEI{ UF0$>F0ǀǀD$4$FFF [^_]ÿF tF$L>p4$D ffffff̀rS[y [UVSG÷y uF0u ǀ4$cunP[^]øfffffUSFXy MQ 1f t[]É $[]UWVS yFy uc1FF uafF FF uwFVT$D$F$V$FV fV 1 [^_]ËF0tN@9t $ωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$se=<1ɋ8tBD$D$ N|$\$4$薽 y8t6D$D$ ~D$L$4$LW8t6D$D$ VL$\$4$W8t6D$D$ V\$D$4$ļ?O8t6D$D$ NT$D$4$耼_8t6D$D$ ^D$L$4$<W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$踻u7O1$[^_]ËpOe8,UVS =lp EU uMtTp4u 1 [^]D$D$4$#+u"udž0UWVSJ=o Ƌ4D$D$4$*EtE$3Gu͋$3tMtf~ 18t$w39⋎t $萩4$Q3uu&E[^_] U9 8} ]EUWVS1<n ]tCƉ$2[^_]þUWVS;În ljUD$@$C.:ƋUu 1[^_]ËOD$M$.…1]~˃Mt|tatOt=t+tt9EGX<tE[^]},[^]^UWVS2ce } D$$%ƅǀM]8bL$ ED$|$]$ mF8FF F FFFF4& ~D1 󫍾󫍕xT$E$Iq]~^ $iF]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$膰BF0F(LN,NV<~$]9~s~G]WEP IT$4$i0}M1Q\$E$oKT$ ML$|$}<$ÉX TUMQ D$t$$@ËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ <$ ;F@7NF(șdž‰<Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$>p$XPlx ͙H 6XPp[^_]ÿO$4$!p81Ë&fLT$ ML$|$}<$ 8녋8"8F8FF F FFFF4ǘ& ~D1 󫍾f1$F~ j%8118ED$4$dž0881UWVS$)ê[ uF(x~(V0!UN9F9MUD$N $&MUF($N 9} TDTDF F,9sF0 F,|$}|$4$_$[^_]ÉUUE${EEtlE܋UT$ML$E$_ME)UЉL$D$$.M $EUVU(_US]ED$U $ #C,9C(}#C0[]fffffffUVS b'Z EpFtD$D$$˸F u  [^]UWVS&ÞY ETPLx PpXxHPTt=kbPKҐ"DHD$$$ƅǀHDǀ$$FljFHt dž wRG GG XG pGqG-GE U%tAtCFt$.t$R4$1 xD$ ED$E D$E$HE EXuEX=DžX T dždž XTLtt!ȍDLX1PfffXL9aTȋX1D$ L$HD$$踰w 3D$D$$Qfxuu fx D$D$$E t @E@t Ey [^_]Á1DžPDžXO'DžLDžT'DžP^O'KVp t$ LT$xT$$1D$$+8D$\T$X$TD$XT$$ѯ…\}@@f@fBB PD$D$T $XD$XL$$D$PT$$xD$$H XADžX2D$`D$H$Œf` =b1`abcddefghhijkllmnoppqrsttuvw `b1uedu\hX=wCu>t_u1 ȉ lpHO 'O'FUWVS$ÎQ EpFtD$D$$RFUED$E D$4$XDžEtwD$D$ED$D$ D$|$4$蹅!@uFЃ$[^_]ÉED$D$$误UЃ$[^_]D$D$$芯Ѓ$[^_]fUWVSEU M wHpPPHHpPPHH p P P H H pPPpPPpPPH t tZ[^_]ftHҍtP1Q‹ˉZˉZBtZ ˉZ Z ˉZ 9uȃ[^_]ftxҍtPu,r utu΋ʉVʉVu9c7W‹ ɉ ZˉZZttr Ήr r ur Ήr ʉPʉPPʉPP ʉP PʉPPʉP[^_]UWVSEU U P׃X ރ HpPPHHpPPHH p P ˉX ffxPpP[^_]fzHҍtP‹ˉZˉZBtZ ˉZ Z ˉZ 1Q9uȋX x)ʉPʉPPʉPP ʉP PʉPPʉP[^_]fxҍLPM2r utu΋ʉVʉV7W9}q‹ ˉZˉZZttr Ήr r ur Ήr UWVS(ùL EpFtD$D$$}FE  D$D$$٨Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$辪$"u 1([^_]UWVSÔK }wFtD$D$$XFD$<$tr$StcFt$ft$Tt$BE4$1<$)E$U[^_]øUS %J E9ErD$E D$E$R [])UEtu]11ɍT9r]1]fffffffUVSZJ UE XT#1rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS4vI }E@Et M 9H 1uEEEEEEU@}WQ  R 2fuft trfu#tPMy MIыURU܃! M0u Uzu@G GGBPWxG8GsBW]O ME9KOft DAfEtD$D$ E܉D$L$4$贒VEE@#E UJU ыU M׃}׃}uYM0ɉMuFBEFEEF0E4[^_]ED$$E6E@ D$$‹EPpt EME A AEuth}OAMOEG8D$ED$D$ E D$T$E$艎E4[^_]Ë}GMOEG8D$ED$D$ E D$T$E$&!E ]M؉EEPD$D$ |$T$E$xE@R$| USEP M TH}[]UWVSPD E}9UNFt%O L$D$$]XF$FA4$]E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$] tUSUE @@ @HKYXBP[]fffffffUWVS öC }ED$E @D$E$}t7ƅt|$$t [^_]A84$}28UWVSD;C uE 1‹E1[t$D$ D$D$<$#=5DžDžDžDžD$D$$ {<$ƃtI<$D$D$4$T|tntD$4$蹲tSD$D$$zE+uqD[^_]ÍvW$^8D$D$$;z4$|8q?-wfUWVStvA ]u EE1EEExGtD$D$$G %}(Et)]uU+t[^_]ËV]ċK9 E.D$D$$]&Gf_ @EQ)‹Eċ@F 9AfMGED$t$<$]vMefLJO fMEG(V]ċK9EM9r\L$MEĉD$<$]xEEEEȉEEċ@EME؉EċF9‹Ms]L$Mt$<$]Qx8EEEEȉEFEMEċ@Eu9‹MG},D$GD$$]cGfEEA!LJD$L$$]qẺD$t$<$]E‰EeEJfMM }.EEFE]C EYf]QfU)Ӄ9f9UsCҋE)҉T$DAD$DQM$]yMAfEAfEFEUfQEf+EfAUfDQȉMMMċQP]XP FD$D$$U]yMċAD$D$UV$xG(Mtu 9Gt1D$L$$]}  1Q$Au9uLJEf  _EED$ L$Mt$<$]M91t$L$$]GYED$ED$ED$EĉD$ t$L$<$]1'vD$L$$]EuFD$D$<$]BAf}LJfLJjӋE9MGED$t$<$]qMO fMt fMfO Mf&Gf;EfGLJt]]pffffUWVS0!: }E@(tEEEtG 7AuQ O)Ήt$D$ЉU$vUfWE\GGMQft3ʍTOU‰EMMf9sf9uEMDHWуf+Uft"ҍ PPf9sf9uOfOE@(u 10[^_]èuE?9xuP9Us݃}fGыu9NV;UF(  }EfEED$D$D$D$ D$ED$E$mPD MD$E$+stۋMfA MD$E$stMA6E EuuKGfGG}EfEEEH(}EfEut$E D$E$nG9E49Eu녉}EfEEE D$D$D$D$ D$ED$E$lE}fEED$E D$E$=nGGV1҉T$D$E$ƅ5EfEED$E D$E$mE@(EMA(1D$t$$EuFEfF7}EfEt$E D$E$hm6EH(D$D$E$&ƅtE@fEED$E D$E$mtD1ɉL$t$E$/EH(81҉T$t$E$E@(EUWVS P5 }u FuIFu 1 [^_]D$D$$NtYVPD$D$$舔D$D$$t!VPD$D$$P|{UWVS,F5 ljU,E싗E9BD$BUD$$蒑ƅUtZBPUTFEDuIFfur>t$<$ut$<$谁g,[^_]ÉU܉M D$<$nMUuD$t$$F뻉ME EF )‰T$ȉL$Mȉ$oMfMfNEDFfENMMAftHЍDVEEufMډUUuf9sfMf9uuMڋUԋEDPEFƒ)ft;MAȉuu}}Hf9sf9uu}VfVD$t$$8E8tRED$<$1t#fFfFF 묋ED$<$ ZD$D$$ȑ1=UWVS0!2 uExGtD$D$$臑G t>tU0[^_]G(tި0[^_]EEEED$E D$<$9ƅEMu@E@  Nf9sit$E D$<$zhu@FD$ ED$E D$<$tD$ED$$}NE@AfFfzfMfUt$E D$<$gJFD$ ED$E D$<$TvFHfu9fFE@4UtEfNpD$GD$$K…<@fGD$ T$UD$<$ƋUBuQD$T$$8fU 10[^_]ÅuD$T$$MUE@fUMD$ED$$譎MUf9D$T$$膎GEԍUUT$D$<$60O9fEW,Uʉ׋9AE؅mD$L$M$E9}Mu25D$L$M$ߍE9}MGD$GD$$M>GNjEA9Etf}ދ98}fxXDy|8f@D$L$$&D$|$$越1mЃ}uf}D$L$$ތD$E؉D$$k\~rD$ED$$蘌D$ED$$z]D$t$$[D$GD$$… v}]D$D$$}t&bD$L$$褋ED$EԉD$4$4'0G,EJ9NMUD$t$$JU싺1M9(/D$T$U<$E9}U8EGD$GD$$肈…sG>ft׉EfMދ?9}fyHUމMDFDED$t$$aD$ED$$ƅ@PMfPMsfUމ1D$t$U$1҉T$ED$U$聇ƅURjщEΉU*;fffff1̀ffff ̀rS[Ô* [USx* D$D$ D$ED$E$t E[]øUWVS~#* EpM dE 1l֋U1҅tUuMxIEGu@p:^)‰ЉhRp9\rD$/$[t)s1lU+Ĭ[^_]Ã#`\%$>O`9;π?Xt։D$ h)ЉD$T$`\$d`p9r9>/u`tD$p$5/|%=@`tOVp:uыp)~"?MMXdD$E  D$p$a8PXh9<Ƌ\#`)@u08p9hD$`$.uFEt)D$p$4JtD$p$4.8m`\ffUWVS4& Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xf[fUVS 7& 4$fD$$D$F $3 [^]UWVS N% }$K$K#1$KD$$D$<$X3t$<$2 [^_]US|% $Xe[]US,V% EEVEEED$D$ED$ ED$D$E$t}u E,[]ø,[]US,$ $d[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C9x@f;ErfGf;EE̋MAEHEUJ}}?]fC]f9]u]fCẼ@[^_]fEEMf9C1뿋M }Of+EfG1fE.&{UWVSl ƉUMED$4$S]ǍED$4$:]ÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVSE }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]JMUBfFF F D$t$$]m1[^_]Ã}Qʋ]C ^)fFfF] H@ L$J UL$ $]IUBeD$B D$$]jtH D$D$$l&KUWVS,( Ɖ׉M܍ED$4$[,UUԉf@UfPWPM؉EH}O M}O }G} f9ED$$ EUE؉EB}GBfBEfBG EB ED$E D$E$M}S‹utftE9UE$E܋u0E]UЃ,[^_]ÉUԋED$$=EUME؉EA}GAfAEfAG EA D$T$$hUPD$D$$ju UuEԉFEf@f]܉3u‰Ѓ,[^_]D$ED$$jj1E$1}kfcUWVS , uE]u BEfAȉE{S ts׋}GEfAfA~V tj׉CfAA A D$L$E$]{i1 [^_]ftC|{M 9uMfftF|~]9u]oUWVSpy" E̋}u]E fEڋE M܃8M\$EډED$EE$U …B)fBMfDJ MQVP]XP AD$D$$Uԋ]1EFD$D$uEF$EuE܉EԋE 8 G,E9EEEEEEEBD$BUD$$]xeEЅUBfEfEڋN C<FE EËUBR)9UЋE:D$ED$E$MUЉrEЉE EF  Q])fQEfTAʉM\$ED$$UЋ]CUЉBE܉EЋMEEEIE 8u4 ML$MЉ $M Su[D$EԉD$$]TfD$t$$>f9UuEЉE'E܉EЋEED$EԉD$$]eD$t$$euEЉED$EԉD$$]eD$t$$eG$p[^_]ËV]XVT$T$$]8B u EAf+EfAUfDQЍ\ UUċPURUЃPUċMD$Eă D$$]AM܉MЋE@MD$@ D$$]HbM|MH D$D$$]wdMEEED$L$$]JduEЉED$EԉD$$]%dD$t$$d1p[^_]ÃB]ڋU܉UfTYʋE@%EԋBAf+EfAfDYVP]f9s/)D$]ЍDSD$DS$]/@]KEfHEF #]ډ]U܉UfDYȉE]CCҍ\S1҉Muu9uMu]EԋCAf+EfA]fDYȉEFFҍ\V1҉M9uM]CFEċB Et{MAurMЋIMu f};]KLً] MUMčQ UML$M $ЉE M9s HˉELEE8E$MЋU c$RUPURPE{]C%D؉E6UB%TEMa u>4$MԋU 1~1E^t$Mԉ $M 1qt&(q.&vqfffffUWVS Ö ƉUMED$T$4$RNjE  EED$T$$`EGfEf}MA U9tD$ML$$_MAD$D$$[]…@UfG|$ED$4$A7U9;GfEf}VE붋Hf9OtWuV1 [^_]ËPUD$D$$_UuV [^_]ËE}?98tD$D$$^Eu0ufp1뒋E}?98t.D$T$$B\tfGID$ED$$r^UWVS0u }EpFtD$D$$6^F w8t<Jut(F(G Zl$Gv՝Ѓ0[^_]F(ǀF,}`H8J@ TPTU䋖:fJD$D$$H]D$ED$$ZuGF,TP\@ P| fBD$D$$\D$|$$RZuME}}8FtM$F FMF(~fNF(D$D$ED$D$ E D$ED$4$1!@EFЃ0[^_]ËE @EEE$U D…ME)tPEEVE$ƒMtEVUfVD$D$$k[D$FD$$Xk V(Nf\VxD$D$$ZtRD$|$$sXHEfM}}D$D$$ZU1뾉ED$ED$$[ZUyV(ENfM}}EfE1ɍ}}V(uNPf9Fǀ<xD$D$$YDD$|$$eW1EfEN,MMOD$D$$zYD$GD$$WzOf9}uD$D$$+Y8:fJTH|D$D$$XD$|$$}VH@ tEfMN,MUOD$D$$XD$GD$$VOPf9ukM9u:fJTH|D$D$$ XD$|$$U1Ʌ 8@ t%UVS? uFt$F FF(U VUfVF([^]UWVS,Ï }G,EԉGED$t$$T…G@fEEfEU܉GfEfft?fE<Ufy ED$E D$ $M.MUt(fuU܉B EftcU܉}B ueE苇20fHEDBtD$T$$UVB E1뭉ȃ,[^_]ËEMȃ,[^_]É  u$f}t3Af9EuAM]EEfG M뛋BtƉMD$D$$ZSEM]@fEED$E D$<$>-EMD$ L$M$YUEUGW E9uԋMu7?D$L$M$UE9uԋMEFD$FD$$RFfEftfm10ufpEpЉ&D$D$$REfEED$E D$<$,EMD$L$M$)TEUGW E9uԋMuUKFƋEA9ECD$L$M$SE9uԋMFD$FD$$5QuэGE  uKBfEeED$$LSMfE7ED$$-S>fE31mЃ}tYDqt0f@D$L$$RD$t$$iP1uD$L$$Rfu10ufp[u‹Uutqt1D$L$$CRD$t$$OJ@fE苇0fPUBuD$L$$Qfff̀rS[ [ÌrS[ô [Ḉ̀rS[Ô [̀rS[t [ḹ̀rS[T [薿? UWVSEU Mwv9tt*<9t!Xr8t)[^_]1[^_]ÐUWSUtmg jBgBrn(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVSU \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PP$}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVS訩M } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSì } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVSO EDžDž<|<s,(z DE5N )=' ==D$D$D$D$ D$t$G$%D$D$D$ 0D$T$4$¡tp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$p3$?o&w̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$q D$D$ 04$T$z1vpDžDžDžD$D$D$ 0D$D$$ϟyPD$D$D$ 0D$T$4$L0[^]ødj낺FsGdD$D$D$D$ D$t$Ÿ$"`&C0D$$0D$$ah ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$$^ /D$D$D$D$ D$t$Ը$ D$D$D$D$ D$t$$D$D$D$D$ D$t$$qBBp DžDž DžD$D$D$ 0D$D$$ t0p ><S,BD$D$D$D$ D$t$$`1D$D$D$D$ D$t$$up3@@fED$D$EЉD$ D$D$)$葕u}u tTE E E Dt DUWVS 賙X <$4 Dt V6u貐k$Et+蚐<t V6u<$ E [^_]p4t V6uD$<${ E [^_]US$ î , t$[]EEED$D$ED$ , D$D$E$'t, $[]UWVS苘0 E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$:F]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $ltljGUL$$KtMVJ}OUWVS袖G uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 1 E}E pE0EEE90EuNEU9sщL$MFD$E$]0D$t$$K&M)Mt2MVD$T$$]#ƅu [^_]1 [^_]ÉUt$E$]Et͋]E0U=UWVS(9 E }}8}xEEE3UHD$D$E$}%U)MMuE؉D$E$ƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$$1([^_]ø([^_]UWVSü }E pD$D$$("tW@ u^JM"D$ED$$!t&M)΋PUD$<$U9ur1[^_]ø[^_]D$D$$$ѐ̀rS[ [̀rS[ [US # EU D$T$D$ED$ED$ ED$E D$E$a []fffffS[n [.&f̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVSå tMƋuA~8t:F4@9s3`V8F4@9r$芇F8[^_]ÉUWVS舐1 E}}u1ENjE1txF8t1ɋ}E+wȁĘ[^_]ËF4E@E$]a~F88]E F4F0E|U1E} OxD$`|D$}|$ F8D$L$$]UF8)UV4V0]< BD$4$)D$ |$t$$Ƅ=D]D$D$$`IƉ׉t]g 8X9;-D$BD$d$ D$D$$  {tD$D$$Ct I\"U+ <[^_]Á}l@ Džh1Dždd <$[xD$`D$D$ t$D$$O~ 9WǸ։< tD$t$ $>9eu d3D$BD$d$5D$D$$@p8/tD$D$$=tVBDž.D$BD$d4$g89:y``9_$o{}d$?J4$0{9U8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$I|tD$DD$$<tT?I‹uB8`9r勅9s$4`9u닅$y'$wHgtStD$D$ $:D$G$`;pNj@8@P1f^$]GFU$=G=D$G,tLtD$D$ $9+_t΋$FUWVS蠀E L<$!E D$ ED$ED$E$MU EƉ<$[^_]US C EU BJ  D$T$$ []UVS Ô utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UwED$\$<$UED$\$E$UpED$|$E$UU؋M܉]ZGu]E؋}7ED$ED$ ED$1uD$E)ȉ$LMED$ED$ ED$E1uD$E$}MƋE]XQu]E)ًU)+U9sʅWE)Ӌ0wPu3U܋>xNuML$\$<$UXML$\$}<$U<5ML$ED$4$U ut$ED$<$UuUT$ML$E$UUT$ED$E$UxIEEYU܉u 0sHuuML$ED$E$UxEEED$|$E$UNu7};Uuu UT$OD$ ED$E D$E$]fffUVS 2uק EU M9Mr/9r 4 9r$9fu49rL$T$$ [^]fffffUWVS$tv lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$BM1 ЋMu`EUD$ T$L$FD$$i;u<tVT$VT$$$Ѐf1$[^_]EUWVSs‹ Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$eÅt@C؃[^_]Éډiu1V룃T UWVSs u xD$4$1E%=D$($IeDžts@@@9uE ED$D$ EЋUԉ$T$UEČ[^_]C1Č[^_]UEU U U$]UVS%rƾ ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D &D$ D$%D$5${U D$E D$E$]UWVS.qӣ E HMxPpt)rP@t3B E$g1[^_]ÃMt P@u͋MAUWVS,p_ }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$1 ЋME܋UD$ T$ED$AMD$$9‹Mt+AMT$D$$&MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i=@1o$@1~BEH M?O1WUE PMt ʈP1]UVS@n ut PtH J H $du4$d1[^]UWVSmǗ uu #[tCtډu[^_]Ë$?[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS mƭ U Et7Mt.ZYutD$D$ $$E [^]UWVS lN } uw vtօu 1 [^_]ËEEUUU܍EEED$E$HED$E$Ku#ED$E$CE܃ [^_]ËE+E1u=TEfH @jUWVS$kw E܋E XE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1$[^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]GnE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]GUq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]k)EE9xsNMʋE9sBȋutftUE}8$]w)}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$][]+SSUSCslj;C ЉϋutftE)P)UKUE$]m1ɋU-Q]؋usStft]E)C=EE\D1.fvBvBAf9vEBf:X9f1vE3f+]]7]J7 UWVS }G tPwtI)7tI1Gu-)t'\$t$G$W,fO @ [^_]ËGDu1 [^_]ËG봋WU [^_]UWVS-eҗ utLD$4$F t$4$ED$4$$[^_]c6 @&4$+g$"Plj4$[^_]ffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVScÖ uc1t\F t4VtCF uuIFF1[^_]FF؉Ft^u$VfF u4$볐1붋V0 t~@9t $6ZV0F FV멸{ffUVScĕ uFft]|T$$+xGE%1= ‹MUtJM VL=u,)l9F(u!Ą[^]ËEE Ą[^]ËE UWVS|ub uǠ1E1F t)fF FCFFE+|[^_]ÍED$ED$4$EF u9vtlEE$MP*1I FEFEu E f F Fft$tߋE f F dFfxD$ gD$D$@U$U`U$EFp$UWVSK` Ɖ׋@0$F0PEB9EED$$F0Pt$T$8$F0PuD$E$]V0UU쉂PF0ǀTu Xt$[^_]ǀX\D$$F0NjF0TXtXU,_Ց M91u]1҉]UWVS_ç u918u [^_]ËF0$hF0PV09t'Pt($6[^_]ÃT1݉UUPV0ǂT1UVS]^ u91u[^]ËF0$F0Tt$[^]ǀP8$F0U] MU 91u]É]sUVS]d u91u[^]ËF0$(F0U t XtTt/$[^]D$\$F0ǀP8$"F0UVS8]ď Ơ1E1EȉD$E$KU+u 8[^])fffffff̀rS[d [US \H E D$D$t,@E$t []UWVS4o\ D$$΋ED$ E D$ED$ED$O׋U6Et F"-D$-ED$ t$|$D$$$mD$(_-8Q-L$EuKD$$9t:D$(T$ 9ЉT$9D$D$8tEVtEWL$ 9L$(L$ET$(9T$L$tD$(4[^_],UOED$$D$(1D$(4[^_]ÍD$0E|$,E"D$ D$(t$D$(4[^_]ÅtD$D$(t$먋E"UWVSZ; EU uM] $\$M] &}}$}M] $\$M] e[^_]UWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]lfffffUWVSYv }D$<$`t(tt$<$#[^_]1[^_]UWVS rY uD$4$tfUtf|$4${t>UT$D$E $;Es1 [^_]*"y*l*UE U9r 9]ø]UU E9r 9]ø]UWVSX5 0 0 u0 1E1ɍt-ωD$4$u t 0 PEu׉MD$D$4$ MtMljMuD$|$E$ 0 8Ftt$E$. 4$NuME8 9t$${Nǃ8 ǃ4 [^_]É4 TD$D$$[^_]UWVSJW u} t%1fD$4$tt=t1[^_]À=t[^_]UWVSVÕ ED$<$tƉD$<$* 4$M[^_]UWVSVJ }G$Dƅtx @D$$[^_]USYV ED$$mtU 9P []1[]UWVS Vú U1E8s7i1}ƉUE D$ED$<$u E <=,EV FfV fuUT$U T$$C[^]ø"8u V F본UVSQþ uFftAȋED$ E UD$T$ $!уN tFPVTfN [^]ù뻀fN [^]USPI E@fu$蕽[]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu#B[^_]ÃHPtJ ȃB[^_]UWVSӉ΋t B SuUtBu{QtBunQu Q9tW[u믉 St2tAu(t@uAt@uSI[^_]ËtBuBB[^_]uUEU P@@ ]UWVSEpVUu 3t)+~E D$|$F $EЅu׉[^_]1[^_]UWVSExOtX1҉UM~]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSExOtX1҉UMy]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSEpEFM ]M19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)뵸6̀rS[ä{ [USHÈ{ ED$E UD$T$ D$E$f[]ËL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffUWVS0MHz ƉE̋]E Ơ1U1xu2  t8u)؋U+0[^_]Í}1 r}̍*]ȉT=Ѓu]t; t\="t]y$]E k1d]̍襯UVSu] U؅tHNtuxu)؃[^]UWVSHGǭy |$4D$ T$L$@utȃ"=D$ uƉFD$8ML$$\$4 u܉t$DL$8D$-+|D$0|$@0D$8 D$<D$@ \$0ۈL$D$8T$u E&UMU ]bUEUUMU ]JUWVSUBt u 8Et?Et8E =wPut$ $5tQU18[^_]É $8Ei81[^_]ÉeqO8TA0ffffffUWVSACt Ǡ1M1ɉT$D$ 5D$D$p4$4$,D$t$$8PE+uĘ[^_]iU&As UB=w&B]Í+]7US@Âs UM B=w B[]Í+[]U@As UB=w&B]Í+]USc@s UM B=w B[]Í+[]{U2@r UB=w&B%]Í+]AUS?Ìr UM B=w B%[]Í+[]U?Ir UB=w&B]Í+]USk?r UM B=w B[]Í+[]U:?q UB=w&B]Í+]KUS>Öq UM B=w B[]Í+[] U>Uq UB=w&B]Í|+]USw>q UM B=w B[]Íp+[]UF>p UB=w&B]Íh+]WUS=âp UM B=w B[]Í\+[]U=ap UB=w&B%]ÍT+]US=&p UM B=w B%[]ÍH+[]UN=o UB=w&B ]Í@+]_US=êo UM B=w B []Í4+[]U<io UB=w&B@]Í,+]US<0o UM B=w B@[]Í +[]UZ<n UB=w&B%]Í+]iUS<ôn UM B=w B%[]Í +[]%U;qn UB=w&B%]Í+]US;6n UM B=w B%[]Í*[]U^;m UB=w&B]Í*]rUS;ým UM B=w B[]Í*[]3U:m UB=w &B]Í*]US:Im UM B=w B[]Í*[]UE ]UE ]ffff̀rS[l [D$t8t9@€tuuuuH+D$US9}l ED$ ED$E D$E$[]UVS<9Dl uE EEEEEEN>wN#@ t$ED$EȉD$4$+xE<[^]EӸ<[^] UVS<8âk uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^] USj8k UT$$![]UWVS,<8j 1EԉE1ELIBCE_ALLEOWCTEYPEAEBUSEfE=18t=u tD$t$$ u߸MԋU+u ,[^_]1US7@j D$E $t []ËU$ []ø̀ffff7̀rS[i [>̀rS[i [US7èi D$`D$ ED$E D$E$[]ffffffSD$L$ T$.&&@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8tt& )[Í1[ffffffVS\$ t$tCFtU8tOu9vCV9u !€t.&CFt8t)[^fffUE1]øUE tUt1ɀ81U ]11U ]ùUU ]UE t&Ut1Ҁ8‹E1]úE1]1ҋE1]UE1]UWVSU ]E8tOt(G1Ht*t-Gu߉E8E1[^_]Ät1ݻ뮉E1[^_]UWVSU MuEEtxtAE1}EXt?:tWEt uԋutE}8E 01[^_]Ät)Etփ뢾u1ЋuE뼋u1UU Et$Mt!tȉ U1]1U]UU E=wMt1]ËEU]UWVSU ]Etttw1=w%tQzt.t&=vۋEUU2[^_]1ɅtE1U2[^_]Åt1뷻1UWVSU }uEt^tgtc1tt+9t#t=vٹUU [^_]1ۅtE1U [^_]þ1Ʌu1UE Utw1U ]11U ]ùUU ]UE =vU1]UE@E@1]1UEt2Ut/u }wE UM 1]øU]1E ]UEt7Mt"U tЋM 1҄‹E1]úE1]1ҋE1]UU E=wMt#Mt1]ËEU]ËE]UE1]UEu E1]ø-]UEUt(U JU1҅‹E 1]úE 1]UEt7Mt#U tЋM M1]ËE1]ËE1]UE =vU1]UWVSU }]tbtC1ɋ=w#tArt)t"=vݹUU [^_]11U [^_]Åt1ǻUWVSE ]tEt)uV1Jt%8tuE1[^_]Ätǻffff.&&$D$4̀D$̀fffffffT̀rS[Ta [PS[=a [USu.a 91u P1[]&[]f̀rS[` [US#.` $1[]UVS-á` l t t [^]É4$}fupU1fUVSÉ1   lLLLL9r[^]UWVSTE8}x}x}@ EM]Br 2 r 9u֋EE}M1ˋu!1Eȉ1!1E1!1 u1!1 ]ĉ1!1Mȉω1!1֍ >Ủ׉1ډ!1ƍ> }lj1!1ލ> ]ԉ߉1Ӊ!1΍>M؉ω1!1֍ >U܉׉1ډ!1ƍ> }lj1!1ލ> ]1!1M1!1U1!1 E1!1 }7yZ !Љ! učyZ !É! uԍyZ !ى!  u䍴yZ !ʉ!  uyZ !Љ! uȍyZ !É! u؍yZ !ى!  u荴yZ !ʉ!  uyZ !Љ! u̍yZ !É! u܍yZ !ى!  u썴yZ !ʉ!  uyZ !Љ! uЍyZ !É! uyZ !ى!  uyZ !ʉ!  un11uԍn11 učn11 u䍴n11un11}܍n11 }̍n11 M썔n11U2n11U؍n11 ]ȍn11 }荄n11}7n11un11 uЍn11 un11}lj}uO}FEЉF T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPEE);UEމE} ]7Ey@9rE)uu U<u sCtft[^_]äftu^uE[uOuW] ]u\3]|fu SfUWVS '÷Y EE} Ơ1E1WEE$G?7w}8)‰T$l3D$<$D$ED$<$EX1u4u:tftE+u& [^_]úx)끪Wtf耎fffUWVS&X uN^~3S C1ЈC01 2 Ƀ9u߉u)1^]^D2VVҋM]2ӈ]9u҃t[^_]UWSUBBB Bz10u7u=˃1҉9ruu[_]ê[_]ft/tfUWVSE1 tftu؉ tO;Us]E )])9sˋu|}M щ؉΃ru.u<똉U4$MU;Ur[^_]CtfUVS :$V u] +D$LD$$D$CD$$SSVSVC F ] [^]D1ø11#`V ة1øUWVSH#=V ` ts胸}1f1҉9r׃uFh E̋d Eb fE؋l EЋE D$D$(Ẻ$UH[^_]f불U U 1EEEu AfEEt%uыqEuۉt Eĉl }t Efb }d }t Eh t3b 9s#M>u +N 9rth Cƃ` =@AEĿ0AEE!d td xUWVS!vT \$(ED$XE }|$8}|$,à1\$$1҅ \$X؉D$DD$D$$D$((6D$D$8<%t2XD$$\$X|$D9s CD$XD$8D$8<%u΋D$8P@D$71D$Tt$\HZw|$(4D$ \$0T$8D$`1D$HD$LD$\|$`D$T7D$\t$\T$09}L$$L$TL$<2L$D9L$Xs'L$Xq0T$D9 L$ Nt$X|$<T$L~-|$L|$DT$HL$X9s0r|$LL$Xt \$DT$X9s  sT$XD$TpT$0D$\)B[L$DT$X9s sT$X;1ۍHЋt$\ABHЃ vwD$ \$0T$8D$TcD$TuD$T|$,؃|$,mك۸D$7-t$\L$Tt$\L$TD$ \$0T$8D$,X\$<8 t$\t$D$<$\$()9؉D$L҉T$HCt$U$XU͸UWVSÓ M uU E@}ω}EE‰EPE)9UB9E9}}|$4${GD$u4$iW׋u$sBu3u,u֋ED$+E$1+E[^_]äftˍvu4uC먉U$FUM MAyEfffffffUWVS(F ljUM܋EGlE8u䍃EE썃E< t< tD$ED$4$pD$ED$4$QD$ ED$4$2/D$D$4$G$u< tt < u>:([^_]ÍF$.~d ʈdGtD$$y닍F$~GjD$$DSD$ D$4$)tD$ 3D$4$ uEO F $e~GGD$$ÙD$̨D$4$訤tjD$&D$4$芤uXO@E܉D$ED$89$ZOWL$T$9$;yO >D$-D$4$t*D$ 0D$4$ugOD$D$4$u O@D$&D$4$薣u OD$ЉT$L@$]Lt׋$ˆL,D$ $L)&D$M7D$4$:5 D$.4$8]D$D`$ȟDǀtǀxDž0Dž(\9$D@Dt$D~DD$4${u덃$w< tt< uDž0<4,LTDD|$@$ \<NFVe9xDw@ut;u㈕$<,t$$<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $DL{;$1!$tDž0pvLusL@DDu|uc'0D$D$s1ɉfLu LVfqUD$E$#]UWVSX. }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|E/9EttI86D$D$ED$ D$D$t$oaBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[ [UWVSd. 9D$$d(@$*iDžDžDžDžDžx@ N L$T$ VT$D$$ZT$${@ 9@ωփsUtfth@ lj)#Pb덋ptŋ t|$$zu똋P04$و@9‹(tft‰)@0DžuY tftlj)@4#tF4$@9r1‹rf$y@ $輸_1d[^_]U[‹);Wh@ 3ffk$fx0P@~~ <9V) 9kVʉ)ȉQ1ҋ;tftH<@ lj)9ts9h΃rE@ $,w4$R@9q‹ytft‰)‰DžHtftR<lj)944$t@9‹yUffR 3PD$ŴumuTk@ $致f+ f넋$t@ iUVS3 1t$觕[^]Í9D$$`~[^]UVSÉ 1t$[t[^]U豼Z U]UVS蘼= ut$[^]Í9D$$}[^]UVSL ut$s[^]UEPM¸t]ËE@ ]UWVSÌ }E0upq @A9D$$}ƅu!yH L$UT$@$tEG D$GD$ GD$D$4$۸u4$rG [^_]É4$r[^_]ËG [^_]UWVS ð E18 &:)lj}싓 u2E D$ $ [^_]Ít$E$qt$ $qt{ t1= ;txED$D$quًED$D$ED$ D$9D$$. [^_]Í9D$ED$ D$9D$$ [^_]ËED$UWVS 袹G ''w} )ƉT$U$լtn  UT$ $讬tG  D 1 [^_]ÿ'y qUWVS(ոr LJ LJ LJ  11ҍ,>EE5 )Ћ  ڍAw L6D>ЉD>]T>ӉT>>MHL>@CD> C kED>ЉD>]]Ӊ\>>,<l=;D> rU7UsD>HL>PD>HL> H=7Ë ; el9H P H HLJ = MULJ D> UMD>ЉD>]T>>,<]ف96l9LJ 롋 LJ LJ D>ЉD>]T>>oMU&E1E䍇 $<UMD$1ۀ} ËE)؉D$ D$9D$$,UMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@pUM^D>E싟 ]X] É %LJ l9 f gUUxz Mt ; r tXl9 H P H H= Ћ]!LJ D$.fffffffUWVS0- EЋ u䋸 }9E CuԍlAl?u썰,@u؍ Bu̍AEE]]EfEǀ  u ǀ E苈 E苐 U苂 t> t1P}艗 P  5R}苗 D$ $ 돋 uЋ Eԋu؋  À8 u }胇9u}U & E苐 &X U苂 }]苃 D$ D$ D$ $R=  >E苀 P[^_]ø]苃 $$E{o…MtO1E&} &E7LEDXtE7<$].oƒ9r̉E1R1KU} MԈ }ԋ EU}ԉ+ E Ћ U }Uċ:O, OŰU苂 U9E2\9ËU)Ӊ]W(EUȉ XND]荃D$$D!_E艘 G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]Gt/U艂 Uċ:MO u#O)ȉƋ_uGE荀:1uȉMȁ vE W18 M苹 MċKщˋMD9UUċ]苃 $\UuUȋ]苃 $ iUE苸 } M< ЋAE̅+}苇 $  <EU‰ŰY9Q MỦ @D@Eȉ EăU2ŰEȋUЉEu艆 EȋU}̋UUu艾 fEЋ }ԋUM‰T$Uȉ$]MAYۋUBA ,Eǀ GEU<A,E苀 E]vC]苃 $Wg]mv8B_v $}苇 D$ EȉD$D$ UP$@c tU苚 <AEE苐 U }< Mč[^]    ڟ ɟr U赟^ U]U蝟F U ]U腟. U ]p U\ U ]UWVSJ u"$ uމ4$ޕLJ LJLJ LJ LJ LJ LJ LJ LJ 1[^_]US蔞9 E$Ԍ[]USq E D$E$ڑ[]USG E$[]øUS D$ED$D$ D$p;D$$ []UVSʝo uD$4$?ff D$4$?[^]fffUVS 肝' EpFtD$D$$.F!u  [^]nUWVSþ uM.D$ ED$E D$E$ŋTe>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$AuDžH V€ʀ UTPzmD$ D$D$T$RыU !ȃP{vmm0<$舂T$l01[^_]À Vll0<$0  PxD$T$1>P^E E DžTED$D$ D$D$$sDžt HƁ Zkk0Ek0 1G.G/G &G [G$G/GD$D$L$$)PLPP LЃHtfD$PD$L$)+H  D$ $PP D$돉Lj8PLen  PD$T$~MP@ ƒ@ u")b'fffUWVS葘6 }EpFtD$D$$)F C  D$4$u_  t$ur  T$U4$Džu=U9B0E  i[^_]1UD$D$4$ot̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$;([^_]UWVS虖6 EpFtD$D$$'FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$e !@MuFЃ[^_]úЃ[^_]ÉED$D$$ 'UЃ[^_]ÉfUWVS$_ }9EUEEEE;E MmG$Ku݋M…tUL$D$<$LUUD$ ED$}|$4$/u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$͇t㉇1UWVS( uE䋆EMM܉;E E苷EHMU$IƃUtY9Euȋ})lj}苊U|$$U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$5.u@EE9E 1([^_]D$ ED$ED$4$-l([^_]UWVS(葒: EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$]LIMUD$ E܉D$L$M$U]-M9M Ut%E9s.E9hw1([^_]Á ([^_]É\$<$DžUt([^_]UWVS(" EE] ;M sf]]9suE19r 9t[:u)ÈU]D$ E܉D$L$ME$]+uEFM9M Uu]1([^_]É)맋E ([^_]ø([^_]UWVSF M EEEtA<1D1?QM )։t$D$$YM fyE\AA}?zft-}|y‰Ef9sf9uE}DxQ׃T)ft"ҍ]uU|$ $|tUx?UWVS EE,E}1EED$ED$$]ƅ@ wXf]1 9M rTVÃf9EuUMUfY]][]]}tH}t8M[DF,D$t$$]E.D$DFD$Nj]NYE}E9}twu})D$D$$]9utAFD$FD$$]tVTP‹}u뙋u]X}8[^_]ËEpE )}fG w[^_]fUWVSÖ ƉU׃ VU)D$ED$M$GMf FE@)D$ED$M$UҋMf f>\?)fDfL[^_]UWVSF E xfEEETf}tU)ƋUJ;MLW)ȉD$T$ΉMщ $7E9EU|6DU+UU\WPHftffP9uEftWf4T]TfTEfEh8E H1[^_]ËUƉE봋uv %E D$E$P[^_]UWVS$ E}EW u}EGft;f~su f ljEfGfEnMfyvE̍DTQ9>ED$E$E@EM $M̋UEHfEEf;EЃ<fD M)‰UύU)ȉEEċỦT$MȉL$E$L9E U/MfyvE̍DTQ9ED$E$E!@EM $M̋U+EHfEEf;/]tED$E$f1E$M̋UȋEE$M̋UȋEf9MsFfED$E D$}G D$|$ ED$ED$E$ uOEEtE@EEEt5@EEEIpEE@ =]c]cx[^_]|Af+EfTM)fLFMfLFD$ ED$ljD$E$[EtpE@ =tGNjUt(ED$E$f}EEEfEEEEMt봋EEfEE1UWVS$rû Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$hED$$"dEu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$,Z…t EME$EPEwD$ |$UDBD$4$Y tʋ@f8 $dž  BUWVS(mp EE} w8}PUEEE@E|FBU M9sωU DF)fEȉ|$UT$M؉$]V)}}C}ffE‹M9sfUM9L>f+MT$U܋ED$M$]UU)UMfL>fD>}f)|FfLFE pH|FU҉׋]9s߉]9TF)ʉU|$ED$M$]}CUfFfۍD\M)f fTN)}uefDE H14rJ|F E9PfD>([^_]ËU9ZC8fDE D$E$]E tpHTFUWVSm\ EE @u E1Oft{DXND$ t$D$E$]Vƅt|$E$Ff]PMuJfwfuf|Xu E녋U R1M AMf E@ =fEɍ\)fDJMfLBE Ht$E$]t9t|$E$Eh81[^_]DXfBfBFi[^_]fEqUWVSGl U EzMq uf+4GMM9U t$ED$DM$\u)uD$ U T$MDD$E$T…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$ƫUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS k Eu} 'D$ D$DJD$4$]StDPfzuft,ˍ< fD$ t$MDD$<$R aLJ(@f8u$LJ 1;D$ t$DHD$<$dR…@ fEB@fE1fEE$MAE9F ED$EFD$$3M1U)fUN fMD$ t$MDD$<$Q…ZM_LJ $LJ(149UWVS(;h E։Mz@ =uW)ЉEN MMȉEGfEt$^ED$$CZUE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$PP…t#M L$M $MEEvEz8UVSu]ED$E$1ɋU Ct1[^]øUWVS(f@ EuD$E$1ɉE--D$ED$E$]>EED$E$} fG fE @}E;EEHp@ˍQU40fUt0UfHUff]f\ftPE ]M HwOfw]E;EE t81([^_]ËE jx}D$ |$D$E$]oN] C$NfMЍLLXffFfLF|$E$]DžtMfNKf̀rS[t [UWVSTdV E؋}u1EĉËE1;FEE 9b}}TD$E D$<$]A@fEҋ9E E҉EBFEȃEYf]YfU])Ӄ9f9UsAҋ])҉T$DYD$DYMԉ$]MAfEAfEԋFEUЃfQEf+EfA]fDYȉMԋMȉ]XVT$T$$] D$MԉL$$1uċU+T[^_]D$E D$<$]M@fE҃}t>}ED$E D$<$] @fEfEEE܉D$t$<$]1EEEE܉EFEEuẺD$ED$ED$t$ D$L$<$]茊D$E D$<$]tK@fE҉ED$L$Mԉ<$]iM1D$L$$],s]UWVS(|a! }EpFtD$D$$FG!9t~rd94D$D$ $jG)‰T$T$$2E䋆E} v&F2([^_]ËUE} wڋMCE 8t9  u|$4$tH9s`!EEUU,D$ UT$D$4$VOH9r!<ED$ ED$GD$4$u@}} u~$ D$E D$ |$D$4$"([^_]F(~$E 8EE 89뤋$UvME\UUT$L$$NH(T$ $\RGE$U]]US^. ]}]ufffffe`[T$Hfffffff50+&!fff] ]UVS]} EEEEjuVj < uǃ< 1tj%jj#jVjj$j%UWVSEE] }3t>uW4j/VZYtp t0MPV'ZYMu}] EEAe[^_]VhhUhp&3UWVS]u 6=_hVS" tfu91&ۋ=&)uz4=&u hZt& &hj5&}& @u5&hjhoXu4'hjMUW6&ZYMtUBk u6h/jPVKSWPUWVS] 32hjVhSu @t h&DP?ě&Zuě&1ț&ԛ&5ԛ&jjPnț& y 5ě&&jB&A=0%v&u hjm&u#&&)&&&%H%hPR& yT&P&%H%hP5&ң& & y5&hj`&|A`&@&u-x&u&HA&uj`&D&&9ӡ&&s@&táx&@`&t&&`&d&Л& ̛&t H& &tH&%h=`u; & x&|&&x&%&RP5&&P &t h jh@&0hjGhūj;1=Ě&=Ț&=̚&&h 0%P0%T5&t'& &&&;&&ss && u15&5&5ț&ԛ&P$ u15&5&\ě& rPPhۖCY[&u5j5&5&5ț&ԛ&P  t5ě&h蘖XZ&&&&&&&K&]&]&] &&9Uu/9Eu*&&ڣ&&&&6esEUӣ&& &&& &&t1&&h&l&j>1=&=&XsE&&EUMt(&,&EU&uRRFA &&&&=٢uy<=u<=u<&t=h& x&9ȋl&|&s")1=d&x&|&h&l&l& h&t j=[Z&5& tH x&1=`&x&|&h&l& `& d&)։&5& u&=&ujPY@u&8th#5&&PZ@u hjj UWVSX ] 3~hjOj蛷hSu\ G-$,<&1,&&8&4&1,&&@0&z&,&1=&Y(&J15,&&3$&$ &1ɉ ,&&&&&& &=&th~=91tu hj1nuou&j,PYZFt@jVE&^Zu hW8pj,WZYt x>1>8Phhp&j 0&&=4&t t9h/Buu/ (&t'hY&=(&th&&jWl&ZYu hy;O<&=$&t11X=&uمtՋ=&jWY[^t' 9=<&tЃ=$&t ]tljKti ȉ=&\t 1Z01C PYjZP0P蔑t 1B"&~h u)V`C_Zu hjt15&DRPrZYyJƅu(3%=`ujJƅu3i& PV+XY_=&i = &t9PV(YZt=&Vh$}=$&t%" r=&ughf3h$ QJu =&u7hfV3h/$ G=&=&u3hkXZ=8&t4011Dž8hhNP &58&8i& 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =4&u1&4&&=8&t50>";&si >C1e[^_]USEEE EE0[1҃vU|r҉&UEhRPz tvpt.Et?SuF&Ƀstxu0gS̟&볡91x&&&۶Phhp& jDE&EE)ЉEEt9E8-u/&EH~&)EEEHEje1ۉ$ZuYh]jdXZjjYY[hjKXZh& lYt1hp&h#菗XZh'tYh$j [XL&Et^E8tTE0xYtEEj0@\YZyj?Z,E8!tYEh0h& @Et9hp&h$YXE8tjZuhC譋Xx*x&tPh$ Y[h&X^y"=ȟ&th`&h9hp& uY=&=&hp&h$>ZYh1#1ۉ$BZ&f%̐&1&냋؟&| thXf%̐&^1&gx(xx&PRRdd tt 1j1ɉ &hp&h$~[Xh1c1$d=ȟ&ujpjqZuh`&5|&hHhp&{ h`&h9hp&b hp&h$ Y[jZn=ȟ&ujJh`&5|&hHhp& UWVSXu} 7{rheCYZu fu91hWV= utt &)Nv踚E8}WgZE1` tAB9EsEUPQMW UuMt6QWhjփ빅u WhAE@t1j URP>E ;F|E8tEph.jsE1~PS虈YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW菍 UWEffEERhm+fEEERhmWL 1!EPhm8@W0 x E@6Sh"jf9tfuPh@EPsh]KU9#K Uy Ęuuuuuh}$uuuuuhuh uhXZQURPWV x%uSh[ ,URPW1 yShjPhjjUWVShu E1E1ۃ}~F8-tEh_th'PZYu &h+_th'PsZYu h5IXjh'h+EPuhQd0E_t<1ɉMMMMMMJha91PuZYhljBEhWE)P$E @}w}c}6to)}4E뷋Ed$}8tEKwn뎡91Ehh591cEXZj91E]EQEE&&}uC&Eu&4>tj@u)Y[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtPE Z\tS1XIEt'U)RPSS Ã~t C}u"hhhEZYu h"}uEEuh&WuuEpEPu9 yj=&y h}tLjuVjhSy hZXjVjh5&y h3Xhh7juVjpSjVjw5&,u1ɉM̉MЉMԉM_18H>v m DGu΍EPEPj =&t}t.D1}tEmjEP48z Gu踧Ey h'j Vh~f5&FVh~fS:SMUE}u j u蘭XZjUE 0j轫jUVSEU J &uc1E1ۋ4@Vh0uU &H &Y^yh&j UXZ&P& Cu ^1e[^]ÍL$qUWVSQxq1&&&& &&&&&&DžDžDž1|hVI @I&/0$`S'$1%%%s%d&jP591 :uy591h%& &&&&&&14݄4݀hC u &w&l&91j/SY_Džu ;C3@;tGt@:t%tu@tj/$[ZÅt8@tYt%@t3t@tij/ZYDžt+{tQt@tUt/{t@t)tG|hO&Ph&h&h&h591}u91<t h*j=&u&fPh &Ph$&hG591~!91<u &$&9shQ뉅 &91j/S=Y_t6PS{_Zu#91%=@u %91+ &&%%91&}591[%[=~ PZPhnj&)ѡ&=&t & &  & &tW=&t t$h4t= &t=&uh=&t=%uhI&u %iDžtDžxjjVjjtS5@t,(YtjjVPjS5@t=%%=&u/RPy_Zu%=u && & &1  &t1=&%=&uRjhh&PR-%y' 8uh&h_tFh&hd[^h1hXh&jdh&6hۋuw1ۉ& &uY %H4=&=&%u Ã=&uMhYtpjhXZؙjjjjjщڸ:htt Sh^_1&@u &&  & &1}=&&Džt~ Džh*0&Y=tk jhjjjщ¸-Oƒti¶ f&j&DPXZh\/Fjhk& 11"&tJ?tEWhU.&&1ҋΉT 9u9u @u&1;=& &؀tet\PhU &1Ӌ Ɖ\ 9u9uGtDžDž19~JCWSh)މD 9u9uG뮋y1RPjjjʉٸ3 TƉV:f=&?&htku ù19rGD8&G&`&11ۀt,&t#u;u u@ $ut&u돋5&&19}{.tK;tFȉC219u9t&A뢡 & & & &=&uYh/,^= &t(/& ,&t h,[h YtM& &2&~ h_Z &~ hFX&2j 񋅀Ɖ1ƃu hϡ&11;&ÍPPZYx+=w;)uv8&=4&50&jStP 1eY[^_]aUWVS}] 1ɉ1Dž1h@SW rfq1stwU1҉j P591e91 8t :tPh&8"[N591h jDž-Dž&)Ot61jhP6P2Ãy2 h&hedAP y hG=*&9 @f*&1ɋ0Xu uXhQ!4jh&h&8 4  tȸuPhu|ZYDžf(&h&4f(&h&-k~PSyhju"PhwdS h(XSˏ1e[^_]US] 3#LSu9US] 3 LSu#M 08=&j/WӰZYu]Whd#hj#hh&AxPh&^@u"5&hd#h hh& &&=&hj5& à (tPyphh5&à x29=&~hPS薈G jjjS!y 0 P5&h"oj5&葉YXy 0P5&h"nxPW\YZy 0P5&h"n%= t^=t5&hp#nXZhPYXu1RVy=&u0@&PDP5&W5&@u5&h`j迢 u00h#mXZ@,t*uLq5%&1&hRZYtRh00h#amt5% &@t[5%@t&1& &,t-hPl&ZYt4#tș;s <u9ʋ<Dž<@rL@< uA9ʺs19ʹs h#j.h$XDž< 8u^%= t5&hO$\ZY1801RV|4щ‰n8X<5&5&5&$ 45&5&85&5&5%PVS?Ã@(t"rSUWVS1~}9Dž ~1}}}~~~11hE p55~Ph+r "~ڋ ~ ~P~< ~~~8iDRP@Shp8H$hd`\XTSh8H 119t T@ܸt.PVSh8=|&~yhgX1 =TRPh8G u"j Xt-hgg_ 9rj uYSh8FXZh9~Ph&r@ ~~5u  5;WV P5v$`&j P591TE& :t591h{=h=Y591 'Zu591h=&Q&B9121ۉ%%&tRPh=j&1ɉ %&h 591&[Z591h=j؈j P591?D% :t591h >jtth#>A&^&O&@&&u h^>j=&ujS8^_=&th&h> LY[hdjjhgbsW=&th&h>KXZjj^_=&th&h>KY[hdjjhgbh>jXZ=&t0=&th&h?QK^_hɷjjhgbjh>Y[.h>79mh>%j.jh>^^AjjXZhVsVF th?RPVOu u &=%tWKZhRPWNt(hWsWCF u0jX=&t/jUWVS] }bSC2'S2'jhh2'jP6'@u@m8u$jhh2'j52']6'@u52'hjT2'2'h2'hQ@56'肴 %y@%2't1MPRUdZY UMu܃ SEPQj.Z@%uRPh[ej蝃pUWVSXu] 3&Ӹ_tj~Phjb91t8'hSVF Dtb$<'<'<'<'<'<'<'{<'l<']<'N<'?&9n=<'t<' <'u <'=<'t=<'th]n=<'t,=<'t#=<'tvPh(n4EP:h߁S u$1ۉ<'<'EU<'<'ڀ;+u[CK&DJPk<<'<'EU<'<'Y}Qȋ=&DOt Bu/<:0RUZUBBBBhvEP~1Sn  $0k SDЍ~=Pd80k SDkd-lGS0k KT ЉGW0k SDωG0k SDЉG 0k SDЉG0k SDЉGW蝫<'<'_u u\l+EU<'<'y hjFh*PxY[u~tO8't5P#Z)ǃv%8't CRU6SgUӃ f @8'h&<')PS t!;t ~<'sC~<'uf~<' h8'裾[<'<' <'th<'*Ph hYg<'u(PPZt<'jjjE =<'u6^uhjtPh,kjÎj jhb ,;<'<'| l5<' <'9Ȼ@} VG9ƉS}M)Mt1jjs se^M9ȃM} '8'hx'Thp'Jhh'@hjG.=4't"Ph QX'^_C6f=\(&t j4a[E8'&utfEڃ=4'u*t{8,(&u1f=(&(&< t< uG< t< uMjEP5d' f=)&{} uqPS_8'&uEE5'&P[ZYf=(&tCۡ&t &fEjEP5d' f=)&uEPX-h)jpUWVS E 0'W1'4'hKY[t h&!ZtTMBug918tpjRPz :uS1ҋ 'buV'' 'hQu uà uC$ / 591h>'ė'먃 '륃 '뜃 '듺X91낃 'v91u#h[h/ h0W 'hjS ^_À;1hnShZYƿ/ t&VRS( u <2t&hzS(^_SPhq` ' G'O3u8=eRh 8=tRh Y[\3hzS踞^ZƋtt ug(SYSOZho_4jPSi‹ 3 9r(<,tuxG 'QRhSV7h^~u591uhh/ hKh諭1k$'t!VP2ZYu''yGh(Vh+j軝91 'I=&u)' uA~='u,P'Y@u hcj7lsc''Z!Ãt~/ t%Ft!á'0Rh{+  s'0h XZ s'0h_Xt Sh޹[^j uh tth.諹jxE uC'3hRبǃ u R3h"xPhP tlj=''t L\1 ȗ'hPWVP' uR5'hdjjh'P%ZY@u5'h't&h'P_u_'05'hj)j'='t8'8th'PY'u$߃8u5'hji='uhh/ h0hjsfO4' u shh8'PA_Z@u sh!@'%=tE'Bt,=@t shB\54'O4'Y shm7C0''5'h'_Ztpp 0h裠 'uB@'%=@uu0'uRPhV 't Ph?Y[''th'P Z8th'P_#Nu@u h j/hh'P^"hu Rh5('%=u5'N[@u5'hS@L5'mNY@u 5'hr4'tPLNZ@u50'hjgj٘UWVS}u 1ۃ~^;-t&11ɉ<8Dž4h!VWB~ it1҉4)&t+:t!;B uBu91B뵃Pr5σitot8DuFDž<늅u 91{ShBh- cDž8Tu# dx1jSVrCtjjjPIǃuh7VhiPÖ @u h9jdfWLY)&7tvFtjNt^HuTHItBQ4 Z.0Q!Xɋ0u hHje돃넃8t 4t<t] j輖UWVS$u] 3lhj hSVC| Btb$1 jj591 L'\'l'P'h'd'`'s\'dX'UP'T'vBeR0G.f"$l2 H $2 a'''G'1''a'1' '?'1'1'"''1''1='''''&)Ӄ'='t*th' ' 'tbh jk[t3='||='t=||)='||| Dž|4+j'jj'PjCx<hSh-&=v ShO<h-&Y-&-&X/tK-&-&1hj]XZ='t.Ph-&.,x/uP-&@-&= -&wPh-&Y_@u78Uxt)o%=@xtbK='u='t' 't P6 P6_Z@u6hjY%=@t /t 1ɉt4h-&hajvY' 'tDžt Džtt$P蝘ZPvЀ8/uj|Vw+x 1lpupCpQh-&b^Zh-&CHfuFs Psh"pDžlpx/Xu$wfushwЦY[ftf tt)-&C,--&=~TSh-&h艦 o{DsC(huTttCpj/V1sYZpt)xphM>PLYZphp>h)8/t z/t/Bс-&vPh-&hե VPRp<p-& -&= -&vx/uP-&@ߋp='xt Ph-& Ph-&7^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-&hCP@% =@B%=@t,M1@ush-&h1Jp΁@tpw `~||t {DPS`ZY/sH ' 'u&fNush1Y^jSxC1*f5'V''lhQh2 h6tCPph-&u?^X='h-&shV E%=@t %fuL='u%'H''yhyh2 h?jRZYhd莕shZY='t'PR='tPRPS|W8t hjhTx)liUWVS|]u >j/WVoYZtxhݫW肗_Zu^hVSj @ui&)Ãu]p0a7hߋ^Xt!DžtpSZY_yɾߋuڋtV茀UWVS}] 39hj hSWf tUit)ft5huP(σvu?(1((15((뗡&)ǃy.4jj(h# jh =(tuϋV/PFTtP2lpY[uNj|%=@luh2lQDà =lv2hjMltx/tlƄ/CGh>WZD>8/u 9tH@j/WhZYtPRdY dvWhٛXZ"@PRlA5z. t Džphfpc~UWVS@] 3Z)p&Su脒]Sj(4uEUEUSj]^_Sj4ZYuEUEUSj\^_Sj3ZYuEUEUSj\_XSj3Y^uEUEUSj\XZhI lZ)Z)1=Z)=Z)=Z)Z)P]1E؍}ȹE? uVSj舎xVSjx x"}ujVj_ y}tVSjD xjVj1 y}tVSj xjVj y{}tVSj xjVj؍ yP}tEVSj 蹍 y1jVj覍 yVSj蔍 xLy y hQ 0j ^=5&tUjhgb05&[^y Еhq 0juZ) #=5&u=x5&t P@hjG,jYt8uVʼnZÅt @|/tCP+Z)_uh jZ)ZYtlj؍PZ)/hȭ(h`: jމ5& t! ttBGuBY@R9=Э(t h jIW=5&u5&FYPt Z)Z)e[^_]UWVS]u 6phjҽ 1hVSE` tLtPt9&t~hSh_8/u|hP~Y^ukh S~_ZuZPSY^@tHxPhgb_Z@t2|9u;xuM9 u;EtjjӨY^uj SAh&\XZ$&@t h)jtHjyUWVS}] 31hj蓼 1hPSW_ ft]/WPtwR)d[)벃vtbit6rtxu{[)[)1[)p1[)[)Z[)K[)<[)-&9=[)zu8QuthZXt[)؋Ht ʉA?jb[)[[) [)u t1=[)t =[)t@jPWVǃ uhzC =[)t.u)W[XCHHf $P9 PDs 诽Psh"jE=[)tC ?ƒuts nPsh"迓[)k=[)^KPSCHjSW C 1ɉK +C  Cu>S=[)tCHSftYwifu`KPC_usUZ=[)u&sh[)Y[R+z8XC=[)usZuH1Htm=[)t<8V.8?H 8r5[) [)$1[)sX8t hjCW;[hxVS|ZYu8=[)tCj譻PSh"[)_u=[)EE%=@uB=[)uSh譑[)Y[묃=[)t'E%=u,Sk*B=[)u=tىډuh=@uS(T=[)u SWZtXt1=[)uSh^衍8 蓍8?腍8u=[)S6X5[)s1e[^_]UVS@jj^X1EĉEȉEEjEPj& 2Q;QTw¸9u Q9Eb)j j(Y[b)H b)jb)$jZYh !>aV7&1ۉ]$hc)3^Z\)tt3Hu:\).&$ jh&!Pj7ÃP$Y|=V7&uL=b)uCEP萇$0!Zu EPX8tEP$腄XEDi)1ۀ=n7&t$=\e)uEPaX\e)n7&u'j4= ^XC̈́RPZY=n7&=\e)46&Di)5\)h$$7&XUWVSpE 0^hj1ۉ]& 1&] ;E9h5WZYEWf}_9Euph5SuT tZftatDeuI렃gu=j591y#EZYz591hj=^&E ]SuYZZYy h5yEPhBt @um y h5X}Whht@um y h5XEPht@um y h5wXt$FvE 8uVEPuWS(S|^1ɉMME 8URu V&%YZURVYZuURV&^ZuoE 0&DPt"VPS.VS.E9jh6V uVSGEZYVh2葊0E E}tSju=j)tzj:WEYZt@0j.WTYZlt!hj)W_Z@lu B/>t0<#u.j)hj)W賍ZY@u ۉ.8xPWpZY@u WhjA9=j)tEj)Ej)jSVR ǃ 1uh>pu jSWz WQX CHHf wg$T s 謰Psh"Džl-=s 肰Psh"ӆttDžl, Džl-j)ht)KPt;Quj)t;Au A<5j)RslЃ t"`ushEY[ds荶Z贂8t hj7VhUWVSu {f)()'{ ) ʈ)$){) ʈ) )wz)%j)f))hV[tl.hKAVYV t7GtPSWzYZu -Shy@Wh@j61h@VuM A6$`U L)%j)<) H)D)8)=91hWyYZuh@WyYZ;,=91N-.j j591~ǃ u軀8"u 591h@D=$)j j591~ǃ t =()u8"u591h@j5j j591w~ǃ u@8"t=j)591h@뺸Y5915Z@u^PA4)I )=1 )4@)(0) 9ttm/؉ j)v jhAuh$A )tt hXAjP4j))ǃ;= )u/;$)u");()u)9rt1= 8&D)H)  8&&=4)tCP U)4uE=<)t=8)?8)4=8)tt  1Ljhh)PQ6PLy h)t=H)uJLxPPOZYLu&%=uD)H)w($ hK@jR.m^~W /Yu Wh>P`)eȺx)t jSRF: h`)@,ZIP5?W^UWVSjj]Sjjh^ 萢@u hLj-uJYtjjSPjh^ ]@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQMQhdU1G맅u) &yh&j jXZ&P& 1e[^_]UWVS ƅ]-ƅ_1ۉ) ))15)))1=)))1hlMu uLC ycPtJTtgxPl$^  )뫃 )q ) e )Y )M591)Ye591>Vj:V7[Zuh6MSH)t)XV3 oZYXu C[Ӊ)=)t h~jI+91tuh1Ҁnuxou8&hzP&q^_t)T֋=91u )i91)TOkh@_ PhLMhp&ej[^])T)t))t )&M Tu)tP1ۉXh~n hm 5)R]XRrRhRLqmZYTLS ZjjLRPVoT9X}XTPT0VhPCgà uj/SDZYuShd#h hS_V6Xu"VXu9Sv^ty2LhVfà LVhjuhLRUlZYhLLR:lZYSh}MjjhVjS~ǃu VhMj(h )hzd@PX uWXБ)`PhedAWX @uVhMWVhgH__9~VhM( z2OBt4FT)뾃P*$ a )럋591hVJjYZu,)yh@V*j^Z,)UD)j 91%b蒯)PhX^ D)591hYViZYuh)hXViZYud)j Yc^ t)t)jhY;tS|)D)j 91mĮ(9&Y=v Ph;Yj%PhNY<]XZ=))+X) @)@))=91))x)E t==)t)=)u &U 4)u%EhY2sX1E1̃=|)t1@)jj|dZYHth=& jkdYX=X)thU& jTdXZhwX jFd]Y[1ۃ}=T)uPPEXZ PEX}u6hYFYXE tKEPjW6QOy6hYdXZ6EujUEY9ËM}Qg ZU܉(9}uMXDH)t؍e[^_]UWVSu1ɉpE 0w)Ph&Pf uH~>NE X&&XZ^)_)`)}u >&x;&1ƅhB&u u4ǃ zI`Ntu&At/CcG6$y WBh l_ͨ)̨)w˨)ka)@&Z`)Nʨ)@& 6ɨ)*_)Ȩ)Pjhjjj j591;Ĩ) 6Pjhjjj j591;) 591h^)_[t9ƀ )xCt!ƀ )l\m "uƀ )Ct_L1>&%=&>&`;&@&ƅ>&@&@&=&=a)uu =Ȩ)Wjmk^G=_):=^)-=a)uu =Ȩ)tEjL&Y=a)t=Ȩ)=Ȩ)t Dž PPtVSE PE)P?!薳Džuh`z hPV! @u h6t*HkttWPbXZuh`z h GSSYXuV%Z@u h`z hSYuh`z hjZVZuh`z h)j@ uh=h`z h*WSй%1󫍅PhYS\Auh*Sq_XuzkhQtS\ZYuhhDz hqPƍH_v󤍅PhiS' @uhdYSrjJViZ thth4z hihZVlƹ󥍅Phui S_'@uhhUjm(Zt h jh7 hШ)ohШ) UhC&h)$h)RhM h)'hM h)&h)` h)nXUh`D&h)h)hxW h)hU h)h) h)XUh`F&h@)|hF&hH)mh@)hH)h1] h`)f hW hP)Fh] hX)Sh`)hP)hhX)UVS8ujh)&[Zt\bjjoÃt hj,O'y hYhZy h/mXjhwTZYu[jj5*hAK* u=jhSY[ujh#hFPhhQj :jURP` @t-Et PhJXZjhwqSZYtj dXhaj SXj jh#f hJu V- t1ftsuG&# )Phw|CYX95&t hfCZjj hw )Bjjjj j jjjhw B0jjjjho Ajjh4p AEEEE jjjjjjjj j j jjjuVI8jVj1EEEEEEjuVjyWjVjoW$jj~jwIEE EjjEPEPjEP貉$@u _1ۃ8É)G&t*H G&vHE G&Ӊָe[^]UWVS]} DžhDžT1L11PXDžD hWS* u~fFt/RkDžPgS$Ď 591ZDYu591hXu918#t591?_Zu[ j dR@P d:u&hRP_NZYPu7uCQ\u-Q\tً\w_G PRhP;Hƒ uPhjjjPXTK6hPGǃ tPh`6DZYjWYXT8t WhMj hWS;j/S$tXSHZPP1ɉrQ19rPR9rS)PCrjPÃh)hzd@S9 SX)=)NjjjjXTPǃLÅshV6LZYt"hV%LZYthLVLY^uPsZ^ZuC Ou3hVKZYu%CN\u shkVhPEƒ KCjjHVs XTO Lj\P@^_1u?hji P\PYZYu \\VF9|1n\PhedAS7 @uS[ u hX P=GhWEYZut)XhfWE_Zu 1ɉ t):h,hChI)Q=91hWeEYZu @)heWHEYZu @)WheDjj591: 591h{Phjhj91$|))=91WQZu&DPuWh@=W<_+=91=H)j:W ZYuj/W ZYth ?u hj D)&=LH&=)u=))p1󫍅l`)AuVE)Ћ)I}DžMDž>=@)qh5r@`)jxlP5`)phG@uph"b)@th4K7 jr HM1󫍝`4󫋅 =)u )tJ) )PH[^@=)))s=)u;))}hR_ @uhGP1ZY@uhZ=)h0V;à uVh"j>Ph0PW ujhh@)jPSyh@)hp!Pn^_@tڋ%=`uh@)h1=)jjh@)- yh@)hjPY[uh@)hjh@)hd#? E)t#@)VRW@^ZtN xRjVhd#? u ƃrVW<@YZuSh@)hj=P)u@P)`PP5P)h@)ʳ@uh@)h 1=P)L)=)u) hYtc uh@)hhfSd?ZYu&D)uhfS@?^_t t Dž@)?=D)th_ h"S?Y[thh@)hl Džt')RP5)5)))5)=)19|Y<@ t )SQRPI  5)=)19| ht5 ))9sSQRPh5jtd) )ˋ)%)RP) @u+5)5)hxj?'0Pm{_Z@uhA[^  ^L.8LtkXDX )뵃`uvhu[i`uPHxhfXfu(TPW<tjFPhj}tVS׶hmj}(DžuP_t8=+tj jhzFWh=+t j jh^FWhjF8j jhmzF tVWhjFWh jF hhbh;Gjjhhbh;G }ujj jj jj jj jjx jj o jj胳@u hjjjhZY@uo8th(=j X}uj_j j)ZY@u08t+h>膅Y2 u hTtZ W賐XVSh{T 0DjjIJƒ BuSPh jUWVSDu]  '+h SVz v~j cStITtbLu+뼃dw$ ++++z+k+\+M+>&)ƍ蓮+=+tjjhQW+ >Ejjj"k+jURh@hPp @u hƃY=+y h7jm;u=+3 @ WZ) (    mt /  =+t1ɉڸ舾1ɉMhj6E؉Ehj6E܉Ehj6EȉEhj|6EĉE hjg6EEhjU6ljEhjD6EMU ʃ} ʃ} у} хuu hE1҉+8gtj5+t_X1ɉMEEFEȅ"CEċS:-0BRU@ZH3U$ +"0V&+0V&+0V&+0V& +uj+[+L+A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸ECEu/CEċSEP1ɸX+uCEċCU衳EuKMċs t^P+hw$ب ]1RX+F`+:h+ .p+@"x++ H+  + + +t# @+ D+@+D+t1+jjV1C R+u#EPM̉U譼EXUUuEPM̉URe_^uChs ZY=+uhhhRg] +CHw)=+uhhhRg+ 1+SEP1ɸX]ċu+Muh5u>au uh0"+Eġ+}tuȉuthNj@Mu}t }EEă=+uMEȉE10E18+1atctguIE+E+++@+++++@+ ++U9sHxt)Ј+t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ ++tMutHXSVh+螫 =+t =+t+f蕱+tE}tHpVWSL =+t =+tsG+tE}tHpVWS =+t =+t+tE}tHpVWS谪 =+t =+t諰+tE}tHpVWSb =+t =+t]+ tE}tHpVWS =+t =+t+f+=+t!=+u=+tܰ+l=+Sh+5+( u( 87t 4PhXZ9~kPhY[]p 83u =+tH[ 8t+ + + +PSV 11ɉډe[^_]鮳We[^_]UWVS } 芣hPFZY…UhOWu Ut.at"t=4+914+뽺붡&])Åt>um4+t&heuS^_th(SZYCt/=4+u&4 +ujRKuEVh hp&]Vh*hp&Mj=D+u.D+h@Wu t@A3w$ z=D+uD+먃=D+uD+듃=D+uD+{=D+uD+c=D+zD+ G,+8@+)<+@+ =D+"D+@@+$+(+8+591V +X=D+D+=D+D+j=4+914+hPY[>0+/=D+FD+D+)&E)tH:Eu5=8+=,+t =(+=4+]=,+t =(+=4+txt4heuWYZ!h(WYZu/ heuWsYZ7h(W^YZ"hWI_Z,@JK EÀ5<+jj58+5@+5 +t5<+jj58+5@+5 +n;E5 +Sj 0Shj +E[ =0+mEjEPj? @u hVrEUuuhp"9[Jh`RP8ht S8YyE  1SQ%1RPhG1=0+t5Xh3SN_Zt#hS=ZYt苪ujVhVj VhGjUWVS u] 1hSVV tRtfu2h+ֿϡ&9td1ɉ`lPVF[ZjxPP)rZY%=`=@uxh?uxPh[^Dž`ddPhV" YZu,)~3ltXnuzh!VW du,׃Vt1PσwB0^&뾃cu3,,hp h9hp&j`hp h9hp&Sh!hp&~j5&9u,=,t 1薹x1&ppt8-u ƀxu t1L=,t 1:x1ʹpp8u;J5^&ƍxPV}b_Zti=,tSuO&8uCVj ^&Dhl$Ylhuha91th!vE@uVh!xu |n=,tX=,tO%= uu-jVXZy Vh "ŭWԎ^ Vh"έZYSX5,OUWVSu 6Khjg1ɉ \, 1h(Vuо ua`Gt+It2EtHa<$  ,먁% ,뜡91u\,`,z,k,591$K591PhWk911V ,91u\,1҉`,jjjh&h'/,jjjh&ch(^X|PPh>(hp&j&4 ,ut >tt1Kj5, h& t h)j5d,UWVSP}1ɉMM1h.*u W蛼 t3gt!utGu.91E91;u91E85&9t3SZt@E%UMM@uSh5*j 1}1ɉM}t E1E1}t6hzEPYZt"8tu hG*jӤGDʋE 46BZ@u6hjӤhgb薎Y@ttEPWt_Z@uhn*}tu*Y@u hx*j荤tu^Z@uh8FtVRPvhjVh#XuQjh*SS菢Shj%UWVS$uE E1҉U0FYth1#1ɉMMMMEPj[_@u h&1j̣jҋZth:111E؉EhL1uVi C3$ _Uq591T,뙺 %591$.PwZYU91@uGYPS]'}_&1}591E591-PPS 'Ã591-P%YZPCP&XZK,}uZ591=EX_&} E'],RFK&)ƋMԍ}uE}uEEt1Hvhi18=,u9UЉEh1XEԋU =,tHvh1 $ jSRV jjRVs2U3,YUu#BU!@uh1QYEC SZ,tCW&X'VYuVSV8%Í@Pd!C u:{ts s _Zt/h27jY C^u=,t"P"=,ts/!YSVZh82N?2U%XtdCU܅t#tuhU2?V:@0ًFttۃt֋@0UVYUu2h{2XZN Vj2F3)s)6)v)CF C FC{uFCV:Xt\W%%YtPEMZUuRWhq/h eSR#Í@PC uLWh17{t'Svs s =,t6s#jCYu=,tPV ZK Sj2CjUvs*GWCP"Spuh2XE؉E ]e[^_]&IfBщ؍e[^_]e[^_] Nh2h"+ "E܍e[^_]h2j蝝e[^_]UWVS 1E%V1E111E1҉Uh[u uZ UtZn`~3a w+$ ƒwt,=91볻1E1=EE눡&E؋EM)ȉEEt Ht[ }~t*Ut#}~ t[ׄUt[˅t&uz[a&EE;!Ea&`t&u[r&EEDEBs&6}t&u[`&EE$E`& 1ɉMM1ۉUuS(jW輁ƃUy jW訁XZUy WhjtuC 1ɋ}9}uAVEY1E9C tUPURPRh\%=u uS/XZG벃}^E M؍}1}܋;j=WZYu h5\j19s x+u@UU؍HM3*NjH XUt 3hC\ujuWW  8u 3hQ\O VEЁg juW询W W VEЁg E܃XM9M/~2U菞@ _ǃUt 2he\GA EM9MuVEYs uSXZGE9}"C t3ht\jV艀18V|1e[^_]ÍL$qUWVSQ@Y1ɉP.1󫺬.1,0<48hpS@[ ,H01$` 0%0591f.1Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @f.F누0f.%1҉Lj LP591ƉPp 8u!918tL8u ;Phopj LP591S ~91:t L:t591h"o4.z 0@nthBoj 0jh& 1ɉ Dy& Hy&Ly&^_91< 0j LP591SPy&91 :t L9t Rhboj0@=Rhvo914 0 0LP591 91_Z8tL:t Pv)ݝ ۥ݅ tjPho!v591hoAٽFfF fD٭D߽ ٭F $Dy&Hy&߭ H٭D۝ ٭F Ly&xy591ho uhoJLy&^ 0Sthpj LP5919Q8 x918tL8591h"p&,%0 0 0 0 915&tDFu h>p1B卅(R$R RRRRR RRRRRRRRPh|QƃH1Ʌ~ )10hY1X.@9u919~X.PhhGXZj 0t1DžtDžxDž|Dž:h0Vj591tPXPhgp0P0rJBL0RQ 0@Yj LP591NXy& x91:t L:t591hp=hhp0% - 0k0%0% 0CLP591.XZL8u591h28LP591._XL8u591hp&@)Ht0j.SY^u SGZ)؉@?wPSPC@Ƅ t@ &t &fBۍ1V@KjKPV+@SVVdP $TVh qj Hd`hSVjSgsX0t=Xy& hqCXt1DžtDžxDž|Dž:h0VjStP7Phjm0BtÉD.ru hLql0Jr rrsH0 y h7<0@t"5L0hP0P t h_q<1DžDžDž:PtPj<tPEPshP0Sp y hbsPhP0S yhnsuSp_PXy&tf9} hzs^jPShh5H0yhs$jShh5H0yIhsj= ~ hzs1[DždjdPhh5H0袤DžjSj$j)5H0}y hsAYjSj%j)5H0Yy hsAZ0  r)r  rrXy&PR(Ph tP0詬Ph'tl0蔬P88t軦h^gjh^gjx1..@<ׯffffUSÛ4 P u=ƃP &tZNtA)֝v[]ËP PDP UWVS )4 EuFN 910u$Xx}xWx U 9s?uɉtE艘\k uXk u쉰Tk Eƀ`k  [^_]ÉtE艘\k uXk u쉰Tk 1 [^_]UVS_3 u4$sD$4$hst$, $r[^]USt3 t[]E D$D$ED$ D$D$ $t} tǃ []Ë$Ë$Ë$Ë<$Ë4$Ë $U.ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgfsckfsck_ffsgptifconfigmknodmount_cd9660mount_ffsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsswapctlgzipgzcatgunzipchrootcgdconfigwsconsctlping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %stotalcannot seek temp filecannot read temp fileinvalid addressline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark charactered.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicmbr_bootselmbr_extInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedasyncgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizefragment sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpare%d %d START disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered newNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]releasepreventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParameters%s, %sError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENALIAS, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexINTSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGTERMhcxndaNR@8MOUSE_STARTMOUSE_ENDcmsobc|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done_(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-c%s %s %slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshiftquotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] /bin/sh~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberhddvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratedialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftprawhdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymappasswordresetvideosunsummodulesbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... m:pusage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: not found%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil done; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %struePScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalchdirletfalsefdflagsgetoptsfcinputrcprintfsetvartestulimitumaskunaliaswordexpPPID20220122 BUILD:20260206082425Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrqfsck_%s-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinv7fs** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]%d%sGPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressvltimeinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEinetnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedmetricSIOCSIFMETRICmtuSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:N%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics 2easector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkexpirehopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesSO_RERRORassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen%s/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20251206NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetformidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directoryopen: %s%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-ifailed to read passphrasepflag set inappropriately? (echo)%s's passphrase%s:failed to generate Argon2id key, error code %dfailed to generate PKCS#5 PBKDF2 keyusage: %s [-enpv] [-V vmeth] cgd dev [paramsfile] %s -C [-enpv] [-f configfile] %s -G [-enpSv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] paramsfile %s -g [-Sv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] alg [keylen] %s -l [-v[v]] [cgd] %s -s [-nv] [-i ivmeth] cgd dev alg [keylen] %s -t paramsfile %s -T [-f configfile] %s -U [-nv] [-f configfile] %s -u [-nv] cgd with alg %s keylen %zu blocksize %zu ivmethod %s can't open cgd "%s", "%s"%s (%s): clearing opendisk_werror(%s, %s, %zu) called. getfsspecname failed: %sfailed to parse key lengthfailed to read key from stdin/etc/cgd/cgd.confcould not open config file "%s"\\#action failed on "%s" line %luencblkno8encblkno1CGDIOCGETnot in usedev %llu,%llu keylen %d blksize %zd opendir: %srcgdbad name %sgetkey("%s", %p, %zu) called command failedcommand output too shortcommand failed with status %dunrecognised keygen method %d in getkey()failed to derive HKDF-HMAC-SHA256 subkeyunrecognised shared key derivation method %dinvalid parameters file "%s"nbits <= INT_MAX - 7/usr/src/sbin/cgdconfig/cgdconfig.cret == (int)nb64flags == CONFIG_FLAGS_FROMALLwrong number of argsdevice %s already in useparams invalidcan't read disklabel areapread: incomplete blockre-enter devicecan't read mbr areacan't read gpt areaunimplemented verification methodverification failed permanentlyverification failed, please reenter passphraseCrypto self-test failedCan't disable coresCan't lock memoryCGP:STUV:b:ef:gi:k:lno:sptuv-P is only for use with -g/-G action-P only makes sense with -S flag-S is only for use with -g/-G actionFailed to parse key lengthno keygen in parameters file "%s"Failed to generate defaults for keygeninvalid parameters generatedcan't preserve randomly generated keyinvalid old parameters file "%s"old filenew filecan't generate new parameters fileundefined actionout of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundout of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()foo%s line %d: %s at '%s'yacc stack overflow%s: failed to parse parameters file tmplen == PRF_BLOCKLEN/usr/src/sbin/cgdconfig/pkcs5_pbkdf2.cpkcs5_pbkdf2: calibrating iterations...%s %s; %*sshared "%s" \ %*salgorithm %s \ could not determine key length for unknown algorithm "%s"re-enterparams_setverify_method: unrecognized verify method "%s"keygen argon2id must provide `iterations'keygen argon2id must provide `memory'keygen argon2id must provide `parallelism'keygen argon2id must provide `version'keygen argon2id does not need a `cmd'keygen argon2id does not need a `key'keygen argon2id must provide a saltkeygen pkcs5_pbkdf2 must provide `iterations'keygen pkcs5_pbkdf2 does not need a `key'keygen pkcs5_pbkdf2 must provide a saltkeygen pkcs5_pbkdf2 does not need a `cmd'keygen pkcs5_pbkdf2/sha1 must provide `iterations'keygen pkcs5_pbkdf2/sha1 does not need a `key'keygen pkcs5_pbkdf2/sha1 must provide a saltkeygen pkcs5_pbkdf2/sha1 does not need a `cmd'keygen storedkey does not need `iterations'keygen storedkey must provide a keykeygen storedkey does not need `salt'keygen storedkey does not need `cmd'keygen [u]randomkey does not need `iterations'keygen [u]randomkey does not need `key'keygen [u]randomkey does not need `salt'keygen [u]randomkey does not need `cmd'keygen [u]randomkey makes no sense sharedkeygen shell_cmd does not need `iterations'keygen shell_cmd does not need `key'keygen shell_cmd does not need `salt'keygen shell_cmd must provide a `cmd'unspecified algorithmunknown algorithm "%s"(warning)unspecified IV methodunknown IV method "%s" (warning)unspecified key lengthcould not calibrate pkcs5_pbkdf2can't generate random bits for storedkey(u)randomkey keygen cannot be sharedstoredkey does not make sense as sharedkeygen already shareduuidgenuuid_to_string: %ukeygen not sharedargon2idpkcs5_pbkdf2/sha1urandomkeyshell_cmdunrecognized key generation method "%s"hkdf-hmac-sha256unrecognized shared key derivation algorithm "%s"/etc/cgdfailed to open params file "%s"keygen storedkey urandomkey; argon2id { iterationsparallelism}; pkcs5_pbkdf2 { pkcs5_pbkdf2/sha1 { keygen_fput: %d not a valid methodiv-methodkeylengthverify_methodunsupported verify_method (%d)could not open outfile "%s"encblknobits_decode: mangled base64 stream %sbits_decode: encoded bits claim to be longer than they are (nbits=%zu, stream len=%zu bytes)/dev/randomcalibrating argon2id parameters... failed to calculate Argon2 hash, error code %d failed to calibrate hash parameters: broken monotonic clock? failed to calibrate hash parametersargon2dargon2iArgon2idArgon2iArgon2dUnknown error codeThe password does not match the supplied hashSome of encoded parameters are too long or too shortThreading failureDecoding failedEncoding failedMissing argumentsToo many threadsNot enough threadsOutput pointer mismatchThere is no such version of Argon2Argon2_Context context is NULLThe allocate memory callback is NULLThe free memory callback is NULLMemory allocation errorAssociated data pointer is NULL, but ad length is not 0Secret pointer is NULL, but secret length is not 0Salt pointer is NULL, but salt length is not 0Password pointer is NULL, but password length is not 0Too many lanesToo few lanesMemory cost is too largeMemory cost is too smallTime cost is too largeTime cost is too smallSecret is too longSecret is too shortAssociated data is too longAssociated data is too shortSalt is too longSalt is too shortPassword is too longPassword is too shortOutput is too longOutput is too shortOutput pointer is NULL$v=$m=,t=,p=WSDISPLAYIO_GTYPEWSDISPLAYIO_SFONTWSDISPLAYIO_SBORDERWSDISPLAYIO_PARAM_BACKLIGHTWSDISPLAYIO_PARAM_BRIGHTNESSWSDISPLAYIO_PARAM_CONTRASTWSDISPLAYIO_SSPLASHWSDISPLAYIO_SPROGRESSWSDISPLAYIO_GMSGATTRSWSDISPLAYIO_SMSGATTRSWSDISPLAYIO_DSSCROLLborderfontbacklightbrightnesscontrastscroll.fastlinesscroll.slowlinesedidmsg.default.attrsmsg.default.bgmsg.default.fgmsg.kernel.attrsmsg.kernel.bgmsg.kernel.fgsplash.enablesplash.progressWSKBDIO_GTYPEWSKBDIO_GETBELLWSKBDIO_GETDEFAULTBELLWSKBDIO_GETMAPWSKBDIO_GETKEYREPEATWSKBDIO_GETLEDSWSKBDIO_GETENCODINGWSKBDIO_GETSCROLLWSKBDIO_SETMODEWSKBDIO_SETBELLWSKBDIO_SETDEFAULTBELLWSKBDIO_SETMAP +> WSKBDIO_SETKEYREPEATWSKBDIO_SETDEFAULTKEYREPEATWSKBDIO_SETLEDSWSKBDIO_SETENCODINGWSKBDIO_SETKEYCLICKWSKBDIO_SETSCROLLscrolling is not supported by this kernelbell.pitchbell.periodbell.volumebell.pitch.defaultbell.period.defaultbell.volume.defaultrepeat.del1repeat.delnrepeat.del1.defaultrepeat.deln.defaultledstatekeyclickscroll.modescroll.modifierunknown_%dBackSpaceLinefeedEscapeexclamquotedblnumbersigndollarampersandapostropheparenleftparenrightasteriskcommasemicolonequalgreaterquestionbracketleftbracketrightasciicircumunderscorebraceleftbracerightasciitildenobreakspaceexclamdownsterlingcurrencyyenbrokenbarsectioncopyrightordfeminineguillemotleftnotsignhyphenregisteredmacrondegreeplusminustwosuperiorthreesuperiormuparagraphperiodcenteredonesuperiormasculineguillemotrightonequarteronehalfthreequartersquestiondownAgraveAacuteAcircumflexAtildeAdiaeresisAringAECcedillaEgraveEacuteEcircumflexEdiaeresisIgraveIacuteIcircumflexIdiaeresisETHNtildeOgraveOacuteOcircumflexOtildeOdiaeresismultiplyOobliqueUgraveUacuteUcircumflexUdiaeresisYacuteTHORNssharpagraveaacuteacircumflexatildeadiaeresisaeccedillaegraveecircumflexediaeresisigraveiacuteicircumflexidiaeresisethntildeograveoacuteocircumflexotildeodiaeresisdivisionoslashugraveuacuteucircumflexudiaeresisyacutethornydiaeresisAbreveabreveAogonekaogonekCacutecacuteCcaronccaronDcarondcaronDstrokedstrokeEogonekeogonekEcaronecaronLacutelacuteLcaronlcaronLstrokelstrokeNacutenacuteNcaronncaronOdoubleacuteodoubleacuteRacuteracuteRcaronrcaronSacutesacuteScaronscaronTcedillatcedillaTcarontcaronUaboveringuaboveringUdoubleacuteudoubleacuteZacutezacuteZabovedotzabovedotZcaronzcarondead_gravedead_acutedead_circumflexdead_tildedead_brevedead_diaeresisdead_aboveringdead_carondead_dotaccentdead_hungarumlautdead_ogonekdead_slashdead_cedilladead_semidead_colongr_Atgr_Etgr_Htgr_Itgr_Otgr_Ytgr_Vtgr_itdgr_Agr_Bgr_Ggr_Dgr_Egr_Zgr_Hgr_Ugr_Igr_Kgr_Lgr_Mgr_Ngr_Jgr_Ogr_Pgr_Rgr_Sgr_Tgr_Ygr_Fgr_Xgr_Cgr_Vgr_Idgr_Ydgr_atgr_etgr_htgr_itgr_ytdgr_agr_bgr_ggr_dgr_egr_zgr_hgr_ugr_igr_kgr_lgr_mgr_ngr_jgr_ogr_pgr_rgr_teliko_sgr_sgr_tgr_ygr_fgr_xgr_cgr_vgr_idgr_ydgr_otgr_ytgr_vtShift_LShift_RControl_LControl_RCaps_LockShift_LockAlt_LAlt_RMulti_keyMode_switchNum_LockHold_ScreenCmdCmd1Cmd2Meta_LMeta_RZenkaku_HankakuHiragana_KatakanaHenkan_ModeHenkanMuhenkanKP_F1KP_F2KP_F3KP_F4KP_HomeKP_LeftKP_UpKP_RightKP_DownKP_PriorKP_NextKP_EndKP_BeginKP_InsertKP_DeleteKP_SpaceKP_TabKP_EnterKP_EqualKP_NumbersignKP_MultiplyKP_AddKP_SeparatorKP_SubtractKP_DecimalKP_DivideKP_0KP_1KP_2KP_3KP_4KP_5KP_6KP_7KP_8KP_9f3f4f5f6f7f9f10f11f12f13f14f15f16f17f18f19f20F5F6F7F9F10F11F12F13F14F15F16F17F18F19F20PowerHelpExecuteFindSelectAgainPropsUndoFrontCopyOpenPasteCutStopMenuPausePrint_ScreenCmd_Screen0Cmd_Screen1Cmd_Screen2Cmd_Screen3Cmd_Screen4Cmd_Screen5Cmd_Screen6Cmd_Screen7Cmd_Screen8Cmd_Screen9Cmd_DebuggerCmd_ResetEmulCmd_ResetCloseCmd_BacklightOnCmd_BacklightOffCmd_BacklightToggleCmd_BrightnessUpCmd_BrightnessDownCmd_BrightnessRotateCmd_ContrastUpCmd_ContrastDownCmd_ContrastRotateCmd_ScrollFastUpCmd_ScrollFastDownCmd_ScrollSlowUpCmd_ScrollSlowDownCmd_VolumeUpCmd_VolumeDownCmd_VolumeTogglevoidSymbolL5_GbreveL5_IdotaboveL5_ScedillaL5_gbreveL5_idotlessL5_scedillaparse: %s [%.*s]keysym %s not found%d: keycode too largekeysym expected%s: not a keysym%c: illegal character in input%03o: illegal character in inputcould not list calibration samples%s%d,%d,%d,%dWSMOUSEIO_GCALIBCOORDS%s: invalid calibration dataWSMOUSEIO_SCALIBCOORDSWSMOUSEIO_GTYPEWSMOUSEIO_GETREPEATWSMOUSEIO_SRESWSMOUSEIO_SRATEWSMOUSEIO_SETREPEATresolutionsampleratescroll.reversescroll.distance.xscroll.distance.ycalibration.minxcalibration.minycalibration.maxxcalibration.maxycalibration.samplesrepeat.buttonsrepeat.delay.firstrepeat.delay.decrementrepeat.delay.minimuminternal error: field_by_value: not foundkeycode %u =internal error: pr_field: no format %d%s: not a valid number list%ld: number out of range%s: not a valid encoding%s: not a valid variant%s: not a valid color%s: not a valid attributeinternal error: rd_field: no format %dhilitblinkunderlineblackbrownbluemagentacyanwhitenodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdepcolemakukczbeponeouadec-pm-monodec-pm-colordec-cfbdec-xcfbdec-mfbdec-sfbvga-isavga-pcidec-tga-pcidec-sfb+generic-pcinext-monodec-pxdec-pxgdec-txgeneric-hpcarm-vidcdec-spxdec-gpxdec-lcgdec-vax-monosparcbook-p9100egadreamcast-pvrhp-gatorhp-topcathp-renaissancehp-catseyehp-davincihp-tigerhp-hyperionamiga-ccsun24sgi-newportsgi-gr2suncg12suncg14suntcxsunffbhp-stihd44780vesaxilinxsgi-lightgenfbsgi-o2pxafujitsu-ag10displaylinksun-xvr1000omron-lunagrfvncapple-valkyrieimx-ipuvideocore4omap3530windermereclps-711xallwinnerssb-mgxamlogc-mesonnvidia-tegraplatinumprimcell-pl11xssdfbvideocore6dec-tcps2usblogitech-busms-inporttouch-panelarchimedeshildec-maxinemaplebluetoothlk201pc-xtpc-athpc-kbdhpc-btnriscpcadbsunsun-type5sgimatrix-keypad%s: %s Usage: %s [-kmd] [-f file] [-n] name ... -or- %s [-kmd] [-f file] [-n] -w name=value ... -or- %s [-kmd] [-f file] [-n] -w name+=value ... -or- %s [-kmd] [-f file] [-n] -a /dev/wskbd/dev/wsmouse/dev/ttyE0adf:kmnwonly one of -k, -d or -m may be givenexcess arguments after -aonly one of -a or -w may be given"%s" not shown with -a; use "%s %s" to view.'=' not found%s: read only%s: can only be set%s: write only%s: no kernel support%dx%dx%dIVMVendor: [%s] %s Product: [%04X] %s Serial number: %s Manufactured %d Week %d EDID Version %d.%d EDID Comment: %s Video Input: %x Digital (DFP 1.x compatible) Analog -0.7, 0.3V -0.714, 0.286V -1.0, 0.4V -0.7, 0.0V Blank-to-black setup Separate syncs Composite sync Sync on green Serration vsyncGamma: %d.%02d Max Size: %d cm x %d cm Features: %x DPMS standby DPMS suspend DPMS active-off Monochrome RGB Multicolor Undefined monitor type Standard color space Preferred timing Default GTF supportedChroma Info: Red X: 0.%03d Red Y: 0.%03d Grn X: 0.%03d Grn Y: 0.%03d Blu X: 0.%03d Blu Y: 0.%03d Wht X: 0.%03d Wht Y: 0.%03d Horizontal: %d - %d kHz Vertical: %d - %d Hz Max Dot Clock: %d MHz GTF2 hfreq: %d GTF2 C: %d GTF2 M: %d GTF2 J: %d GTF2 K: %d Video modes: %dx%d @ %dHz (%d %d %d %d %d %d %d %s%sH %s%sV) Preferred mode: %dx%d @ %dHz Number of extension blocks: %d %08xDELUltrascan 14XEVSC17GS17PSAACAcerViewAPPApple ComputerAST ResearchCPLCompalCPQCompaqCTXDellDPCDeltaDWEDaewooEIZEIZOELSAEPIEnvisionFCMFunaiFUJFujitsuGSMLG ElectronicsGWYGateway 2000HEIHyundaiHITHitachiHSLHansolHTCHitachi/NisseiHWPHPIBMFujitsu ICLIiyamaKDSKorea Data SystemsMEIPanasonicMELMitsubishi ElectronicsNANNanaoNECNOKNokia DataPHLPhilipsRELRelisysSAMSGISNYSonySRCShamrockSUNSun MicrosystemsTatungToshibaTSBViewSonicZCMZenith1280x1024x751024x768x751024x768x701024x768x601024x768x87i832x624x74800x600x75800x600x72800x600x60800x600x56640x480x75640x480x72640x480x67640x480x60720x400x87720x400x70640x350x85640x400x85720x400x85640x480x85800x600x851024x768x851024x768x891152x864x751280x768x751280x960x601280x960x851280x1024x601280x1024x701280x1024x851600x1200x601600x1200x651600x1200x701600x1200x751600x1200x851680x1050x601792x1344x601792x1344x751856x1392x601856x1392x751920x1440x601920x1440x751152x768x541400x1050x601400x1050x741152x900x661152x900x76320x175x85320x200x85360x200x70360x200x85360x200x87320x240x60320x240x72320x240x75320x240x85400x300x56400x300x60400x300x72400x300x75400x300x85512x384x87i512x384x60512x384x70512x384x75512x384x85512x384x89576x432x75640x384x75640x512x60640x512x70640x512x75640x512x85800x600x65800x600x70840x525x60896x672x60896x672x75928x696x60928x696x75960x720x60960x720x75416x312x74576x384x54700x525x60700x525x74576x450x66576x450x76-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype truncated no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedIPv6 addressIPv4 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signleft-parenthesisright-parenthesisplus-signhyphen-minusfull-stoptwothreefourfiveseveneightless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflex-accentlow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaymondaymotuesdaytueswednesdaywedneswedswethursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselectmanual10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.NAME=sysctl hw.disknames failed/rdk/rno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format stringsysvv71kv8otherhpfshfsraidframejfs2minixfs3vmwresv%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%s^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$acosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llx%llirpn == pn!((*cp) == '\0')?xml !DOCTYPE plist