08Pȝi'&<  'ȝi:P''`';. ;.ȝi'&P@@<@T 08Pȝi'&<  'ȝi:P''`';. ;.ȝi'&P@@<@TU ȝi`';.00yAȝiȝiȝiQ$f ȝiȝiȝiRAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝi@AȝiȝiȝiAAȝiȝiȝiBmK $ȝiȝiȝiX`hpx$ȝiȝiȝihpxS$DȝiȝiȝiP$ȝiȝiȝi (08@HPXQ$ȝiȝiȝi`hpxJAȝiȝiȝiDCȝiȝiȝiEAȝiȝiȝiFAȝiȝiȝi1mȝiȝiȝi\$ȝiȝiȝi$ȝiȝiȝi$>ȝiȝiȝi $ȝiȝiȝi$sȝiȝiȝi$ȝiȝiȝiAȝiȝiȝim ȝiȝiȝi ($ȝiȝiȝi0 $ȝiȝiȝi8AȝiȝiȝiGAȝiȝiȝiHAȝiȝiȝi.Aȝiȝiȝi/$QȝiȝiȝiPX`hpx$ȝiȝiȝiI $ȝiȝiȝi$ȝiȝiȝi ($ȝiȝiȝiN$ȝiȝiȝiO$ȝiȝiȝi$ȝiȝiȝiAȝiȝiȝi0Aȝiȝiȝi2Aȝiȝiȝi3Aȝiȝiȝi4Aȝiȝiȝi5Aȝiȝiȝi6Qyy}u\Q56 L/6zP> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4$4 (@@!!#,,@t ,,#,,NetBSDAPaXUSR&ffffUVSʯ' ,9s 9r[^]UWVSuÚ']P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*trE9ǍvuUWVS'E@@9s{*q;9r[^_]UWVSé'E u @-M \27ME @E @,t/tu,9s 9rEt E$,P$ ,9s 9rt!$蹔ED$E D$E @$ r$@,PMD$ @D$ D$$1ɉL$dQ$蘡[$SWD'5u1ƃ5$tЃt`$l_[SW'4uYƃ4t|$`<$kt(?t<$ktЃ_[UWVSh!h!h, @#%1t:PYxOvh,j XZ3h~$h,˜ h,j ƯjeUEU MsMU HE]DpUVS1ۋ%%tVPgZYu %%C܍e[^]US|APh!h,1h,h!" &% CtsPhׁ!h,j诎UWVSE tuhށ!辫URhc@5-覍 t5-h!jhu俞"5"M"5"E躞"5"WVSQRP5-h!荔E t"5"RPh/!h u5-h=!R1e[^_]U5-IXUjhc 5-֌ t5-hV!jg1USRj EPS xU:t Shd!jg]UPEU Ph}! JtPh!WEEEPhc5-; t5-h!jEg1UWVSSuE H1ۃv>PW ZYtC%%uދ%%Eh!WZY1tFEEPhc5-詋 t5-h!jf1e[^_]US u Sh΂!jbf]UVS1&%tSPZZYtFSh!j,f&%e[^]UWVS ]u} Sh}! } ~Sh!1}{EFE} t!v!z1UWVS`] u~ uh!Uȹ1Rhc@5-E 5-h!jbP-DPEU Eu>M9Mt66EE1EEEK>tt,uh!U1}}}}}E뺉t9Wuh!jbU9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E4Š&%5-hă!謍 "}t}uuu1ۉ]EuM9~VQuh؃!jak]lSrEYu h!j`1}E1҉Uuĉu܋UUMM]]}}Ph c5- u EX@1}Wu {5-h!j`EuPE4Š&%h#!CE rh+!^ElU9U|`-h`-h]#%XZCtCPhޑ#_Xj '^CtCPCPh@! CtC"PSha!Ӌ Cts؋C4Š&%h!賋 C$Ph!蚋ZYuyXE\1e[^_]UE-]UE-]Uh!j^Uh-!j^UhD!j^UhZ!j^UE E EE]͖Uhjjjuho!c--Uhjjjuh!c--Uhjjjuh!|c --Uhjjjuh!Qc0-4-Ujjjjuh!)c -$-Ujjjjuh#c----(-u(Ujjjjuh!b--(-u(Ujjjjuh̆!b--Ujjjjuh݆!jb0@,u jUWVSu-1--1->W3XuWh!j=S8]Y_u Sh!j\xxuSh(!]hjjh&%EPsuu뺋(-#H t uhB! P(-WPZ_(-t/#=t (-(-tt hr!X(-ƒtuh!<t?%t4!t$t (- (-h!j[٢8-e[^_]UVS-uX------;--rgj------X=5-u-E -)EU}t 13A}uke[^]Ë-- t --Uh'%h]#jZUUh'%h]#jZUUSË@4URs(PZYts$h]#jZS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u蹙8uK ]USQ/9s SkZSPEPnlƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h!jYC4WPs(Xe[^_]UWVS]uVh-jd9C4uu s(P(8jVjB9$8؍e[^_]UWVS-}t -- --EUEUEU}uH*- t?11ҋ}9׋u} ytEU -$-E -$- t(jRP5--P Bu@u 5-h!IuSh-Ɖ 19|4 u5-h3!%8t5-h]#j[X11 -E $- tKEx- |-5-5-QP-p-t-P-T-1ɉ - $-5x-=|-9}u;9uu6E9-u E9-tX-\-|P-T-lX-\-9}u9utT-t%=-u-5-hE!;XZ-t5-hi!j W)u}--+EUEU--=- -9}Er }ME EtUR-)P5-+3 --- -- t8X-\-P-T-SQRP* ujh-$j5 e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQ- -t/jh?"j4 - -tjh?"j4 jEPwi]eƉߋE׉pti-%-Ɖߡ-׋pt)ptZYt puDžp1t5\-5X-5T-5P-5L-5H-5D-5@-h!jd]SZ,S3$Sj3h-l- t7ƃ$ tݪ"QRPh#!jdSS$Sj3$`-d- t7ƃ$ tݪ"QRPh5-5-h- ;-C;-7벍e[^_]UWVSƉ׉ˡ<-҃Pj h5"WVRuVVShL#R|(e[^_]UWVStÉ׃=L-t%tPhЉ!h Vzh PVZv =p-ssVPh؉!{s$s ssssh!{0sxs1--tP蘶5-Z1҉-YX1---1U塨-t*Pe-ZtPL5-Z1-ZYueUjh( -h,Y2 yj----1-@=uUSUE ---M-Ћ] Ӊ)~-@[]Ã06w $ )%1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1-2--@ujjh-h-EthɎ!h]#=Y^----`-)--1-2--@ujjh-h-thɎ!h]#g=XZSjjh-4?e[^_]UWVSƉӀ:0B؍}01҉U")%]BuʀEt@9uS1Ythg!h]#|9XZe[^_]US--9--RPPZYu[By0[Ph"h,hh % 9-H-ua-tjtJj]-- -u -ųu١-P--M 1]UWVSSU-=-CE;U tM-119~149u1ɉs19~H -9E~@1Aˉt-X[^_]UVS5---19| t!-H<u -1[^]UWVSfEp E}u.h?"5 -?p_Z]tjEP_ Y^uD1Gh?"Rp^_FP-Zy }Ou PP x. E uhr!: -| zf% ,Ѓu-h!RxoZYuu h!6X넋-jEP [_bE --9-=}\SR NZYu[v0XPh"h,eh %I6-H--tjj-- -u -uΨuً-EH - -8lx #xtދ-PRRe yɍe[^_]U-1----5-cP1҉--H-Yu-tjtjUWVSP - t u h!5X 6ƅu  -8u@ -S5-Ë=-X9=-|^SYt= -tj jsPEcUjjjRV赮;EtGSZyh1e[^_]Ë `,Q`,y ;p,| tX,J X,UhX,PfXZUWVS u1ۉ߃= -tVI NyVt[XHF `=- -9^-؁}U|WQ9KZYU=-- -u-tjtj-u  -C1 mCE -9-؁}ULQM5-JZYMUuX s0UPh"h,obh %2-H-t -/t1 -- -u- u - KF @t.ur0TPh"h,ah!=2tt- -}-8= -t=-te[^_]UWVSu VE=- -E-E1ۉ- -X= -t5-11҉UuiEZUU-5-YUt(EEtBD-PPjAƒ u- -t C-tjtj -u -uݨuEVu9uuHtg}tIu -=-tEu~h,hя! -Y^=-u3B=-u -d -=-tJE  -uh,h!XZ -t!=-t9uuu$-Cu -19uu=-=-M  -= -t1ҍe[^_]UWVS];!uh*A"CPXZS h*A"P_ǃ u$o07RPSh%h,_h!Ju WYXyh;!u7WOZy4mo0QPSh%h,^h !4/WOUǃ=-uVh!h,^ -+E e[^_]UWVSu] }9tU= -t VP*VPtuZYy0n0TQPh"h,:^h$!.C1e[^_]UWVSQu VJ[= -tW1ۅtW;uRWNZuZW95-u= -t =-u BRUPu xËUF?륃= -tuX؍e[^_]UWVSPu]>!uh!FPY_V u P]ƒ u$m09PPVh%h,]h6!RuSRUǃ Uyl>!u7RIZy4gm0OPVh%h,\hN!.-RISǃ=-uWh!h,\ tE)؍X؍e[^_]UWVSW11 ,yh,HT^u,P,s= -  -9-؁}U|WQDZYUu[l0OPh"h,[h %K,-H--tj j = - - -u -uΨu١ -u -1ۉ߉ u- -0 - -u ,@t?k0S<[t<\t.RiZÅu!h# { uh!-[1C뵉) -= -9-Ё}UtVWzZYUu[>0l!Ph"h,R.h %-H-t-tj2\j 5 - - -u -uΨu١ -5 -lj -= -tj jRPe[^_]US -< u h! XH< u= -u$h3!XJ  -R t8u ӡ -PKXu1 -t=-u P6X9j -Yu(=0 Ph"h,-h %hK1҉-5-S5 ->ƒ -t+h'h -PRP5 -1 -R]UWVS -P -M -1ۀx%u}M8Huu -h‘![s9}n -P - -  -\P - -2<  -= -}  -U8u-ف}|WuZY= - - -O-tj7jm8uCH -B= -du f% ,1 -| u6/ - -9-؁}tVQZYuVn;0Ph"h,*h %6-H-j-U5 - - -u- - - -e[^_]UVSVu] 1 - u 1ۉ -U  -< Uu 1w8uA  - -JπwEi:1ɉj h -5 - v?:8"uh!1Zgu@ -늸e[^]UWVS 5 -] -= -}+ -; -a&M 9}y;M)9 ڋEE-}RUuZYUu]x90Ph"h,(h %@-H-t '-tjtj - - -U-uΨDϋ -M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW-}RUuZYU - - -u-t -M9u}EMELE B19uu)d9|T-ځ}tVu9ZY45 - - -u-_b -Cw}9|T-ځ}tVuZY5 - - -u- -؍e[^_]UWVS] Sװ^|= -tj jsPlCjPjup1ɉ E -}t9U3 9-ށ}V5 - _Zu[60Ph"h,g%h %-H-b-tjGJj5 - - -u -uΨuك= -tjj    -NjEpSP-  9~U-΁}V5 -c ZY5 - - -u-= -tjj S6  -Nj󤋅  ?u9Ћ)ȉË ؍x -9<t t tjPjumo-=}tV5 -= Y_5 - - -u-~+ uEthG!TZDžW= -tjj S  -Nj󤋅  -f u1e[^_]UWVS--H-1ۉ]1-+-9U-@-Pmuu PuƃU-PP[Z -3E-1SwYu' --tjtsj-t PۭFZPPjƃ t9]u -u -uuE-G-E  Euh!XE tu RRK x1e[^_]UWVS-E-E=L@,t =H@,uhb!NYm= -t -j- -E= -ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń= -t聺L@,-EL@,H@,-EH@, -u-tjt j`1e[^_]UWVS - -Ht7k X< u'ʣ -B0Z9tSe;Sx ZY1 --L@,-H@,e[^_]US -9 -}Pk -  -EuCk -  -u C -P -k  -ZY]d -j Ph - tPvPh"h,\h %5 - 1 - -1]U_Phr!h,j `,Q`,y ;p,| tX,J X,UhX,P XZUWVSօt%ˀ9u RPh!RPh! uqRPh! `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5 -x U2h!Ph!h,jUWVSf@8tXu1P6-1҉hW3Nà -8#)tSWV 룍e[^_]UWVS} 5 -fDž<^,1҉hPjà t[h,8Z,8u P,1ۉh-"Vf8uFt"SVW yF ,8#u5,1ɉjjPQ @u+8thϔ!jxhX$)+jWjfDž= -t fDž9DžjRj fDž9fDž9 -jSV @uF+8tJfu ft>(@ufDž= -u#K, -@tftfDžftR@u KfDžCe[^_]UWVSQ}u VW>[ZÅuzjjXZu h !j;s jEPWƃ ?tE8thh!j#*8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMumZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRP茮Y_}ËBt1Uj L$qUWSQ -- -w -ڞw ]]5 -5 -hՕ!j 5 -5 -h!j  5$ -5 -h!j 54 -50 -h!j  5 -5 -h3!j 5 -5 -hI!j E$h_!j EPP$hx!jy  =8 -t>u -1 ujS eY[_]aÃ=8 -tUE Puj UWVS}u _Ph!j3` -B9tT` -e[^_]UWVS$ ]5H -t(V$VU0Y^ugh! j0Pu ,0% yWp4$v0ZtWVP u WhΖ!Q5(0%jj0։( y0h!"jju ։ƃ C Wh V00%ƒ jjW40%‰ V80%h _Xuh!jw[^jh h R(<0%y RY߉R Zt-w1ҁbt#bt!tu h>!1 Њ Јt u hJ!jYu Vƅ/ t jZV8 jZVP djjP7& d -0tS SQPR(&,7kP5Ɖ4W$8t t10hb!j \9s1BFu h!j 1e[^_]UWVS\]ƍ}ZE580%(,a&V&048EPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xPC1RPuut5@,9ΉЋt}"Q_85@,VPh!/e[^_]UWVSP] AEH1RPuuƉMt1׋C|1׋ujQ1RP<t2uPhė!jE01RPuuV‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =D -EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$hz"5D -;Ãt#EUSjPVHt h!XS4X -$ -E1 - -E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuum9E E~1҉ t1EUWVRP89E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh!3REЃP2‹EЋ^_9t"ERQuuPhuFt 11E`E9sWu h!jeN1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRP FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RWB}EEPhE00%ƒyEqRPh!jxhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPh/!1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em} - - - -EЋU - -ẺEMEPh00%ǃ yNQWPh@!0FPh00%ǃ yNQWPhf!j1eY[^_]aÍL$qUWVSQ9qd -X -,h -l -?1< -@ -1D -H -1h!VW, ta#DtNJCl6D -뷃b$d/%p -P -C8 -Ct -u5l6^@ -e5l6h -R5l6]d -@T -/5l6]< -L -5l6]X -Xl6H -h,h!艉YXp,)lj80!h,h!YXZ=@ -xh!!=@ -x 8u5P -t hQ!jNtjj)h!h+jjD[_@u h!jj h!ghjn00h!@PB@ uh!t|j/S@ZYÅu@=} -׉hjhjj$8` -PY\ -1urh !jj#\ -؉8hDj?803PyP3h(!jW5\ -OG9=` -=P -tf95` -~W\ -4FX烽(ta1(,,9` - < -_=T -tjM@ -xrP\ -0jX -dh1҉ldPh \ -00%à t$ 8:ha!j+11ۃ=` -*6, \ -,4@lXRjPjjT($tPhI!XP :8zJt&Z JZ04z($J 04zh P&1 - -8Y_9t4VZyPh^!jPhw!j] 3‰.Ju lxtH'‰`R840Ph! tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRP\1ډ߭ D0%ܝ0v7ء\ - 40\ - <0[10=t -pݝt{\PvS ݅y+؉Ph!jN ѡjPh! \`+EU5X -9Ɖ 9jSZY@݅u؉NPh̛!h -ܝp 0%ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhljP8T8P PuPh!Y[# 1҉D<5p -d -8Hȉ9r09rÉ014#840Ph!k840Ph!jx04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPh_!PDPhx -SW(~LFD\`HP\Phx -W\DHY, X049Ѹ4}u014"80Ph!p1ۉ898r;D\`j\Phx -W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPhɜ!DPhx -SW|$~FL,NY8&D8tx -011҉VPh!K=98~k,0D$Aۉ7<1߭߭ - - - - - -1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP ֗1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ=L -t 1Px -k,8 $98p 9~Љt$DPSh!pPh00%ÃJQSPh'!j#tV":t&PhL!j,+ePh^!j, E$) 048<11ۅt9 ks F(tȃ0tBE;Pdr,9u:s (tvRPR}YY09us,9uih~(_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV|^_Ɖ׋E t1 $DH 9|(&[ (E9s@(ERPWV0,h!(  袋9.}*WV0,h*!j(fk,V4Z1ɉ0 PHD0,hP!j ((X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Phj!4<@E0]\)Hu E1ҋ] 1ҋ] t1RPWVkDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =8 -hߟ!jAY^wM t1WVSPE(<0%=DH9}bk,4_$SӿG(Zjt0P4t0$h!jMH=8 -tRP0,h(!jCEHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh E00% bRPڄ@8tGpBuE -@,Xe[^_]ÍL$qUQ - -5 -5@,H0%EM MuQQ$RPh!MɍaUS]CtS P S tSPSCr s gZS` -X]USEPsH) - - -Hu0 -Z[9u -u'  -uh%!j胧P4BPQ X4CXZ@]UWVSu EEE#@, - - -M11ɅtJA9~ʳ9M}#t -h9!h/%hhH!l}9x4u }9x(u9p$t버t -e[^_]UWVS]uuu SO trNj@thj!h/%h1GGWX9w(~6Gth!h/%hhH!wVw 5G [^WY -@,; -X= -u = -uBGWu -GWtP -WGtG4WPZWX -j@jIVj?G _4E UG$W(G,W0wE #@,G8 -tz8GC GtWP { _ Ge[^_]USEM Puh!h/%h4hH!P ʉPHPPP s E]XPs2H - - -1ɉH -H -.1ۉXt -H - -H -P4JH8 -9t!tXYX tAP]UWVSUu }uWVRcËECUt -R -EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=@,Y,A0Éa,ڋyY I4 s RPWSQ<0% RPWSQ@0%e[^_]US]C%CSjS]1]UE UMQ1]Uj跕UU P -PYtHJ -@ -UWVS] -C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd.C ${s  ]e[^_]UWVSuE EEEE% -1҅9su}K}9y,u^}9y(uVK0ts4q4s4 -K0ts0q4 - -C4 -= -~ttpRZg{$u{uCuڋ[0n= -~ tRkX - -t$;3uEE EEuCe[^_][؉؍e[^_]UW1 -- -11҉ -_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE@,K,ϋS0c,ʋ{s K4 es RPWVQ<0%9Cu CC17RPWVQ@0%uh!YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPdY_}UVSӋEU tt RPdY^CSt RPxdY^CS e[^]USËt-w1Ɂbt#bt!thbRh!91 Ȋ ЈS^Z19tPQh! Ћ]Uuu `jUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus hC EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPbY[L(ștșe[_]UWSvh2!h0%h hC!PÉЊӃttRPCbY[LXștșe[_]UWVSvh2!h/%h"hC!ƉӉȊʃt$uҁTXe[^_]UWVS vhh!h/%hhC!kƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRP\YYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8j7ËEEC1CC"_C_C h1C C$hjEhjM쉁j`jۈMAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmEEpduSEE싀}@u jR^_}E UG(W,}x0xdEtFVtRPZYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u -EE % -S0tK0J4 - -C4-C(tS(P,-C,-މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hy!h/%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhy!h/%hh!v@]9~ ]B뫋EEPE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh!}t/EEtP1uuRPhݣ!辧]9]tSuuuh!蟧uu] SY[9t$PRuuh-!suQ1҉U u?XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPObMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhy!wtC M苉9t.CM苉p9t$1SQ1RPWVh!蠤C(S,C S$]9UrSPWVhȤ!rWVh!^ ~}t5EtC(S,C S$9Uu9EtPuh! EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/!辣}hF!h 0%hh!荿EzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP^EuuWV^9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVk^9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhM!臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^!ݳhX,[Y^tCpStCHuRPuuEU}t h!ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPh!F-6EtM}`d)RPhʥ! tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8jyE1҉PEMA][A[A [1ۉY Y$XZ}t.hjwyËE쉃P^_ u =@,ƉE} t h![1ɉM@,EPjh WVu*hjxËEp }쉻PP P jPXZtS Su@,}URjh  t1RPuhjZxEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7!Y@Et} t#hl!Zu uuS9u u菞X S膞X]=t SqXktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjvƉ_tCtP`v^tCtP:vFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h|SXZ؍e[^_]UE Puj@, UWVS]FHljL1RPuu WEUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h!@ u~ 1RPuu VtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuNV€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh! LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t Ph֦!XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph֦!`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt Ph֦!XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt Ph֦!B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuJƉ׀}Mt1׋C|1׋URju1RPQtPuh!d Ep 1RPuu,It֋F Ft:_vkk փ~t*uuh! tFVC(S,FC vkBHMQjPjjRt Ph֦!XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt Ph֦!ZYEP tu}rz}zP4PR:X17-t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]USJPPh*!h,舡h,ha!6,@,CtsPhC"h,TjUSSE] t$uh!a"s*ZY¸tr1EEPhvd5 - @u35 -hoE"jq]UWVSPu }t}~^h#"S跩Y_DžtFh*A"S褩_Zt)h!S蓩ZYthy!S肩[_t뫿}}uhg#vSZYuUEPhud5 - @u65 -hoE"j'qe[^_]US}tQ,Shzd@5 -Е @u5 -h|!jp Xj E pS蔕Sh~d(5 -Γ@u5 -h!jnE pV5 -h!e[^_]UVS] }tjs(V vjh!jEnVh{dЀ5 -< @u35 -hoE"jEne[^]UWVS] p6p,11hJ!Su; tet quٿ11ۋE9p,t]UEPh|d5 -蛒 @u5 -hM!jmU;Ut4i9UsRUusYXۋUu5 -h\!j?mu'u5 -h!yXZju|hhRSeE5"t"RP5 -h!*1;us:PCPSh!F e[^_]UWV }tEPhd@5 -k @u5 -h!jvlEEPhd@5 -8 @u5 -h!XZEu}P1RPWVFRPWV5 -h!@e^_]UWVS}t=E XhoR$Sң^_tDžd1ɉhlpdPhwd5 -w @^tltDCSx|xP3Pss ss5 -hE!n N 븋lhprhx!S_Zu+hxd 5 -ڏ[^@5 -hi!jjh$SĢZYxP5 -{^_@u h!%= th~!h!h,oj&tDžd1ۉhlp`dPhwd5 - @u5 -h1!9tXl%NjX󥋽`8X K`t!Tj {YTujjihp`hjT_Zt̋`1X\11t(X\H X+HXߋWV\X5 -h!^hxd 5 - @'5 -h!4Y[``pp pp5 -h!`px`@`9q j RP5 -蔍Bu@uWV5 -h!OOWV5 -h0!莔hT5 -H=thn!h #pXhX,pZR`e[^_]UWVS] }t5hs4Pl v jhB!j sEPM vjhj!jzg10j PsשƉ׃ 8t sh!ئ8"u:9sh!pyhΫ!e艦1ɉj Ps 7e 8t s h!=F8"u!@u h!jfuĉ}ȉM̉UЍ$Vhyd5 -n @u35 -hoE"jwfVh!蕒XZe[^_]UWVSlj֋ 1҉@,tUPQM"ZYtUBMQh!jejhh-@,s 5 -eh -@u5 -h]#je --VWS5 -Ge[^_]U05 -hoE"jeUSS}tE Xh3"SoZYth!S^ZYuEEPhwd5 -* @uE ]UQ}trEPhd@5 - @uE O5 -h4!"XZUS I-I-t I-1Ӊȉ[]UWVSӋ}bG-uƍPG-u(PpPP?P*PpPP?PPJE 7 u9tN7k?9[^_]1^G-x@uUWVS։ˋ=pE- tE-11~B? ʋE[^_]UpE-?tE-jh>RPu==vuxE-UWVSQ5HE-Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ P-1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉MpE-tE-ÉEE1RPWVB<E)Ɖ1UQh$\XZ}UttE-H9upE-H9u u9rBRWh!& e[^_]U塨A,=DE-tvPh!5E-5E-5E-5E-5E-h!׍ 5lE-5hE-5pE-5tE-5xE-h8!謍5I-h_!蜍 Phm!艍hw!E-E-5A,5E-5E-QRP5E-h!J,h!PtE-pE-5lE-5hE-QRP5xE-h! 5`E-5dE-hn! UWVSQƉ%1ۉjEPV >u#ËE8u8"u w܉1e[^_]US8P$5"Ph5"Ph5"Ph5"PSh!h,,j΅UWVSEM A,9uh9!5A, hO!j_ًEEUMjؙ]!É]]!Ӊ]uuW諄BuAtVA,A,=PuR@ 3P5P$-R @ 9A,uNE!5P$-}e[^_]UWVSEUϋE E컙!t!EU@uShl! XZff=Ut+=E-t fuuSh!蠡ff=u%Cth!rfLJ_f=Ut1=$ -u Sh!EY^$ -tSh!XZj(VP: x0XŃ~X E-t\fLJᵃVe[^_]UWVS9I-uI-5I-w1XƃbG-e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEE!EEtE!11}=A,EtE-pE-U1҉U܉E1ɉMԹEM]̋ERPSQ6PE؋UEUuuRP6RPuuȋE؋UEUuuRP6RPE؋UEUuuRPr6RPuhM!蝈,"uuuuuuuh!y h,jdh@I-詟 u h!j[h"h@I-GY[@I-U슀@I-< <$u z Ћ P-DQu<-7j EPh@I-Ɖ׋EEhl"%PCEЃEPh!uO tuhY}"uN t L =A,Ήʋ5dE-11WVSQ5Ɖuh!uN ui dE-ω%dE-Ɖω uEt5`E-1Et `E-1Et `E-1)Et `E-1)׋E؋]؉E]h"SYZÉ]; t,h@I-=Zƀ?I-uh@I-h!菆 9uE|E9Ɖ]}.uuuuWVhȲ!Wuȋ}u}e[^_]g_USE Purh!,H, yh,蟀Y,P,؃ t9@t* ,y h,mZ,P,8 u h!jQY1Y]UWVSEM䡘A,E@u h!jYA,EӍEƉωؙ!M!Ejuuu}Bu @uA,A,uhuP(8 nR5P$-PV9 9A,uVjuu5A,}Bu@tP$-K!Nju5A,R5A,7 9A,ue[^_]UWVSRáI-u ƀA Mz΍I- S}8PRJ4 I- e[^_]UWVSEыEU u1+ˀ `E-1ۉƉ)߉u}};=I-}=I- !EUEUE9I-I-}=@E-t EvI-KiE9t 5I-tމ&ʅu+`E-9UE}M1E܋E9E܋U}t0}t}utsƆj/!Z!ȃ[^_]UWVS EӋEEhI-@PhI-E 5I-t h~!jRVEU9E|E9u|I-] }) VRPa25I-31fǂU }u@`E-5I-֋M)}CsKSCPKSs FSjI-Ee[^_]UWVSE}u&bG-ƒ<1IE E#֋EU EUEUE9E-E-ME-19Et\tSMM1ۉ]]9ً]M}3M9MM }̳!=@E-]@uEE-˃t I- I-t!=@E->I-1hjiI-[^u hN!jSfǀUEI-EU I-I-EUI-I-I-ytbt]t E^I-QHuI-<=@E-/hO!>Y7!gE-=I-I-;I-KxZ 5I-t1;EM |9UE}=@E-t`룅I-E 9I-u;]t~I-HI-1+]9~ Fu%uF PPR. I- *`E-1RPEU I-+EI-XZEU I-I-EUI-I-!! !!Ѝe[^_]UWVSË@S t+5E-=E-9u9t h!QY]sǹ󥉍1󫍍@u'C! Cu!Rh´!XZߋe[^_]Ã=tC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾E-19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu hz! E Et}u9}E}}u`E-dE-1RPuuu 9tۃ}u E9uuujjR;#EUEPuh!h!Bjh,jdh@I-uu h!j=h@I-q[vEHƀ@I-t'?I- t9EEHPh@I-h!i uh@I-EPz> uċ}ȋEEă}t6juuWVUċEPE-uD<=@E-1EjuuWVUċEu=PE-tKt$|=PE-us=@E-t Ph]#j[P]juuWVUċEt)/juuWVUċEu}t }tPh]#j<}uf} E U u }EfukE } 1E}t Dm:}ta}tE `E-1 I-I-9u19tuugZY I-UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P7<@E- =HE-u=@E-<t I-(h!Ytfu'uEPkE }P; =HE-9=@E-t h!ZuHE-}ft=@E-h![E̊@EċE̊XEčE@‰xE-p1WVjjjK!E1ɡtE-p1WVjjj^!Ã(Uă?1ɋ5pE-1WVjjjm!^}̊MO_U? ˆWGEĊ_EčG‰xE-p1WVjjj~!E(1ɡtE-p1WVjjj!ËUă?1ɋ5pE-1WVjjj!}̊MO_U? ˆW(} I-uKye[^_]UVSáDE-u h!X1ۃ=DE-u Sh_"dY^jjڸE-CXZu҃=DE-u=I-th!ūX1L=I-thݺ!u Sh!dY^g I-RP1҉8XZ=DE-tCDE-9I-A=HE-~h!?d5I-j5I-5I-RP 믅<f=\G-th:!^h!c[1G-t=h"c2G-Y=uh!"k Ph%!cXZ hZ!cXh-$荪X=DE-nPhO!\cY[=DE-XG-PPhk!u Sh!cXZ9I-} h!X; I-RP1҉u Sh!bY^jjڸE-XZe[^]UWVS ˋDž! t Dž! @uh!ZYߍ1jhػ!Sf t 1/9Cu苅9Cus Pjf( ;Cuă=HE-t.{ t(s$s sh!ae[^_]UVSPEA,;A,u*=E-u!URhmdP2Z y h"XE-11@uh!B=H$-u111HL$-~ ف`$-@uh>!^EI-01C;I-}. I-I-I-@@uShS!qY[1҉UA,;A,u*=E-u!URhmdPOY y h"4Xe[^]ËUr Ph!h,'cjYUWVS|E|xJ-wSh$!h,bjYSEEZuhS6EXZEE FEe[^_]UVSSPPVu ujVShq$z;,@uLit!t"ji0KZ!t!PSh!j)jkOUVS]u VS_yYZu Sh`!j);/t"Shu!blXZu E!e[^]Kle[^]UPh!h,BXjNUVSPh*A"PX[^t,PjPuVlVǶt jP3 ZYSNXe[^]UWVS EEu EE}]EEE1҉tK-%1ɉ xK-K-h!Vu: NtJb$<%1=K-K-K-|K-xK-뗡l6tK-jWh`<%5l6iu h!j"(PYYK-Jp,4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjPXZt1h#9}P _ZY uċ2jWShw$Q8@uLWft!t"Af0H^!t!PSh!jw&t%@u=xK-p&xK-_xK-MDž!=K-tDž!tK-t ##P=K-t &$=K-t !=|K-t Y#1ۉXP#h!h}%j%Sh!h !V誘u h !j%j/G P%ZYt|?Sh!h#!VStj/C P~%ZYt|Y?XjJUVS]u VStYZu Sh`!j$;/t"Shu!gXZu E!e[^]ge[^]UPh;!h,Sj@AJUWVS]u1 11҉t11ɉphx!u u6 athg$=%5l6`CpX5l6!CtXDžp5l6XCxXDžt뀃K|wK|njVh>%5l6 u h!j#P X}tWWVY^ƉuuYYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5K-=K-}t M U JpD1HӉ5K-=K-}tCS}t#RPYYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuh2!hL?%h"hC!Q}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWV1҃t0119s#h!3+ZRP%PH0jjjjXSËP?%F߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PChw$VwPZYthw$Vh!( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydh"!'^_PDžDžt9t h@!&Y9~Wths!&XZ.DžDž9|ċ9|<t h!(&Xh5K-h!XDžy(h!%^_uqh!MXYI;rh!%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t PhP!G$Y^Ht2{{ @D0{{@D#Zt⋅9t Php!#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Wh!"XZHd 1t1\{ChX\Clg{ OtIh!h,w@D8ljPh!h,K@t@t)1L@t31#LC LClC XkT,PxuxtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtp ct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Wh!h,: 9Huh,h&!,XZdѽPho! dt$h!h,:OPh!<77 v$tpPh.! 7^_j #6Y@uhL!~h|!}XZ+1߭ڍP L0%WW$h!6HuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|PEYBu@uH0(+Ph$ tu `duCPODž1v 1񉅰 t1 t19u9t h!_ tG ?9|$ tj jh!q$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh!^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@hhYu jj@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WV^_Ɖ׉ t19s=Pd/D ]jwƉX PVYP;FZ@HRjPjjt Ph֦!N>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ Dž`?%Dž1p/_<҃D 9sh!5K-hoE" Ft Pt#u?RPY^f*uGɉf1VfN@ tBh1!h0?%hqfFu=@ A)G G p 6p<uGG9rhK!h ?%hhC!/)9rhj!h ?%hՉϋ)1󪊓t@@tf)th|!h@?%hh!LP4PRAH‰ljX1OtVjR1RPQytPjh!66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=P-u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPh!3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WVv@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t Ph֦!/^_A |tVC@SDs8{8tGpBuXE8P-A,Xe[^_]ÍL$qUQ 0P-,P-5(P-5A,H0%EM MuQQ$RPh!MɍaUS]CtS P S tSPSCr s ZS 4P-X]USEPsH) P-$P- P-Hu0 EE싀}@u jR^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM uhP-EE %P-S0tK0J4P-P-C4`-C(tS(P,`-C,`-މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hy!hE%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhy!hE%hh!@]9~ ]B뫋EEP[E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh!}t/EEtP1uuRPhݣ!{]9]tSuuuh!\uu] SY[9t$PRuuh-!0u 1҉U u XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRP蕢MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhy!wtC M苉9t.CM苉p9t$1SQ1RPWVh!]C(S,C S$]9UrSPWVhȤ!/WVh! ~}t5EtC(S,C S$9Uu9EtPuh! EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/!{}hF!hF%hh!EzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPEuuWV9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV豞9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhM!DEuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^!#hX,Y^tCpStCHuRPuuEU}t h!:ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPh!`-6EtM}`d)RPhʥ! tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8jE1҉PEMAAsA 1ۉY Y$XZ}t.hj轹ËE쉃P^_ u =A,ƉE} t h!B9[1ɉMA,EPjh WVu*hj8ËEp }쉻PP P jPXZtS SuA,}URjh  t1RPuhj蠸EEp }}M쉏PP P jPW^_utCHSLC419|} tMh7! 8Y@Et} t#hl!7Zu uuS9u u X S X]=t S XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWj̶Ɖ_tCtP覶^tCtP耶FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h;SXZ؍e[^_]UE PujA, UWVS]FHljL1RPuu EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h!@ u~ 1RPuu NtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu蔖€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh! LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t Ph֦!XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph֦!`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt Ph֦!XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt Ph֦!B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuƉ׀}Mt1׋C|1׋URju1RPQtPuh!d Ep 1RPuurt֋F Ft:_vkk փ~t*uuh! tFVC(S,FC vkBHMQjPjjRt Ph֦!XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt Ph֦!ZYEP tu}rz}zP4PR:X17`-t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRPv e[^]UWtBRBR t RP+xY_}ÊtBRtUWRPxY_}ËBht1UWVSӋEU ΃tt RPwY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh!h,F%hhC!(UVSuE H$X(1y9)tNp1SQRP e[^]UVSuE H$X(1y9)tNp1SQRP輈 e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh! E|BD1H)CNjEahE@ EDžpA,pp@tUkl1ɍ9~ډM}}x1:xsY[EUEUDpTtM]199 ]9ظErpPd؃x4PEWE7T)ljxxuExT9rxEZxPE@4}tp]u]C4WtGpEUUuF4E@HEUEXCpEPEPEPuuSutuuPhF%hURjV1RPQdtPERPh!E‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWVLt‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPh!kE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWVWrC0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<uP-@ P-$P-E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPh!‹EEp E @0E܉F uMMЉF <u v0E@4uPuE܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉Oơ`-`-Nu"h!h$Y11҉P]UWVSX=a-thX,hp"^_5`-5`-5`-h"hh F,la-߃Wh"h,l &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃShx$hVxgVTp^NjP ѡp-a5p-kƃt(@h-$PJtZYu)5p-CYu*LSh"h,k 7Sh"h,k FhC"PsYZu5p-Z1Sh "h,j p-Ƅ=FVvhPSh1 "h,~j:hPS +1RPSVH p-;5p-Bơp-Xae[^_]UWVSuS ~_X؉8/u@1Ҿ1h͢$PnuXZۋtm;thlu1WP ѡp-Sbn^5p-Yt@9uVSBPq uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3X]]FT UWVST=a-thX,hN "[^a- nVUX=a-E}tPuPuSf uSzEZY~/9jPuSjSh "h "h,eEPS'EPS=`-tuuuuh9c$SC uSY[fft uP Z5p-\Xe[^_]UWVS}E U#ÅuWuu h "=hhW,ƃ y@Wh !h,eh,>u0X Ph"h,d 1S ѡp-p-0Nj[Yځ~RQWW @u55e-5Le-5He-h "h,pdt0nW Ph "J=a-uURQV @uG5e-5Le-5He-h "h,$dt0"W Ph6"h,d$jZ%WVXZe[^_]UEU ]U= B,#tjjh B,5h B,蛪= F,#tjjh F,h F,wUWVSƉ׉ˉ t;5`-`-rWVh "; D-RPWVH-s{ S$=a-t [$t9{ u9suh0 "S<XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh? "Pb<XZUWVu} 1 tC;5`-`-s.D-RPWVH-t;x u;pt@$e^_]UWVu} t;5`-`-rWVh` ": D-RPWVoH-t H$9x u9pu 1pp P$WVh} "i: e^_]UWVSujj[_ÅtJNJ/t tF@PW3jZYt [u Ft[ 1ۉ؍e[^_]UWVVj/PB_Zu1,VeY/txtEVh "9XZEe^_]UVSu>-F@-9s%)P6SDjj*9tC/vKSh "Q9XZ؍e[^]UWVS}u h "09[ueeYƉ<@-uE5`-GC Zu h "8X)`- @-9r @-@-@-uS5t؍e[^_]UWVSu=@-uF5`-B Xu h "8X`-Lء@-19r C$؃(t@-@-C$@- 1ECCDžuPE  EujjY_t Vh "8XZVV/d_C[ٸ1Xj/V?^Z@PPcC{G C_ Y^Et5uu XZYƅu h% "7_E UCS FC^1E E t)uu ZYt h@ "N7XًE U<؍e[^_]US]SgcZ@-@-]UWVS]f{t hQ "S8Y^{u&{t hd "S7XZ{ t h "S7^_s{ t]WVqZYuh "S7Y^49uWVKXZt-~"ЅtP9uSP h "S{7ZY3@-C$@-Xe[^_]UWVS]E ?ƅu h "S27_X9stsF C^ j/u !>ZYx3WƉWbC$8VP3ffCu fCe[^_]UWVSd=a-thX,h "XZa-E0h!u9]_Xu,Hm0O Ph "h,\uh "55fc E1uE9`-`-ErFuuZYƅt)GE~SFPj6.v}ӃEU1E1}E9`-`-EuuPZYDžttj$GPEPJ uGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP-눃EUUH-Mt@ESjjEP-E D-E9ʋE E̡`-`-EUMԉuС`-`-E؉Uܡ`-`-EU`-ESjj(EP5-C @t,`k0M Ph "h,Zuh" "M3SBQXe[^_]UWVS=a-thX,hP ">Y[}uXjj5`-5`-D-jPNA H-_Zu hj "2^jjjh-$fHwjju ƃ y,j0 M Ph "h,Yuh "y2xPV<Y[y,Mj0L Ph "h,Yuh ":2EЍXjS@ XZu h "2YSWV,  y.i0oL Ph "h,UYuh "1j(PPV  xV a-Z Y P6 `-Zuh,hA"jI(J,]UVS]`-Ph-=a-tPj |^`-,j:S.$ZYt"-pS3[j`Ih"S[ZYh*A"hh"R`-Y^udb0qE Phh"hq"h,RRh*A"hDg$R`-u(b05E PhDg$hq"h,RjH-Vh-fXZe[^]USd-d-EU]SOPh"hX,Q d-d-MU ʸ"tSOZPh"hX,Q "=xd-txd-h8d-Phc-5c-h"h,WQhc-hM#h,CQ$=`-d-d-EUSOPh"5`- Q d-d-MU" tSNYPh"5`-P "=xd-txd-h8d-Phc-5c-h"5`-Phc-h"5`-P$5`-h"3XZ`-@ @t h"jt!]UWVS} u=a-tWh"hX,-P EE]99ru4=a- ";]u5"Ph"hX,O {CPCPh!hRK=a-t R3C4,J,h"hX,pOt}t?SHK))PDPPCPWb2K"uSHK))PDPPCPuI2+"<SHK))PDPPCPW1:"%@:{Nh"PWZYt h"PzWZYtJt%uCDPjW( w"?CDPu@*ZY\"CDPjW) g"@{atNt)CDPjW.( w"?CDPu)ZY\"CDPjW( g"@t=a-t/Rh"hX,UM =a-thX,h"YX=a-thX,j 2dXZe[^_]á8J,x=-ti0UPXUWVS -}tt=h"]%[15T-5 -t=`- 11ɉ1\-5-tj6Ca- tRPh"h, >h,j U J,1$J,XZ낡 J,$J, =t-OwO$8L%h,h"5h,h ")RPh7"RPhL"h,=h,hn"/_X\-Hp-9tPRh"h,O=h,j XTY^1t&t1Ƀu t@A9|p-1\-t-C J,1҉$J,e[^_]USe-"f@e-1ۉDe-He-Le-=Xa-Tt4l-@l-@a-Xtd- `-9 d-u;`-ʡ@a-Pp$LL%1;a-}0a-t Cd- `-9 d-tl-@a-t;`-uQ`a-De-a-Pe-a-Te-a-Xe-a-\e-a-a-`e-de-ta-xe-a-a-he-le-|a-|e-a-a-pe-te-a-e-a-e-ha-la-e-e-Ta-He-1ɉ Le-l`-`-He-Le-Te-"He-"0 Ph-h%h,|-`-`-Bh-- a- `-9~ D@1ۉh- =-t RQZYRQ58J, |=0 PhQ"Yt!hhf"Ph"h,,j{# `-d-=a-tPh"hX,, @a-TuF h- \- X-a-@a-.uh,h"vh,h"[X=-tB=a-%Skx-`-11`-=uI)У|-=a-u =a-tud-d-`-`-d-d-`-`-EPh-$hZYy#<0 Ph"h,+j9"E荐w1ʍu1ɉMfEEE'E0VhQ`5-$ @u h]!"j5E<u 5-hj!"<u5-h!"h, ~<tP5-h!"h,_Pu󥀽_y-`9L%CSh!"hX,I j 詚RZ<h!"Xe[^_]UWVSE] h Zu h!"j1󪍕 19}J jQh! ujQh!" u#Fuobu 4jVh$ ÅtIjVh!" u'jVh!"s uƅ7fDžjh0uhj P5-ƅp9؍t h""S#Y_uu"-h!SXZthC""SY_h!"SXZhI""SY_u hR""SXZS5Л-5̛-5ț-5-hc""` @tAtif@ffh""S"Y_o`f@ffh""S"XZ(/f@ffh""S~"Y_m!u h#"RZEVh! Sh]#| X4S׃X9uEe[^_]i e[^_]UVS ] }t3h"VZYthv$VZYu E'j EPV؎E U:uy 3h##"Tsh"VZYthv$VZYu E-j EPV胎E U:uysh6#"j,EPhU5-  t hF#"j0e[^]UVS ] }t3h"VZYthv$VZYu E'j EPVE U:uy 3h##"Tsh"VZYthv$VZYu E-j EPV萍E U:uysh6#"j9EPhU5-- t hT#"j=e[^]USUBBPJ R Ph`#")  uEi#"]$PSh#" XZ]UP}E 0_jEEPhQ5-t h#"jU}tqjhQ 5-N t h#"j^U}t&"t3"PQh&"VSf@Ph&"VS1ۉ؍e[^_]UWVS]}hpVjSzPh '"{vTh'"Y {yj h,'"~XZ,C@tPhA'"fYX,C t PhQ'"NXZCȅt Phs'"8YX{w j J_CȅtPPh'" S C h:Vh'"C t Ph'"XZhpPjSuj Xu'tPh'"j  W;} } <;u GVh'"aYXujh ("NXZjh ("9^X>9tR;U }MuRlh ("ZY1ɋlhlPh#hAlBXXh?"DXe[^_]UWVS] }uh("^X1C9~D3Ph0("FZYj X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u @u h]!"jEtU-<uRh>" <uRh ?"h, #<u jSRPRh ?"h,\je[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@UPhB?"h,jMUh?"lUWVSÉ֡d-Pd-uhh`-蚦Y_`-h?"h?"hWh!W_ZuDh?"Ph?"j J- u.h`-Ph?"h?"h[@"h`-Ph5"h?"1X9ډ}Dh-g $h?"i ԥ-tWPjh-?;9}~ڃ<" u5"P<ؙPh@" h-PgYuRh1jBY[jc^31<$M1$jXZh9@"iXZ?e[^_]Ujh-"gU=-u h{@"|BXj.USh{@"fBh1jh1jh1jh1j$hhh{@" xVj"h@"Pyh-j PScjh$SV(h-$h-S;S蕭]UPhB"h,jXUWVSыP-:֍RD{@u1ҊBuT8t9s P-DY@tJB[^_]UVSËHuPs8tIS8kC4`9s `Rj 1s0s4s8X{Xu1ɉKXCXtPF Z1CXe[^]UVSu] EPu36vx9s)e[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|ShC"j EPQEEEEPh1("j EP-UfT ȃP-DJu.D=uURY=P U_Ce} t EP5=Yuh C"XZe[^_]UWVSS1}11#tAEtSWhC"P<ShE"P< @u hdV%h!C"5W }YCu}u#h5"2EZuhdV%h&C"jIEe[^_]UZh+C"Ph?C"PhHC"PhRC"Ph\C"Ph}C"PhC"h,8jUPh !5K,- t5-PhC"5K,E Pu5K,a - USÅtN@-twRtF -ti0M Ph-hC"QH@- -u=-u2j -t#0 Ph-h% tŋ]UWVSEEEEujj}WjVP @u"e[^_]ËEƒUt PhC"jPS ZtjjWPVui @u ]=0-u5K,uh$| ms5"M;Ms"VvvPhD"SE f"j ]X]e[^_]H UWVSEE]EEjj}WjPS @u-uy YtjjWPuS @t̓=0-uuh !XZv<9t's sss sssh'D"{ ՋE荞 kT؋U9u FE1}h-h=D"ZYdTEM9Mt?Sjh! :1;{s֋TM4PhPD"G ,j Xue[^_] e[^_]UWVS}}} }܃=,-É΃=0-tO=(-u:=(-t }u&}u35K,Rh$[ - 0hX,juVMN}u!Rh !( -Y_~7j 6X -~# -~}uڋUe[^_]уtut3]ߋMtu*E r4s6Ph %4]ߋMEtPEPhUD"b sPhW#Ph"hXZM]ߋMtuuEPh\D"@$M] s SQh#SQhK# }uEeD"e[^_]E e[^_] e[^_]Ã=,-t -URh-4K,hjD"UWVS=$-uhD"sj j=PY^Xd 1Dž\ Dž`hj`Ph-\PVSH@u!ڋ\==-jDž`1Dž\YdX@DŽdj`R`PPQVZ @u!0S Ph-hD"WBuh-hD":XZ&,- 0-uPh-h%5 e[^_]UWVSWE}u =,-R˃=0-t>=(-u3{=(-tNu%"u25K,Rh$ - .hX,jWSu"Rh ! -XY~7j ^ -~" -~uى؍e[^_]it1RE rGK= -tUPh1("#YXUt2= -uUPhD"XZUB9|SWh! NuEeD"e[^_]E e[^_]e[^_]UVS]=-t EhD"S=Y^uEEY1҉jEPS边EUE 9u%SuhD" =-j8uT8u̸]1PSEPuVuu @u1t =,-1(-  -u}u}tPjUEPj D"UENY^tF(-  -u}u}tjjMUEzjj D"UEXZe[^]UWVS]=-t 'EE+18jjEPEPuu @uuhE"kjSdW u%Suh/E"e =-xjjuVc|W8u|1PSEPxPuu @u1Ft =,-x|t1p(-  -tpjxUEY^?URV莫EPVhLE"jduV7pPUEG$tk(-  -tjj|UE~XZEURt EPthLE"jd]SjPًUE$e[^_]UWVS(K,8-t f-/--SVZYuVh-賩e[^_]É)@E̍EӉljDPh-芩h͢$h-{uUWVS`Eh-ZEV%1]M;>r2jPRU Utj@uVRP_V3hVE"WGjEPjh-RU/5 UuE Eu1}u+E9Eu#/tj@uVRPV3hfE"jRGQ1EEe[^_]UWVSEUE5,-$ˋ -(- u'@- -h-hvE"[^=0-tu*jtHu!u05K,uh$ *hX,jSuHu"uh !XZ= -~(j Y I~I~uڋEe[^_]1v{9}E0Ph1("rFYXt WhE"^XZE e[^_]je[^_]UVS]EjjEPuVuu @u Be}t ShE"j蟹 - (-tjIY2=0-u Sh !XZuuuuuhE"e[^]UWVS]uEEU E$E@- -=4-J - (-t}jjEPjuV @tdMt]QM XtMMMjjEPWuV @tM;Mt W _j-PY}e[^_] }tuh-h F" = t)tu*Sh]F" uShF"Sh1F"ShF"SXZe[^_]UVS]E jjEPuVuu @ul} t ShE"jƷEUEU - (-tj cXP 0-u EPP5K,Sh%&IuRPhT# uRPhF"e[^]UVS ]EjjEPuVuu, @u}t ShE"j - (-tjE=0-u5K,Sh$  EU=0-h RP) t P)XuuhF" e[^]UWVS,EE̋}uu<=@-t3EjjEPEPhF"ƏE܍Pk((U܉UȉMQM XۋMЋUuwuM1BH(jjURPVW @uCEԋU܋M؃t (9t$9uދẺE1uhE"jw 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPhK,uhF"jURUUС - (-t7j(EY(}t GE܃t9]e[^_]# =0-uuh !XZv$v vvvvv vv6hF",뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|PhF"蘍|<Dž|tW XuJHxjjxPVph @ut9xt ShE"jdl%EpujjڍE_X=@-t=19|WhK,ShF"jUR  jjUE{G ŋ= - =(-t jQ=0-u Sh !Y[|~+t4Wh7G"G9|~ hf"Zj Xue[^_] e[^_]ÍL$qUVSQ$A QEjjMQuVRPE @u}t ShE"j  - (-tjYd=0-u Sh !*XZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hAG"eY[^]aUWVS@]=-t Dž S:XuhtV%h]#jR1h$RY^18jPS u.q8"uShQG"9t8uShbG"j诰9tҀ8úw܉ h$ji 1PSPVuub @u1t =,-1ǡ(-  -tW EZ)AP<$PUEVH tV(-  -tj EvX1P$PًUES e[^_]UWVStx|h-3l-$@-Yh@-h)ȉl)ȉ@-u-u|uH1ۋx9t担t-$u5"RPh$PPC뿃} t~|PK,xw5"RPh$PP|P-$xw5"RPh$PPU Dž|K,|K,Ã=4-( =0-th@-h !)XZh@-h-hxG" EHv h|j#hG"<4LV%hG"_X}uC|@0|psPhG"Y^P|p4hG" |p@hG"|0`-XZpt 5"6hh5"h`-谜hhG"h`-蜜$ppu/hWh`-thhG"h`-`揃$ƀt2hWh`-=hhG"h`-)$s2hWh`-hhG"h`-$ s2hWh`-͛hhG"h`-蹛$ s2hWh`-蕛hhG"h`-聛$ s2hWh`-]hhG"h`-I$ s2hWh`-%hhG"h`-$ s2hWh`-hh "h`-ٚ$s2hWh`-赚hhG"h`-衚$s2hWh`-}hhH"h`-i$s2hWh`-Ehh$h`-1$t7Vh2"j V]hWh`-hVh`-(h`-|p%Ph H"e|@H t PhH"J_X|p(h$H"5j O }r=8-=@-u }|xXDž1DžtxTpj`SPPWt< @pu\t|@9uߋ|@(9uΉdQp ^dtNjp󤋅|@XPwP Y|XX=@-uTE tN|@XpHv9} |pUE"<=0-uh-h !rXZ|@XPvh-H"PeX}|ps E z-UEÃ}tP@uj- Ph-h>H"jbs u|xtjh@-h-|@@uojjPjxtM @uD@- -=4-h-hUH"|@@EH{$`U%|xt2|@8d uq=8-:t.s j|xtjh@-h-S @- -=4-h-hpH"tx\=8-j|@4p\· _+jjPRpx@Pt @pt*|p`t7|@4`&R߿ ^K8 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT蹶 ZPtރ NjTCXpsR X1-d1ۋ|;X4,F\s@- -t%xQuujPtC`jjPSxt+ @jjjjPSxt @UjjDžjjVSxt @uI08 u3n XjjVSxtx @u jٺ-|c^_9S蓽 [DžjjPSxt @tgjjٺ-|^u讴 Yuh-hH"5K, KjjPSxt @u jڸ-*Sͼ XZhƀ@-lƀ-e[^_]UWVSƉLH-j=P腢_ZƅTt9sx?u @ƅTGh"V貐Y[.tK,K,8| 8Vs tG=^jh&`#S P` F<=t:K,M  T=$-u hH"s 41Dž81ɉh 1ۉtpƅY1j,Te_ZƅtF1ۉH1DžL1<1ۅkj=V+[ZÉluhɍ"VZYu09@llhɍ"VZYu D1j,SʠZYDt @Dh$VIZYHt;H"Hu$PThH", =-jo10jlPSI"!8u8h*z$VZY10jlPSM48l 9uSTh\I"8u;8u48,0,90r48hcX#V_ZYuThH" ډlHw^$xU%PmPaPUPIP=P1P%PThI"1L DžLpB^VThI"u D1މDu DžD<tThI" D$U%1ɉjlPVa<@l 9uSThI"8uO<@4849Ƹ8r9u-u F0j PV x;3ue[^]UVS@Ë5H-=XL,tjtSv|ZYuFl6j j5SHFS#$PFSh$P?H-5H-F PhXQ"j@]SSfe[^]USQtP=-uSZ]UVSÉu=-u VS'ZYe[^]UWVS׉΋]Uu E E!UuUV$t5"[^_]USt<0„!1=-uSZ]UWVSLEӋu>hhQ"VIZY)ƒ?EljDUhbbSPEUDEj URPEU:*u%jjWSRPEP,tEuj>u貋 E9hbbSVq e[^_]9`L,t3UVSRPjuV`L,e[^]#-t ú-=ԫ-u-UWVSƉӊ>uuVȫ-HtB1-hp5-V=-1҉-hp5-S9=-~؍e[^_]UWVS,E9- --}]6SP^Y^y#---=-u`- -SvZ=X=&wAKw2iffN6[nRffN6D=,w$==!ffN6=XffN6=KwJ=w$==` ffN6 =%ffN6 ===ffN6wffN6lffN6affN6VffN6KffN6@ffN6 5ffN6 *ffN6 ffN6ffN6 ffN6Eۣ-Eݣ-Eܣ-eẼEfE1E`- 5-iSj5-شE-e[^_]USEPhht@j~ 1ۅu E]u+hpQ"eaZtP-Xa$T~-hkQ"5aYtPZy--1ɉ \L,=- -t-0h{Q"`ZtP-[[#~-hvQ"`YtPmZy--=- -P]UPUE -1J$`Y% (UQ"UQ"lyUQ"UQ"UQ"ۍUQ"эUQ"ǍUQ"뽍UQ"!u,UQ" u -!- -1UVSPhQ"_P_ZYXL,h$_[u %1ɉ -Ph -[^Ht -Q" t -A7"-Q"-Q"ث- %ԫ-!"̫-Q"-!y1------ܫ--~1҉-E -UQz$tdN6U"u5"-Uq"u5"-UQ"rī-UQ"`uQ"-UQ"EuQ"-=-t8=t-u/UQ"-UH%-=-u1--5"=-u -5"U#-t8uȫ--5"U[ %-=ԫ-tt8uȫ--5"Ub"^-t8uȫ--$UQ"/-t 8u -5"1҉Ы-EPh5"h5"h--i$R"EP5-5-hظ-ܸ-%$" EP5-5-hи-Ը-V$a"EP5-5-hȸ-̸-V$Y}" U%"Uu5"ĸ-!"t -%U# -tހ8tٍU8"Åu5"-5"8t&jjPPuuVnDER"-U$$Åt =\L,u5"-5":t+-HPjRtPuHuVDEA"Y-U"6uA"-U"Åu5"U!…u5"=ث-u5"É-;u  -e[^]Ë--n--^=-tg=-t =`-uMU= -t=T-u--=X-u--1҉-]1-á-t 1=-ú-----USc=-t =`-ul=X-u<--f-8t-8t=-u-=T-u--!= -t-=-t9-~j CX]6]Uuj5- =-uĸ-8t -Ã=-uUjlXË--q-bUWVSu M1+uAM]-}tue[^_]USÅth&$P葵ZYu R"tEPEPS tt<`UxY% R"Ux<Y% R"Ux R"UxR"]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]U师&$-ȸ-и-|ظ-m1-]UE t \,@t]USuZù¡ܸ-ڡԸ-ڡ̸-=-ttS蘯2Xڡ--]US=4-t-u ]SJX]US]SZ3-t]]]UuZu Y9Ã=XL,tUh(R"Xú-UWVSu}]E Et#jYu7u21ۉ] E-R"jYut$RPyZYtRPjZYuÉE1ɉM EAR" t9Et'hÃu1҉U t EXR"EoR"vOԺu Y 1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E ER"e[^_]@-B@@@ 9uUS]t=hL,tjhR"XZhL,]Ã=@L,UWVS-@@ˁ1 }1119މM}Z -9t+9xu"9puUpP5@L,bX UхtjhR"FXZ뛍e[^_]Ë -…t8=-u/US@t\%11Ҁu 0@4@[]UWVS$-$@(@u9t9pu9Hu,@;Ps D15-%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=x-t @tdL,x; @~QMh j脍 ZYMu 1x-0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x Ex-$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@蝛Bu@ujhR"[^&-M]艈@@hL,Ft*ThL,=|-1ɉMܻ-@Mt@\%T뾹 )QDP@ià u-u}艰0@4@Et]y*jhR"XZ1K@L,yZ=|-u/@L,x&t"SVTRPT 1E 1E -ؙ@@^}t-=-uAEEPh]#O-ZYEU艁0@4@=-u2j2X=-t!=8-u+lt-8=-+-98t<WQ Gz8OW Q JMԍJO]É_ y z,@;F0De[^_]Ë -t&US$@(@ ,@1[]ÃÃ=-tCUu/ -,@w B,@$@(@1]ÃÃ=@L,xzU= -t,5@L,eU@L,5l-؍ 1ɉ l-XZá-4@uƃ0@u -jhR"nXZ;@t-tUWVSu} -Uy 9}!@u EU@uG@E䋋@9u9t0E%@؉EPE9t8E;BuE;BtREU$@(@%,@1?E9ƉV-@9@}A@4-t&[^_]UVSjjY[t@-9t2ʋqY9t9rr}ы扰$@(@1҉,@1҉Ѝe[^]US-u1Q@t@h0@4@[ut RPPZYs@t-t]UWVS -t @t e[^_]pE11E9t:EP@ EUE@1EU9Ɖ}Ɖ׋EEWVZYe[^_]Ë-,@t H,@cUVS$@(@9}Q@u#%@Ћp9t.9^u9Ntv퉊$@(@,@[^][^]ÃUUx1udL,]US-@uǃ0@ǃ4@|9t@@@g0@4@-1ɉ@@$@(@,@jjj@蝔Bu@ujhR"XZ]Ujjjup!Ѓ@UVS-0@4@ut@@9} 0@4@[^]UVS]u 5-q-Yh8@j-@1҉ @@1ɉ@@$@(@,@ǀ@ǀ0@ǀ4@XZtSYu -@5-5-pXZ-@u@e[^]UVS-@ t4t&9tPQ PG X1ɉ @@uB u @OZ-t ǀ@P 1-j5-*p e[^]Ë-1t@UWVSt/Bt/; r"H19|0<9Osr;s B1[^_]UWVSR1ɉM1-G*u:Vt3st!dt1k1uUE 0e[^]UVS h5"jL hlS"DhĹ-o h-e h-[ h-Q Ĺ--ȹ--------------hGS"0D1[<=:tjh{S"?j FWZPÃ$Z%%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu= -tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU= -u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U庀-E1uN-Ev¸u6Q,E^u =-tL,ED]U庀-E#1uN-E¸u60Q,Eu =-uL,E]UE= -tE]-]USQ]uhS"h@-w?SSZt'؃@PCYu@ShT"(S5Թ-SZt. S YtS5й-j h@-茌"yE@-SEPEXZ@-]U庘-E¸uHM,E]UU 1}Du% ]UWVSSEIuRfP辔^X[RVZY1uEV Xt S菔Y-h@-jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRhX"V:hX"J:ShX"PQOucjhX"V=Oǃ u.hX":ShX"POu0ShX"V O ShX"PNEW@z Ete[^_]UVShX"9P9ZYu3h"V謗ZY1t=hDg$V藗Y[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPV Y[{%=eh*A"VYVDy GShVO #jhX"V  1҉p1ShW t t u@hX"WZYZhX"WEYZhX"W0YZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UE-U -t@]UWVSSuE 8=$-u ^9uO tu QM豍ZYMuGCQo Wo _Xu s 胍ZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]á-t);4_,t!Ujh@-P-@ UWVS]= -u3-=---uP--Àu-%=ua%=tSSH-%uF -A--9~1!Ph-ZYu(1-K1=-4L-15-=-t1ۉ-UU1;L_,u PS_/EZYKHA$$Z%}e,+1-#1=-15--t-8 1ۉ--=@-vx u-x -=@-w1ɉ - -5-GZq1--8\<1-I1-E1-:41-)91=--=@-v6x u0-=@-x Z߀x I-=@-w15-1ۉ--8 u-8 o-oZ-Y1ɉ -=-=h_,y--@-h_,_h_,[} t9s RUVh@-Y Uuω_1-ItVh@--@-XZ-8=-t } -tPk 15 -_.=EPf[¡-u=-@-@-u"z-tމU&U; u C9re_,Ed_,E11ɉM@-9t)9s"RUuVE Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\--tPi Xj-)@P,--)RSP0P-0e_,8uCSm<XuSA -_WA -WZi Y[- -t{}t1-Ph-o-1ҋE7_Z-E%--9-s-u,15--/]1ۉ-Ku5-DY.-=@-v d_,8HuhX"(Zu͢$1-v-e[^_],e[^_]UVSQM1uu@-EQЀ w[jjjj uuuVtjhY"Y[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1-9-|@-á-t @@@ Ã=|-uUj11ҸLXUWVS|-t`_, 0_, -1Dž|Pt@$jjWP蠏VZT:QDQh!V{XZ$fSftxRPs]ZYx,E%=ufSfthP0YXhY"%Zud PX~P_,1Ƀx tA _,x t tlphX"h"Sz|1ɉx =|-u:pl)ыt)Px, jjxPhX"SSpWVo.Ve We XZe[^_]ú9-t9 -t 19-‰USR@-t>BE@-R8e XE=@u$-t t7tut g ]UVS=\L,u=-t =`-ut/--u ujjj5-RPV p-u)=\L,u^5---1ɉ --5---1҉-u H5zY6Y5--e[^]U]UWVSt e9ZƉׅu‰@-D--=-u0t;5@-D-}jjjG 1--ld8e[^_]UWVSQE)ơ-u--ǁt#t1 2ux%-Su5-á-ƒ-- t;x- st jk1j1Ztjh%Y"蹱ZYtV1VJ)Xe[^_]USVá-$N   tw #5x-jCP7tW6%I/f5d-S5h-5l-q1l-?E4x-؋]`--PS5<+u C< u-tPva Z;u 1-S-X5x-jPCP=|-SB1X];!t-tPa XSQ6-Y=|-ui-uh7Y"h5"XZMh7Y"P=|-ut71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉@-YYu@- ыuUS]t CPX]UPKPEEUWVS<--@-e=-t1-1x-|-l-=-t=-tj轳_@-t x@jBX-\-Yu*:t!u5-YBZujQ_=-t*:t!vu5-&BYujZ1-=-u1-=p-tjhY"1p-:͹t hS"Xt?uh9j::_X Ws^Y=-we{Ã=-Z-$/t.-7iCЃ . jS_Zdteht-x-|-^=-t1ɉ -d=l-ud-u_un`-ƒ@+t2tA!uI1D!-tȡl-=`-uLC1@ ‰d-j@d-]=`-l-  =tSZHOEa<h-1EЍEPEPEP虝l- tDFEĉE=h-u Pw P1_=E@Ƀ}XHNuEЅ:EPhY" 15`-HY=l-S贜l-YuSEЍEPhY"Ch-l-d-Ht!5d-h5"5h-5l-. RߓZt5l-j1ɸ/eu;&7C!$tZ%*t0@tg!=-7u-%-=t--=-7t%--=t-=-7g=-7tWjhY"j#]S h^SvRPσH=-7t(3-P_- tA tS u݃=\L,u yhK5h_,jYO =-t)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $Z%j1ɺ"7 x-19|-}h-1;x-|-|Ϗx-|-X=L-t5\-5X-G^_jx-19|-}h-1;x-|-|mx-|-j1;x-|-|x-1ɉ |-=L-u+;x-|-}5\-5X-YFXZjj5x-1;x-|-|x-1|-_jjQjj5-V=jj5-v1;x-|-|x-1|-=L-;x-|-}ze1;x-|-|x-1|-jj5x-1;x-|-|x-|-=L-u5\-5X-.E_Xjj=L-t5\-5X- EY^1I+x-19|-}-=L-u5\-5X-DXZjj5-K7 x-19|-}-jj5-8tFm謹G5d-1;x-|-|x-1|-d-Y5|-5x-F5d-q=|-y1x-|-t-x-|-d9|d u=t-tx-d1|-t-5t-5x-H_Xx-|-19|, Gx-|-19| G{RPEv=|-y15x-5|-5d-5|-5x-YG\x-1EȍEPh]#=-uEtEPZ9%tP-`-L--H--jYj譧8---1;x-|-|x-1|- - ---1;x-|-|x-1|-x-15-Ѓt+Ѓ$5- t -1;x-|-|x-1|- x-1_5-x1FP薶XdW[`-P-15`--L-1=--H-1-hP"?맃=|-j 4_,Z" =|-z5-6h"Pl u jh&Z"5-P7YtjhAZ"ԝXZj _,KU$t5d-jPoPt jhlZ"<;x-|-|x-1|-5x-_vt\,t4uj^;x-|-5"}Y"EȍEPhyZ"t jhZ";x-|-|x-1ɉ |-5x-Zi;x-|-5"}Y"EȍEPhZ":1;x-|-|x-1|-5x-XuMjhZ"@/1;x-|-|x-1|-5x-_u jhZ"V^ u 5d-RP>1;x-|-|x-1ɉ |-5x-ZJjhZ"?|15-V`2_kPYt VVT2d-1`-P臇Zu egjP1d-`-j1ɺz! =|-u) _,KU$t,"j=|- jhZ"[Mj1ɺZ"L_  1?PSq'@0j1ɺZ">^  Sq?@j1ɺZ";4Y u lpSrj1ɺZ"%[Ze4 t u.Sp_eD-j _,KU$% j1ɺ["^x-19|-}H-#H- -x-|-`-;x- |-} x-=|-+x-Yx-19|-}H-#H- -x-|-x-`-1ɉ `- a`--=-it Dj1ɺ$iSXZ=-tp-̯UE= -t@]UWS]Sj"XY1ɅxЍe[_]UWVSu}t ME  u aZE EE EuEE܋EEM9EEujEP5ǃ Ethuc;us^ -EPU9@%=EtPU9rtEt>WSXt1E9EsWQMS_ZHMt QXYKEPU8EtWH Zt WJ YWEP.XZ}tE)}+} MJx҃u̓@tAu= - = -B$}mu;-}Rj#;k-XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e= - = -B!5-V9}Pj#Rj-XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]U--|-r-]gUM U-y1E E["]7]UM U-y1E E.["] ]UWVS|-Et EjuX [^xPƉUY9E}jV4> XZu W XjjjW.MBu@uSgB W ^_VSWEW Mș}9u9tS/B 륉 Et;u{Mu {+u{Gt|3t|3uHVSY[|3Eu3|3nu,|3du%{GEtVD_u D|$W& XZtu h͢$Vh%WS;}tjSY^y S* ZPLX؍e[^_]UhX"ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'-<%t-tRPCY^CGjCŚXZutKH݀u=9us8Ft38Ft1 -<%t -tQPSRSCÃCFe[^_]UWVS]S^u1jjjSx4Bu@thVS ~ˍ19= -t)RP芨ZYu FSW_XSjW]ƒ =p-u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=|-!8u"P^h+^":PEyZYUt"^"RUAƉ$AYPAkL$QMWd_,Pe_,PURh4^"MQV8$W( tXUVAZUtRhK^"P~G Sh"PlV' t'YWY>u V' Z S' X؍e[^_]UWVS}1ۃ=|-u\W@X$S~WhS^"SP7VuPǃ VPDZYu S<' Y1W3' V-' XZ؍e[^_]UVS]h"SD^Zt(hP"SDZYth4]"SDZYƉe[^]UVS]SYuVS\YZu]e[^],~V&~Ze[^]UWVS u=@-h|-ZjXhcZ"Y_?|uC؉E-uEh"VC_ZECHtjhW^"!u[^Vuc?Ɖ<$Y?T$RUF}WuURPS6W% V% YtsfGftjEPV Ht-WqZKtcu_E18E h4]"|XBEP;E8E 0h"|Y^WZ;u S % X1ۉ؍e[^_]UWVS}u =|-j֐h^"nZY~1E E^"e[^_]sVWS>E4$=E<$=UMT$RU{EWVSURP4$WA$ V;$ E@u)$ t]e[^_]e[^_]U|EPuaXY1xE%=@UVS|u=l-u1V[t&V-=$P{VPTLhb,\|PVZYy VjXG1ۃ=l-uu#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=-u2=-Pkd-RPWVcWV4Ɖ׃ - D-uWVcY[uu}-Eu藊t ub EUcuu3uuEUEU9uE-$ uuP&EU ~ÉEf=\-Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃ-g} t}uS*(EƉ׃}s}t$ `-_E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉U-襅t u`Ɖ1- \-uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=\-t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&=L-tM\RPj =$ Mj}!SQ{&uu+z^=D-tMWVuuRPEU$=-t;}t5 u-t t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1=`-jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=-ukd-9EE}11軁 D-uEU)juuRP蹁EURPǃ[^y=-tLۂւ t u, u-<ͅ u@)蔂-訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃ-Ex u5#Å^IJ `-MCEă=\-XmRPSO!Eă J…u =`-~1҉-uȉ}E=\-u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=\-t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=D-t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5HL,=LL,΂Hw t5PL,=TL,e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S=L-Ee[^_]3rWVEZYt1ۉ] E^"e[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuE-)HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPh_"jWI_"5j PWO‹ 9u5"%`" 4-Ze[^_]Ë-;-~~- ,- -‰-US-X-0-H-[]É19f,t @uUP`iYt-t-tܫ-t-UWVSd-UjS[ EjSP }tUuu YXtP5 -} ljE5$-5$-_ 5 -T E -E$-d-XZ1e[^_]UWVSÉ։9d-~ -$-< +t[^_]UWVS׉ˋ5,-V,-Љ[^_]M=-tt*ttt t XÃ=p-u[USjm5-pZYR"t:t1ɺNC=-tlc"t1ɺ*C]Uhtc"讽-PYZt -!hc"艽-PƽYZt -c"jh=U -jh,U$-d-h-h-ނh-Ԃh-ʂ h-轂1-ZU1}]á--U(-1-1,-9(-~" -,-$-1ɉ ,-@1------|---------h-(h-h-h- h-1҉-UWV=|-uu uƉXZ11D- -u=|-u u$ZYt-@=D-tʺ@b PL,TL,D-ut79MM |-M9 HL,LL,U |-@x@-c B-9-H1Ҹ WVY^1 tj uVRP;FVƃ1-)9~1Ҹ G19tD=G1Ҹ --e^_]áD-t-=|-u -DUS(-9,-~$$-<u -Ph-€XZCԡ(-,---]UWVS]u }Eu@0tjxYEe[^_]= -tW~Z= -tw/P'x_uSQ~[ۃ,-~K1S|YuSWV~_ZV$-t2dZYu,-$-DV c_tW,-uVb^ƒt -V$-tcZYt t-t-t-Ӊ؍e[^_]UWVSEUMЃt-} u)}u#=-M-}tuEPjEU RPu ugu=-t[-tR E@-D-ut;UE }EU @-D--u=-tr1ۉ-1D=-uf=-uJ8u u1ɺZYG9{Ft-1k -ك}u E1O - ,- E1~RjEPy ,-1҅~ $-TRPuu&Ã=p-u}u9EEEE55-+5-Ee;5-'EPv_`-9-uY=-u=-uEU --1=-~+9=-~-81ɺGh-w|Ym19}E81ɋUG`-9-|1}uEPh-|XZ(-9,-~Չ19(-~= -   $-<<@B)5,---9`-}1ɋ(- JKݸe[^_]UWVSƉP[=p-t<-+-;-~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ19x-~ -t x-)C1[^_]UWVu} =p-uWV1ZY ie^_]á,-l--h-ál-,-h--UU1wR5-ZYUS]1w%SZ1uS5-ZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6%9tu!ـuJ%u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} -E-=p-uuS-Zt -1--dSPEZYtJHWVM^_-xt -Sh- yWVMZY5- 1-Sh-xh-k- -Pdyh-x-@}-2 -`-9-}%h-xX--=`-9=-| ,-,-؉ESjEP8tU$ t9r)ډh-w5- 1=-[^0-t -u"uu} U,- p,-~@9(-|  -|t $-D0tu u. u#uWV11ҸJt1Jutq -ЉERj]S*sƃ  -E9s=)У,-RjSsNj$-,-?4WtVL)-~뫣-m},- -= -u-PapY,- $- M9u3_u(t M:-t E)M Ma_uM -UK_uFM@t>SrZt -E),- -PoSPYtE u1- -t =-uuu} U -+-4g, \-~9|0g,)ș);`-}sd-)WV$U ZYu K= -tw.PmYtu} U؍e[^_]= -t+=p-t"SqZtSarWV WVMUmZYe[^_] UWVS]u }-t4 u ti5-5-1ZYt 1- -t =-uVuR=|-- 5-=-1p-t-_@x-1ۉ|-i뷃= -tH=|- x-- (= -t|-unx--ÀuWV1҉ZY%=u+%=tSl|-5p-=t-_1%ul x-Ax--9Ph-'l[^5p-=t-th-lWV-. 0x-1ɉ |-uVf,SxXZ1jjVM u뾍e[^]UE1҅x f,]=-t&-tUSJZ P+JZ HX[]Ã=-y-U=|-u -1|-jhc"A5ZYá-xW@d-UWV1ɉ -5-=-,9Ɖ}jhc"5-XZe^_]ø- @=-u1---------1҉-----1ɉ -UWVS EE} MEE--t"C 9Ku}9{u E9C֋s--t - 1-ЉpHMH MHxC;4-=-u`-PHE8}-t'Xp9ډ} EӉEEډÈ}tE죴--@B [^_]ÍL$qUWVSQQEU=|-t E]!@u 111]9؋]ع5--tF U9V}}6E9F uE9Fu N^*--1=--~t-uF"HhKU$(V(h?"( TEj舦C'j9jWj"Ejby uXh"Xu>h!:tu R5_UVXtˋURUÉ<$L$QMt5蔻WPURh$MQSu W _urVZ5YSfS j(u@ujVj8}t&u'hc"'X,j &u& VC-u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jhc"h!SXtYXujhd",XZFhKU$&S&h?"&A%j 8jUjj }u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuV,vjj j`Ujs7B-jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k -GPw'k -1-'t'-#tUEEPh"d"**YX1ÉUS.w$tX-'^--1--- -tP X1 --mNt jh4_"g-K - ----jh-{/-- -Y[뉉txux ujh9d"5)XZ1]UVS -1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5-sS CKCtP7 Z1C-e[^]UEt*xu x u]?@ @-]U Pu]jEP-UEYYut@ - -$-(-E,- -tP Z1 --UWVSPEf=-uJ=(-uA=$-u8--1$-(-d-,- -tP _15 -{u#jPs蓾Cs 1ɉKs {SC;-u RWV UP號ZUte[^_]UQMt-9PtjhFd"&XZP@ UVS]u -1k9$-u$90-u9,-uPa~#4t P'@5u1҉[^]UU19$-uǀ,-ǀ0-=u]UWVSu薾[1(-t:PPVl uE$-(- 1҉(-YS Xue[^_]Ã=-UWVSu h"u - C Suu0-ue[^_]j }WRP` su sʽXh"VZYtVWsPh_d"uUWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=-E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtP( Y1Cu,CZe[^_]USE] =|-t1E End"tS_,l-XLt1ۉ] Ed"u=@L,x1ɉM Ed"^S*ál-ZtPz XS茫P軦l-S` 5l-K]s@=@L,y1ɉM Ed"]J#l-EEPhd"4#XZ]p-s,x$Ujh@BRP-RPd-USEtzE 8.MU u4@E Qhn$RYs, }t jhd"}Qhn$RC }t jhd"kd-s,as,yd-EEPhe">Ph%e"j ]SS~P|0uD]EPh,e""XZ]ás,x$Ujh@BRP-RPhH-USEtzE 8.MU u4@E Qh,"R<s, }t jhRe"}Qh,"R& }t jhje"kH-s,as,yH-EEPhe">Ph%e"j ]SSp~P|0uD]EPhe" XZ]US] }u!jSŽYZt]EPhe" XZ]US] }u!jS^YZt]EPhe" XZ]UWVSUE t tP(0-^w=|-t1ۉ] Ef"e[^_]/ P['PR蠗?UZYt]e[^_]3"SƉ׃utS莗5d-WVe[^_]USEU tXtugR%(s,YYR&ás,Zt=s,tPj XS|P諢s,YX]]H s,EEPhf"QXZ]US] }uC=-tS'-Y,@-h͢$rrSlrXZE@]%r]UVSE] ,-E(-*,-"tRGYEEPhh"XZ]UEtHw1E Eh"]x-]U}u= -u]g.]Q.]UEu=- M-]UEu*=-~!EEPhh" -XZUEu*=-~!EEPhh"-XZUEu#=-t=-to5Bu @u]]UUE t#u?s,^u2@t+s,!s,PJFEEPhi"@ US E1ɉ - -E 8,t)EPh(#E P }t jh-i"3-E 8,uf@E EPh(#E P{ }tjhEi"XZ7-05-5-h^#j]S]܍EPh_i"u]UVSE] J1 RD+~vQQ r/d~Q wG$%t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPh|i"1CSPh-Y-E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPhi"XZe[^]ø=`-u=- 1=-áh- -+-UWVS }8uMEPhi"Y[1bÉUP$@PƋUXZt=0-t <\u {t C<$ut PW0ZYtFFC؍e[^_]U@uPhi"j*h`-PRhi"j*h`-k`-UuBPhi"h-:\-UU1t 1BS]UU!t B tB]U}ou<¸d"u1]1=-U-.EEPhi"KZYUWVSu ]E0`_18-u@JЀ v#tuKuEPhi"&j uP yu˅tӉuEPhi"Y[뾅t1҉t؍e[^_]UWVSM-tFPtu)QjP_XD-ZjPEP 15-1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7Z9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]Uh}"zYtP:.Z~s,øU =-u[h-Z:ZtL1-EEEEjEPj M9 -t-_k--;EMMEEE=-t=-t=8-us,=-tuPjEPm EufE=-u);>s,9u -&P\Xʃ=-t ƒftըu1ɉ -uu u 1҉-=-u&u-@-~Fj.Y<1҉-y!d8mV8#_M9 -tu1 -Ujh-8UQEPKEUUWVS0u u5É4$+|$WVuhoE"WP&؍e[^_]US]SD ZuSh}"h-O -]ÍL$qUWVSQ Yq AQEU}WRPq1pˉE؉UM܋EuƉeWuuRPDpu؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEP}XZUSs,@-t,s,@-Sh@-5s,{ 9t -]UEs,]Ã=(-t 1(-s U=s,?-r|s,Ps,M1 -E]UVSP-t -E1$-EPSXZt'u> E$-Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRPqK}Њ}" u؃}yC-^SuXZeY[^_]aTUVS]1)EM}I}"uyA-NQu XZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%(-e[^_]US5à Hw ot tSRX]UWVSu} ,-ouWV"XZE e[^_]$=4-u`~h-WVhs,n-\B1s9- -e[^_]@UEU E 5"E5"}"]UVS]u .uu ]e[^]s,P-ZE }"E}"؍e[^]KUS]tu uR4=YZtg=- -j ZQuj>X؋]UWVS]uE %=-t >t:S$PKfPjjjjSPwf$9twV Xnjjb1=-1҃=t- PSW ÃtW贮 _}t-jh}"[^tP6芮 ZY>1؍e[^_]US]tP3Y ZY1]U1}]UWVS|}ue( u [E E-x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$5"E<:N<%<.uFu RPY[ +!@ *u5-蜋_vG9^.1u؍U؉ƋU؍C<6$% l-1Jk`-RY19- -{9)ISQRPd[u  u11ERP[_19r -+ -ISQRPRd1h-N5-5-P5-PDwSJ x(t u(5-pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ-wtl-1&t jg#EV!;5-KZtP X@=l---e[^_]U5s,US-=-t¡s,u`-PE1҉-]U5s,*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tP贠 Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH --13CP 1ɉK^։UReZ9Us&RUjEP!P Utܺ1҉S -t -SuWV>ƒx6Ct P| 1CZV@$jCVP{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]-uU5-Z1=-UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} Uฬ-9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5-jjWuE)PV5-5-$'e[^_]1----UVS=-t 5-}uuf-1ۃ=Ы-uDSgYuu C-H9RPSjY wyr5-e[^]UWVSPL,ETL,E@u }HL,EܡLL,EHL,LL,PL,TL,=Ы-u e[^_]=-t11-H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v T VN ZY1CCC ----e[^_]Uh-XUS]-#t-=-ujh~"XZ]1=--E]Uh-'XUVSu] t1ٸ-t;pX[^]UWVSEUE|E x-p$l-h5d-u-tXsmS. Zjj1CCCj y]e[^_] -C--e[^_]U€u1=-1]UWVS4--EU--E܉UtE؋M܋]MjEPjujuuu $--u}u܉}Mut}9Nju|M܉]E܋URP ZY--9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EU--E܋U--,jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1-=-u]]USj5L_,#ZYt8jٸ-Xx =-u=-uS1]U=-u ----]xUWVSU EEt :CM@tE3- s+jh ~"Eu jh~"=-=D-=-1ɉ -MMM1ƉӃu]5d-+PXZe n=-=D-jh?~"_XE:jx^@=-@1ۉ-.1EPM-Zx- D- j1-#X=-t =D-TƉ-u}tp-xu }@u}uQ-HEP5d-X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=-}W؃&MxuƉYjZGMEPjEPjuujjE Mt=-t =D-tZ}~TJEu2EUutjEU9u9t5d-RPy =-t =D-tjFXEe[^_]UhjA -XZ=-t.Uhj -XZ=-tUE]Uhjڠ -jjm=-tU}tOhj衠YX=|-uPj脠hjxjjohjc 2jjUjjLjjCjj: jj.XZUWVS-1҉-tijj/jNjjjj؟BjPL$hj輟j- tH=-5-y9=-u95-t-@-h耲-t=<-tj"Xe[^_]UWVS E։ϋ-SRU萞$EuUR u.{tUM tuWV袠C SXZ1e[^_]UWVSSE։jj)u$@PCuPDs {E C}u1C%u$@PCuP؍e[^_]USs,s,t%CBs s S 1---]UWVS5s,'Vh*A"PӘ赃 Z1ɉ -[ÍhV荬 i!tSV, uNJ< t< utZ8tPt u9_8bPjP蛾 u1Px^u ȋ8t6t2\uG@x9tzP‰1Ҁx$‰uH11WQщ‹Ms,s,Ps,-ZY{X=-ts,--1e[^_]UWVS u!b1ۉ-s,s,,TÅ515-hQ~"AP>AZYq%STYu莚Z|lj4$r$L9QZVh`~"PQ9tV躀 Xh*A"W W覀 f;?SYSjjщ‰s,s,Ps,- VhPI th=-t,tVXGPd_t u Ƅ@t V2[ uP- u,DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBVZt1---%s,s,t--1e[^_]USs,hk~"S<ZYuwhq~"S$ZY¸t_hx~"S ZY¸tGh~~"SZY¸t/h"SܛZY¸tjSDZYxPEX1]UZu E ‹E2ttHu jh~"jh~"jh~"XZÍL$qUWVSQ -p x tWV虛ƉY[jj1EUXZ-uBEPEPWVNE؉U܃E EtEU}u}ujh~"=Y[=|-tuuuu誗=p-tEUju4P4ESj:jEPuuS"4(eEu| S| XZEЅu u؋}eY[^_]aUWVS- -]11~1t2s,t AFKމt - -[^_]UWVS- -]11~1trs,t IFK݉t - -[^_]á-á-Ë-tUrIZøUj3Zujhh"BZYyjPBZYxU-]øURSjEP5-hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPz Z1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3y XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV4M9u"9uu uEZYe[^_]Uju蕒jh-UE=4-t&uf=|x,tE~"]H8-@]]UVS-1=p-u-1(hAj XZhAjY[h-^tTjjXZjjבY[h#"^8-u !15|x,=4-t j[P ֋5-t,t,PV,ZYu8-8@1ۉ8-~"Z8,t@8u݋8tH5-R8-PZY4-@8tSXh*A"5-貋^Xuc5-h !qY[~"S$S5-I& BP5w,P^ZtbShVP Nhl"%P#^Zu @׀8 uSY "h"P#ZYt @׀8 uS܀X"8t%8,t8 t@Ћ8tH5-R8-PY^4-t S^Z@8-P 0"Pe[^]U-jjюXZUhj辎x-XZU!-jh`- `,Q`,y ;p,| tX,J X,UhX,P迋XZUWVSREƈEj}W5-$ f=x,tk1x-5x,/ejW5-T:je=x-t.V]"Ph7"輅 Ktjh@-5-# 럍e[^_]USQhN"jj薍jj荍| n-Åt4EPZ9u< hT"PjjKjjB]jj4jj+x,j/ShڅtPjRSh,h"_hY"jXh,h"Dhe"jXUSQjhV#5-7 f=\x,t#E tPE Z+u}f= y,t WVh?"WVh" jh-5-.h`-jjL|e[^_]hV"iX UWVSEhVh"F 'jh!5-<.jjjj h-jj{(jh-5-G/"à yh"X11ft#jƉXPbY~G9uAj5-ajXjj艂jj耂V Vhj"Uzjsf=|x,tj)RPh|"ejh-5-L-h`-jjzjj jj XZe[^_]UWVSE[hVh" 4jh!5-,jj豁jj訁h-jjgz(jh-5--k!à yh"iX11st#jƉXPY~T9uNj5-1`j5-$`j[Wjjjj$VVhj"xjZrf=|x,tj)RPh|"jh-5-+h`-jj|yjj覀 jj蚀XZe[^_]US,]S5-w]h!u`-u M e`-Sj5-yh`-jjx]US,]S5- ]h!u謃Eu %ESj5-x ]UShSh" S'Ew,[tEw,jhg#5-* Ux,tUx,5x,t5x,5x,t5x,f=\x,t_x,t$x,f=x,th!hc"uY%y,t%y,,y,D-5y,t5y,jZEy,t$Ey,f=Ly,th!hc"X]Ujh{t 5-$oj[jhzt 5- oUS]Q1uN!jP&+XZ]US]CStu RZYt1]UVSEh"PZYtP7]^yhd"^[Ph"hP=t]ƅulx,uQ$$*$*X-Z*$*1ɉ $Ph^"SSjuu*htA"X*X~*X1k*$h`-4)à D*XPkY9u tth,h"XZ댅yh-"xuPh"uPh"h,v Cƃ`-_-8 u =`-vH@`-e[^]USErjPh-h߀" uxh-hhPo(-yh-h"sZY?hSh" t h-9X5|w,5-S ]UVSjPh-h"] h-h-PY[vE"e[^]Hu --5-hhP'Ãy5-h"rXZ+5-h("hVWqh4"SVe[^]UEjPh -h߀" uXh -gh*A"Pu uh -h6"@rXZ)j5w,P f=x,u-Et2UVSjPh-hH" h-h-PY[vEO"e[^]Ҹ-Hu-Rh*A"Ptà uVh6"qXZ@-f=x,tPhg"Pho"hV pVh"S e[^]Uh,h҂"jjUWVS}<1ۉ--x-%1u~11Ejh u,hJ"u u0O=-uh,h"(j"jt&`'FtrE96/ kU DЉEx-뉃a$Ĝ%nEtPt=l6WwYvh"Z?95l6jh!V{ jh!Vz h#"V{^Zƅh"jrCl6h{$Sy{ZYkh8"Sd{ZYLh#"SO{Y[ÅhDž"뫡l6-l6-Em=-t hڅ"sl6j/RUSCYZUt -5Rhc$h- EPjhjjjj5l6Vx-U P5l6h"RWD-teh+"tMl-p-@-=-1vldZRp,E)t8HuR}t hk"KE h9c$RUyYZUt-"l-p-@-h%juh%juh%juh%ju 5x-h"j h-9lh-u h"@u h"jhX,[EXZtKth{$ h8"h#" Xt 1N11҃=-1x,Ly,=w,1ۉ|x,=D-t ,y,=l-t5x-' Yu.t hĆ"j=l-u"5x- Zt5x-h"j6@e[^_]U-jh-U4hJjntEXZu2EZt1-=l-u!uj?tYX=-h-Zu(j h"RZt8/t P % Xxv,|v, "Shtv,EPo, ƃ 1=-t6--|-l-1p-=x-u'x-%;/u%-jSoY_tt-t t u!hF"Sh"趀XZ h%"言_jtcv,9u QRPa. v,Euڃ=x-u hx-h,E#Ph0 @u x-%ht-h%$uF0 @u t-=p-y15p-=-u\)j:hw"uX$ 1҅‰p--uShz""t%=-u-=-u Sh"j<j:h=$u# D-=l-u3-tp-tR5-tZYl-|-j:hO %u# t x,j:h%u}# t x,j:hK"u]# t Lw,j:h"u=# t1Lw,j:hga#u # t \x,j:h"u# t lx,j:h%"u" t |x,j:h_"u" t1|x,j:h $u" t x,j:h~h$u" t1x,j:hy!uf" t  y,j:h=$uF" t y,j:h"u&" t@-j:h#u " t Ly,=X-u X-hv,=d-u d-`v,h-t Ph!|^_`-t Ph9!fY[T-t Phm%PXZ\-t Phx|$:_XhP-h$u- @u15P-hL-hb"u, @u1ۉL-hH-h ="u, @u H- -4-8-4-tj,S:ZYt@-4-؍e[^_]USPh"h,~hShه"h,nhj%_U=-th-htj>^ joU ,yh,`Zuj,P,=p-҃ !UjjBm|-hA"*jh -_Uh`-jje Uh -jje U E E1ɉ |-hjlEXZjjlEYXuh]#dXZh -YtnE sujlYXujlXZ=|-uXE M9Hh,^ZtU < tU EE9sE @E ,xˡ,P,UE Mtt @8u1]UWVSu--FVtI)~@"t8u\Q ^@P u f^?봈@-[^_]UEP^v-^?<tP@-- ---]UVSEPh "cXZ@t,;t[Ct =-uGw,PPh"bsC <Ƀ*PZVQPh"b 렍e[^]UVS,u]S5-GVS.#VS7#EԀ€Uԃ=@-t̃Ef=Ly,tMẼeewfEf=x,t %‰USj5-be[^]UVSuU ]=p-tSRV y@19t - @u8u h$"EX$e[^]Ke[^]UVSPw,EÉ-@t,t68u-Fu#EPPh]#SaSV1%tك 8]tjEP5- Íe[^]UVS!S 9X<uY8C L{ t VWgZYtAEPuWJ YVC Zu h"Xc9s ts tC Ke[^_]UVSáT-H!vd3V4cYT-T-Swt^'`,H`,x&X,PX, T-PT-"~;p,}hX,j `XZf{ u<@T-`,H`,y;p,|X,PX,!hX,j!Z`^X3h]#ZY[{Vh"ZT-C ^ZtaP;T-s Vh"Z>Vh"ZT-C Y[t'PPaT-$h]#LZ =T-"~1T-hA"BZe[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>#"t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]hv$Se^_ug@w,; CteE0ƅUB@tUQMXY9MU~ R"QRh$h,SÃf"h,j jXZe[^_]UPPPh"h,Sw-t@th-XjAJuUh"hȝ%hqh"Y .UWVSSt Éֺ,%"hь"h%hh"Yu :u!USP\ZYUu=-e[^_]VShތ"f`jIUEuh͑"h%hh"(Y@0hܑ"f1UEuh͑"h%hh"X@0h"ff1UEuh͑"h%hh"X@0h/"0f1UMuh"h%jTh"X11f3A@=uUVSEu ]uh͑"h%j`uh"h%jah";Xt0ffPhÒ"NfPh"Nfe[^]Åt$1ɀ8u"UJRPRP 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4`%YZYt4G (uh "dhQz$h\#h,P d%E24`%h"h,YPC uh,j \g_X<sR@8t54V/@WT$WVJVEPȍMU1e#sj@HEPwG susuh0"LuhF"LuhS"Luh^"Luhi"LU$19d%t@ uRh" 4`%hu"L[^}tEPh"iLZYh0)uuh"bX,01e[^_]UWVS]uh͑"hP%h{uh"hP%hhٓ"U11{ uh"hP%hWVhPsu s h1"=ts h>"/bZY1=߶xt uh"aXʍuu-WVhPsus hW"노"=thPs hd"a^e[^_]UWVSSljUQX0 ^t#u uSuW;Ãu V8 ZHWu uSVWX9uSuV u V8 XVy8 ]벉؍e[^_]UWVS@]uh͑"h@%h8C@uh"h@%h9hٓ"$S{ uh"h@%h:߃uh"h@%h;ŋuhД"h@%h<뤋1ɿ 9lj}Ph"99|CƁ t!Ph""_ 1jjh V= tS h fUtts h"H_X1jjP9u 9t-uRh1"PRhP" tu@ku h"Mu h"m󥍵ѶxԶx9t PRh "`3hX,]jR1҉ R8t.Y^t4%h">XZh">X19s~D3 P=FXh"C PCPCPCPCPCPh"= s hܛ"=KSCkVkVPQRPh"=$sDhS"t=hx"j=s@ t h"R=Xt h"B=Xh"JSH^7t tt% ntPh"<ZYGLe[^_]Ë `,Q`,y ;p,|< tX,J X,UhX,P;ZYUPPh֡"h,8jY/.W|$wUWSˉ1҉.M]m H0%h}fU fUm]mURp pSQh},0h"h,(8$e[_]g_UWVS]E }܍p(}p4EPSdY^tShդ"XZe[^_]UWVSPu} FM% FVFt5RPW&à tF H1ۃ8t/h},h"X[XRPh},-à tŁftvWZYt#/vh},ZYu}u2}u$h},h"޴Y[}te=.u\VlUUG1҉UtRWZY@uT9G8-tRh},ZY@u"~lth},h"p[XuVh},VZYt؍e[^_]UWVS.dt2h},:}h},Epd h},!jjEp` @Euph]#ͳ_X-xP=.t . .t 5.t2} F=.u:xPh},ٴ[^@} 1ۃ=.h},h"h,S5,H, yh,-Y,P,0 t+@t( ,y h,,Z,P,Ѓ߃Yt`_(,h},h#觲` DždWxPh},S[^@t1E%=tEjhGPhh},Bà uA 5.uh},h]#kh},'{GPhh},ÃtNjOGXW\X\t;X\E@hDžl},X\ptX \TX9и\T<0XPjj`jjPjTjwXP X1ɉX\vRLP)TPS> L9th},h]#蘰XZDžd:)։1X\=.tX\hoPT9Y^Eph]#%XZ=.Džd1X\t~hh .`ƃ ~KVh .SU 9th},뎉X\=.tX\htP`dXX=.u`MXM=.t#S`Y^th},h"6XZ`^du S[z.dtSWLZYd=.um} tgG t^.9GuTxPSY^th},h]#詮XZDžd$E9Gu.#G%PSGY^uS[Zth},h]#][^Džd=.tWh},9ZYde[^_]UVS]hVs u sh7"'Ƅ} t'h},vZth},hD"ŭ[^.h},V{ZYtVhO"١.t jsPZYe[^]US]} th},vZt h},hD"sh},ZYth},h["=ZY.t1E ]]i]US]} th},vZt h},hD"$s$s sh},th},hf"ĬZY.t1E ]]]UPPhp"h,.jP%UPPh"h,y.j0%UWVS|Ӊ΃=,/u\P=0/tЬR|Y_u%=@u">|h]#XZt#h|V% =vQZVSY_u%=@t=8/u^VS__ZuQ%=@u?V? ^u=?XPSh$hS@)=΃=,/=$/|8/uVP֫ZYti|h"UhSW$W+t=|Ph$hW(VW耫t|hɦ"菪_XVSZY=,/S|}5^_uS|hզ"L@ j/| ZY|tpj/S Y_xt@xxV5_Zt=@/|)~=@/ix)؉t=9|u fDž.Nj|ƄPRJZYkx9Íu fDž.׉ދt󤋅tƄxPR^_|9;x9 ;p=4/hX,Sh"h,*,H,yFh,"_H=@/=4/uS|-ZY=4/u,P,0t- t( ,y h,"Y,P,΃߃Yth,h "Ŵ=</t%=@uS SpZu4=,/C1=0/ PSj|j<tS=(/u1#| /PSh"&޸e[^_]UE TET]V2UE MQTU TE];2UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]1[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]F1[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_]0[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]?0[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_]/[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]8/[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_].Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_].Z[^_]USU EAHtRSHtG t uF u:] M[]9t=/uyDutJt] M[]%/1 []UWVS(U/ / d/01d@DHLP4TX\x|hlEE8jj h5" SQj]S豝@u h"jShʧ"XZ=5/FډWVRP0"=/t"RPQ e[^_]Ë `,Q`,y ;p,| tX,J X,UhX,P XZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpP/tvv Rhܧ"Ã=d/=/tBjj h5"v\vXjUR2@Uu h"jpRWh#à L /AF`VdEUQRuu!ܧ"=/tԧ"RPWQ?Ã|/ x/Et*=/tU]Ã=X/u=T/tF%=@u FaÉ؍e[^_]W|$wUWVSEUEP\EZuE"EC u=l/tECu}EUE؉U܋=/} /ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut'C  CtNV [[^]UWVS(]jf//X=H/uEԃ}Eԋ@ ẼM AqP=/tvv s hܧ"0=d/F`VdẺUЃ=/tBjj h5" RPj}Wr@u h"jWsh# K /AEUЉMMuuRPf{ܧ"=/tԧ"RPWQEPvfEԋxvs$EPh"X=/u7s,h"= wsh"* =/twsh:" F%= u9N % 1RPs4%1RPs0h " dVXN\=/t3jj h5"QRj}W"@Ws(h#  "{(ܧ"=/tԧ"QRWPb =/tF(V,=`/tF@VDF4V8[|/ x/Et"=/tMUF=X/u=T/t@uZF%=uE@ Eԋ@ 뗋,,Sh"0j@$,/x/Ht u hЬ"jh"jܛXZe[^]Ã=/<=(,/UWV,wh8"j薛XZ=//u6~OfEEEPhm50,D y/~uz1=/]xl15/5/~SuOjjj50,xFjWVRP})WV50,x(,"1ɉ /=(, hg"h"j蓚XZ1e^_]ÃUWVSPE1҉P1;EE (,/jjj50,KƉ׃xtEU =/u/] /9É}EjRP50,y%kh˭"0jК(, )}W =/t1e[^_]ÍL$qUWVQ1y(,I/u9h"9jjj50,My(h*"0j (,)y11҃=,,~hW"ZjRP50,Th|"~B/19}oMQRPWV*U Uth"j茘XZjfEEEPhm50,] yuVh"0jC'(,1eY^_]aUWVSX,=,t,Pq+5/= /X u1=x/=,Oh"WV5B/5B/蠝RPVh®"hWs5B/5B/hٮ"hVQ0WVh"hV6}}t^=/tU5\"h4~/t/CFtP5 /7XYZy" /Sh\"0jK=|%=@t5 /h"j&~ @YA%ma=l/u )؉h%'2\yDžlh/BSZth/&ZtX/ L/u#h/%h/XZY )P1=///PV 9hsh/h"j3}tPWfWZYuL/=X/t:t:4y밉؋]UB/D/=,u>B/t5=~~ h~Ph("thPhV"jy@5/Zx%B/B/B/B/1B/B/1 yB/D/T,~B/~UWVS/t h"jfB/=B/T,uB/ yIB/+B/EU EUT,EEuuuu|u})׋E9ƉM}u}WVMZY+u}B/ T,19}dB/ B/B/;B/s5B/PY_B/+B/RP_ZxhB/Ɖ5B/T,B/ B/B/T,B/EU)B/B/1ɉ B/ B/z,h"jwXZ؍e[^_]Ã=P,US=,uh"jvXZyx1ۉB/B/15T,5B/ZY~%B/B/‰B/B/B/1+P,~C9}Ph"jTv yu뙋]ÃUWVuM B/)ȣB/^_]UWVS$]CDž$$ x$|$x $=@/u15xPu ɲ^_y狳 Vh9"0jmvPu蔲ZYud%hB"0j(vۉ15T,5B/u 跁ƒ B/9|Ru -WQQRu<9uUy%Vhj"0j@u79|$u9x$t h"jtZPu ,ZYylVh"0jtNjE49}u;0thȷ"뗋9}3t)1;x$|$}Ru ye[^_]Ã=B/t1US5T,5B/ZY~'B/B/‰B/B/B/=u.=x/uB/1$x1B/B//]ÍL$qUWVSQ Q1ɉMM u15B/=B/)9}Ή5B/)ډ tƋB/]؉}܍MQWSRPtƉ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}B/B/19<B/+B/щ9|gx t%u؉}9}M؉]܋EB/+u}뢸eY[^_]aUWVSU Ӆ~HB/+B/U U  )څ$ 9~؋5B/}5B/)É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu Y[u]%2dhB"0jqۉtE1҉P`1h9Ɖl  B/+ B/ } ^ș9hl}hdSpPtPQ5B/u O]hlS} yE] Cpt1;x$|$5B/=/0\t`A9\u\B/)hl} xdptZ;x$|$}L pN;x$|$Vh9"0jl[B/+B/~b9}P5B/u x )B/19|5T,|^y t h\"UxPu &ZYyfSh9"0jk+0}94u;Eth}"jj 1tShK"뮋U Ze[^_]UVS]E xz$usPxZyVh"0j*k$tAP# Yy$Vh̸"0jj$N 1$/Ze[^]UVS|]s|PVDXYxS=h/t1F $M9$$u0;|u(,$U90$u;EuVhݸ"jki 뻸e[^]US|]EPSCZYy1=h/uOE%=@uEh-$SZYu\S8Yy} tySh "0ji/S Zy5/菝GSh̸"0ji̋]UVS]EUdh1ɉlE Upt1x}=,t =,|PS~B^ZuZ=,u#EUdhEl=,uZY=h/t1|9Nu*;xu"F M9Nu;EuWh1"j0d BE%=@u8h-$SZYt'S:YyTShO"0jdjSZy-}tӸRMtvvS uSWZsZYu1}tuSWh`"Rjxd둍e[^_]UWVS|]($1u(x$|$9ȉ}$9$U  xWVU=YZ@t$E%=@uVhz"jb KjAZe[^_]UE$tH $E] ]UWVS]E U$usPLpYyVh"0jWc= /u($=$/t8k<$8$V =$/($ttC($5($=/u(j脝/Py/XZ($/!%PVY_, ,t%jjL$H$X$T$V$tG{WVpYZyWVh"0jPbVV$蠧 1$/Ze[^_]UWVS]Ct1$H%#($Njt1lp$H$%5/h"ZY=D/xPV:ZYum%=u[hRVm u/tVh"0j>ap#ƄWVZYp` `D$@$WV耝:WVToVh"V P}nZYVh"j_ U%lt lt)w$V#pZYxDžl=(/tVh "RjD`뒉l<$8$VO lxDžl0= /u =$/tCi<$8$Vy =$/t#($tA$u($(($$u ($.($($tbYX$5/h"jYZjVYZxPV8YZy+thA"0j_WV@1$H%# PVXZ=$/u ($j$/ , ,t[j $P3VA=,u =,t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSuFu hY"E18}t}t://E/6SVu譽 9u hw"i//E/ҍCtPRH XY P Yuhi"j%\XZ>CPVЉUP趮EU 0j\̍<+E e[^_]UVSu] }u1NjjjV̬y 1Sh"jh/V g yShw"0jt\e[^]UVS]u x@P,iX=\/t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu g ~ pt1@9uNjt9|$up9x$th"jsZ xPu 莗ZYySh9"OT$9X$u;t h"jjju y$}Shܻ"0jZp1$1e[^_]US/tPO1ۉ//X/um1 ,yh,sYu9,P,9Є,uu%1S / t뭅u tډӡ/A/u/ @/tϋ/zyP1ZO밣/j5/h/K/ &1]U=D//=H/t/=8/t /@=/u'h T /Yuh"jjXXZ1x\/t9UVSut>uh%"j Xuh@"jXY[FVٷZH~ 8/u3E ؉C1C=/u//X/1e[^]á/t@=`/t /=@/u4=p/t+UE$u/tjP5/S US=\/t8/1t6{u+uhg"j(WXZ3h"h, [Ƌ]UWVS]=/u =/u$15/yx5/M/YtHHQf $%=\/tȋ@PURURpp p0;9xjjuuuu/pph"j6Vph"hμ"p jW Rph"p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=\/L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPDa y$/p!Vh"0jUƄ  ǃ$h /pCPh /rPܦ5/h"' t1/@8e[^_]W|$wUWVS<ÉUMMQEPu}j, 9ƉЍM}Qh"Qh""j@S|Wue[^_]g_UWVS\]uCE=T/uPh"VZ ue[^_]}W($mmT$X$E(j8$Ej<$Uu5"u5"PjRj4$Wh."Vح$ w'@$  R%Ph@"|$x$hK"V艭uEPh($Vt$Pw ShR"u Sh!V> Vj IZYVXe[^_]UWVST]}T$X$uV($#lSWVhZ"aQe[^_]UWVS]u fVfuP膎Zt%t0SRjP}W3VWH7Cۉu ]e[^_]07e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=P/!u%UP/hc"jMXZ1ø1UWVSSu] E}MM1҉l6=/u0K //9-u B/ p,=/u" /Q/u //1Ҁ=/t7tMM}E] ue[^_]ʃE] ue[^_]ZUWPkyZYtU:u W3h"(x:u9p,9}l6@p,W3h"h,轧?e[^_]1UE E EE]鎰W|$wUWVSjEPSʣƉ׃EU E9Es 11M9ttuj,VwZY…tUj=VjwY_DžUuh "Uj 轈 ZUuh"jJS, ju/ /B/1/Boe[^_]UWVSQÍEPS^_u C #ƋE| t@E]S* Zu/1 KDe[^_]Uh,h""/j՛,t 9tU,Uh,h"/h,hV"/h,h-"/h,h'"x/ joUWVSPuh͢$SZYh͢$S/_ZÊEhViYXuVh"0jOJ }t/1e[^_]UWVSlj/E 0^_/t@E /h"PgY[d/"//111҉U11Ejh`,h7"u uKzX$%l6B/5l6h "d B/렸1P,덡l68-uxu1/Ej/[D/Q/!"Bh/38/$1,=,u'">|1 //=/u  /$/,c`/T5l6=Y1T/ol/` ,G/k$8 /l6/#H/EH9~2MxPVĉ XZMuh"jFjaEƋl6/PM/#1/P/GEt/>}15/jP$Y[yRFEMh"SAZY;GCjP[^u}uh"P[Z_uh"SӥY^,uS(…u_h"S谥ZYtV4^=/tSh"zFtjP8ZYy*h*A"SϜXZuSBh"RUNZYt8jh"URx UujjRZYMpjP؃jSu1ɉ P,}J/t 88h"ۀ/Zt 8/! /!11jh`,h"u uwz$̤%1Є,ă뿃l6B/5l6h "t/p/xl6/fl/ T/!"Eh/@3d/΀`/ l6l6h,h"#5,h~$h, 5,,h~$h,ژh,h$#/k$0P/l6ÉѣB/B/19| 5l6h6"%thhM"jV=XL/l6Sh#"%ZYuP, SP,Yyhs"j5l6Z\@DH//D/Ph"j<jK/1ۉD/5l6Y5l6*ZtjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh"j7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 5/h"6[_Vh&"6hV"|6hx"r6h W6hC"W͚ZYuh"W芖[= u h"&6Y덊uh"6ZX<.uuh"5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDh>"j3|tHL@t<uDha"h,t WDhw"h,Yt@th WD܅0 1e[^_]UWVS]t K΄u h"4<\u FFu8ujp Xuh"j2^_DžoGjQPO t2hVPSVh"jd2 Wx [띍V֊t\uF8t)FWx Sh"j2YR4Zu%輖WPx h"j1$N1GtYuh7"jn XuhL"j0[^C31CV辐ZC 1ɉKECE C=/u//X/1e[^]US/1t6Cu+uhy"j0XZ3h"h,t [Ƌ]UWVSu/t$tS=`/u S1u=p/uSu$t9ut/}FP2Yuh"j/C_Zt/1srCt/1ɉK;W菏ZC Hǀ?/uC C$c‹@t 9uBSSu 1ɉ$[:h"ja/XZe[^_]UVSu1ɉ$/u,=`/u1=t/{C |/t[t0CuPFP3> KVPZuɡt/u '$tVZYx 1$e[^]UWVS]=x,tjs{.u{.u Ct:e Zt p h"b1e[^_]UWVSut>u h"j/Vb[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh"j& TE@jd Xuh "j&Y[0t;u GM1GtAt0yVhS"&O}thE8t`W yuho"j%W0l bGƒWt+G 9OG}Vuh"j%Wk 1G=/u=//x=/1 h"e[^_]UWVSM=/tPÉֹ=1:t9pt@9u9U}tjb ZUuh"j$[^1p1ɉH xe[^_]Ã=/u1Ujh f /YZt1h"j$XZ1UWVS}/$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uja YtGGP&Zt0 $$$CSEC ECECEC1vSj Yh/"j#XZ\Uh 3 P1v 1$$CHCUwC3i Si [^e[^_]UWVSM/4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3h X]e[^_]h e[^_]UWVSS=/t51ۋ4t#1ɉ v0Eh EPh XZuC u͍e[^_]Ã=/UWVjhGd /_ZuhM"j"Y^Cx"=/5/ ,Z@u"5/XVh"0j"5/X1e^_]1Ã=/u1Ujhc /YZt1h"jp!XZ1Ã=/u1Ujh=Ic /YZt1h"j3!XZ1UE$$ $]UWVS(}=/$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAj] X11q $$$AQ C AK 1St$//// u+//M!u!9u^9uZtL/5/ t:Uj] Zt+UM܉HUPp K HC $$$3GPh"jhI"j$P @ $$$E؉,$Eԉ0$1e[^_]Ã=/u1Ujh=` /YZt1h"jXZ1Ã=/tDUVS1/0tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ /=1Et#؋M9Hu9p u M9Hu9xt@$uj([ X҉UtMu UЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!Rc XE "Ee[^_];e[^_]UWVSEEE EM}/tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3c Sb XZ1e[^_]1UWVS]}E= /t";/tPS^ZuSh"j$Z YuSh"j. hS ZuSh"j ue[^_]Zb GFG4W8F VG(W,FVGlFF /F5/e[^_]US/tvC/=$/u{ t s3hXZ, ,tjjssss 3輲=|,t s3YX3a Sa /XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=/FhGSPl <9tjww 5,zk;Wu;G t مh1"*SR5,+{ 9؍t譅hI"0j SRF} yT$X$G9__W1jW Xjjj5,jG WxNS5,z 9u)T$X$GW/W8ބha" ҄h"0j7 W_ Xh"j#ZYe[^_]UWVSQ/uh"jXZohu u Eޅt6u|Y_tcvj V ^t;uƉYt#uwGZt _E81QV^ XW^ _h "ja[^0^SuS|ZYtS^ u"F_Zuh"e[^_]UWVSu} /t=h7V t&3V{ZYuusVj [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=P-ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh1"h SlSyEVh9"h SlSy=VhD"h SlSyVhR"h SylSce[^_]USSˋ t%RQPhE3[ 1U1ɉ EeveRu Pg ]URPh]"jUjhoø1҃=/t1UME1҉/1Ҁ<u=Bu} u,J=/t/1҃8]UVS]} ~;uqjh"Pw u%=,u ,h"j0ZY1,jjPƺ 9؍e[^]UVSiÅ3h"VwZY[uh1"SwZYt)SVh"jh1"h"h"j ,vSVh$"jt/o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVh// x Rh// U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$%=/t_hJ"j hs"h"h"Ń d~ Ph"뮋p3Sc~Rh"땹1jdRPb1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEPWbjj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 th"$%$1$P/ L/t5t/=x/ T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh-"e[^_]11UWVS}} ?jh"V}p ÅulhR"V)qY^¡/ / u/hZ"j XZjjPƺ 9tPVh"j ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPW^z/@E K<vM E)Sh//} Rh// } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)P2yjjCtP͹<$ ƃ(8$P PZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2"hP莕ZYy|jj ԕ[_x/u$  ЃH5/PC¡/1ۉ//_Yx)ЙRPnZYy넸e[^_]UWVS$ƍ@- 1U ډe[^]wUWVSu>-u~t2h*A"Vt\_Xu$l0O PVh["j[,1EPSKZYt/G}vEVWhn"jEUt,u1 S RXe[^_]á/t UU RuP`5/"5UVS]u F5/tRPSo tD3j S{,ZYu1e[^]US]}t /u,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^/e[^_]U5/PhR"UWVSQ5///PÉ5/^=F,t r"uKt;u#%F[1҉jEPSGƉ-[ 8uE8t+[8t"`% tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$T%" u "!AuEU Ѹ"t݃} uWVuuy WVuu&MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=/%us Љ UUEU=/&t "wE//S1 VVڋExYtEUe[^_]UWVS(Ɖӡ//EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh!j]SCCjSu e[^_]US7=/)u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HI//SuЉE뭃$9 "tFكPE4EȉU̸"=/#4EEЍpًt(SEȉŨwhf/SEȉUYEȉŨw>/t[5/>t'/H/FxFCXVԀ~/u#/KhC"VZGZYu$,9r :ƅuh/K;/u>th-$V GZYt /x/4tX/ gXV>t/H/FxފFC9,u /x/C 'X/=/u//@//tP( X//5,Ӛ/j5/hJ" j5/hM" /H/u /u@e[^]UWVS} ]/@/ud!Yy /u/tuj;ơ/H/Zu/tut hQ" Y4u1-=,u =V,t5/h"XZuÍe[^_]UWVSΆ,hƅdh{"cYt @$蒗l^EhuSpBZYdPp yZ#J8J8pW>@$lXWm, Plh"e[^_]UjU/ZtjPhM"q h"XUSLhR#AYt/8th"^t>h ##W@ZYEthL"W@ZYEuEE1}}FHπ\ut}tnxP0tB<wV$%NE1>: 6 2 . * &щǍ@0w\9Eu},HyP,H X JF>/,HyP,H X J }u-,HyPP,H [ J 5,,fBYtfBhA"j(1e[^_]UWVS]u },t,9tx u h,X//u/Ph !hЇ, /t/Ph !hЇ, t&WVhЇ, x0h}$hЇ,ZYxS( Ph]#hЇ,,HyP#,H X J EЇ,e[^_]e[^_]U/u^ U/jPßUU 1//@/tuRj u/t /U1/EEEEjEPjr =x/t=,tjQjj9j: U=H/u H/E Puj:UEPu u(UEH/jUS]DSu 0uUDuu 0uUEPu juUuu j}uUS] 0DSu0^ ]UDu u0A UE Puj+ Uu uj UM %ft9uPU t@Qh %j h//á /UWVSPYuOƋjjPRǃ t 3;ZC jjP,ǃ t sz{Xe[^_]USh5"ĨY/8tN,,M/thB sXZ/XjjSP5/#j1]W|$wUWVS ƉӃ=4/uj'k<4/X 4/1ƉU1}m `0%M1EmPP$h"jS-;6u{0ujh #SB)F S_6ZÀ{0u K{.te[^_]g_1,//(/$/US]tvUUt[F~#CtVj RPWjEpS:~5j Rs cWE@C us XCX C @C[놋]Ã=8/USQjj]Sjjh$, @tBEP8/Zt,jjSPjh$,n @t8/PATH@=58/ 8/,X8/]á8/US ]t6;u1Ct*p~Zt/PjEPCp1(]UWVS }W1t@/B/PWDrE_XZsnEX;t.Ey"xVQY?0z" Ph"1Psus ua /u/t[~5jVJXZ}xuju0 jssYX}yjs_XZxV^uuYu u|Z upX1/ /u/te[^_]UWVS}u ,tu u1/1E܍]SÌXZ$%uwYX=,m=,/%jw~XZ=,K/ ,/4jwNYX=,=,/=/=@/t>VW VW=S- =@/tVW=@/tjwXZ=,=,/u=/uSŋZU ?1=/)=@/tuW =@/tfuWSi =@/tAuWfك=@/t(www+1ɉ /jwXZ1=//jwY_=/tr/f=@/tW,S踊XZTjVW S蛊6Rh")h,ES{SpY Sgf1S轊XD/t}=ކ,t/t tPtj=e[^_]UWVSE ǃE܍uV5/ju^1jY=,tKt>=,u5tUXUt E܃PuRcXZ=,/u V苉X^VZu1/tje[^_]UWVSWE} _,,//HO;t(/sx&迊P ωʋ7/tx BM蓊P M҅xJ wH+ ,Q茇^ /PS}ZY1//e[^_]UVS](/1js&XZ=,=,/tT,/u0/H0/x1,/뼃u 0/Q0/ 1ɉ ,/MwE5/=/; ut-t)E Ps5/XZ=,/Ro (/5/e[^]UWVSu=/=,u1EPIE؉E܋^Yt$hPSO =,/b[E؋E1҉(/]؅6F/=,P/P莦PCh "9v 1,xWPyP,H =_ J=s,xWPYyP,H X J 5,?_jsv E Pv =/=,uJ,/t:u0/H0/-1ɉ ,/Hu 0/H0/1҉,/ (/=/EPPXe[^_]UWVS]uV薅E؉E܋S /jPsiM[=,/{tuG/EpWRZYtV1=,/uZ=,uQSC ; t/u P /[_.[/u P/ZYu뇋[g1/VlXe[^_]UWVS]} 31EsZ=,{5//P*Ph"Stj RU5,UR h"Xu h"X,HyPV,H X J 5,X/@/ujSguSPEq}trt8u4guu /u/t3js"Wsj/H/u~/tunUu;Rf1ɉ //H/[/e[^_]Rr//H/Zu/t tJ=,tA{t;5//PjPh",Ee[^_]e[^_]USD/EE1EEpX=,tlExtc5//PZYEP$"[EXtj S5,X [h"g[5,XjEPˍZYtlE//jXEuKt&:EP$"X5,XԋEt/j5/詍/@/Eģ/j EpXZ1ɉM /t5u Ep-Y[/@/E/j!X /t/t뻡/tEt"EPK$#"?X5,Z]UWVS}] 1CCC =,EP聀/@/E^y h+"xjWfdjWPyu31ɉ //tujujWudE؉s /H/Zu/tEPwXe[^_]UWVSE ,1@/X/(|/$1`/EP{X1 /E@/ptEXt8sl_u&C/hpPSG [u[ċt1ۉEp :^x|EXtC/sYu|1҉4pjxPSF [븅t4B4닅4P}_0pt0J0H 䋅010T=,t"=$/u4~0@T40)Љ0=,u 4fEE 5//P}ZYP0[xuvp1s%Z,Hy`PX,H =~=WXtN,Hy8P_,H {j=W Y^ƅu뽋J=뫋J Ӌp t:,HyP5X,H J s^X뽋EX ,tRSP t [HyPX,H J 5,h_gxsjh%V& u Xԁ} ``041 Huw)4)400tX4t-X`0QRUR0af}Zf}tJXZ:-{z-uzu apu CSu>Eg- `tfE=@/u Ext,AEftfwE= t= tˋE@fat5/@/ju^[^n,9tߋM/t/CUuS"1ɉ D/U^_}9uBD/<:ttB1::uBMuOZD+,Ee[^_]k1e[^_]UWVS|uj/SY_tAuu VS\ xP6ь_Z@ j6EPǃ tjMy\=D/uSuu VWu><8t428t*(8 uxPWUZY@t WkX뀃 h u tCƒv~ H/PSP6hoE"jUWVSuU F^fftfftdN/$U jS$PJPj IU yхtvh"XZWPXtkh"<XtZh"+_MtIh"Sh]#/@/v~P$Pb/H/tSh]#NY[?/th",Ph" PSh"M~ t-,HyP^,H *Z J*,HyP1,H X J e[^_]UVSu%t"8u%uCVP,ZYt؍e[^]UVSu %t8uVPZYuCݍe[^]US,,1ҋ`/tHft fux@ |u[]UWVS}/@/`/t,Pfu9x fu9=,,| P X҉΍^/t /u/t e[^_]Se[^_]UWVSSu/X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPh"uZYUt>:uGFC딃=,,y t ,,u1҉MRM ,,Xe[^_]UWVS/@/`/t!f{usS XZٍ݉w/t /u/t e[^_] e[^_]UWVSutA%<`/`/tCVPZYtdߋ} tX/@/V[ $eÉ1fCC VCPt/H/ u/th=@/؍e[^_]US %tjP)f@SPXZߋ]U/@/@/ P= /H/Zu/tUWVS] j/u ^_t[EtFxPuPZYy 8t8tffCf1CƋM/9tMEth"QY_tM ju_Zt>HftftfuEEu E u=,,yƀx u91ETtE,,tuDYDžDž\DžXDž`juEP` WdD/Z?/xPWބYZ2E%==D/NEW Lȉ`+,$]cWabjuƃfx`QWTfXZF FfF CfF fCFC,,f~tF\`9\HPh"pZYtuYDž 5D/h"epYZ`9\~8^8kP8]BXKWuh"5/@/dTujuY_f~udfF`FDžX t@Et$jXPuh%5,Tf`/@/dTujuXZf~udfF~ /./!1 e[^_]UWVS$EE111E11EEh1"yEZtPEbw$%1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEE/81`/tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u5,^,@h;"[EjWZYt[@ft:,fuu>/P/8ufHu*}"fu}}t˃=,,x t/PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZvd]uEԉERuIEe[^_]UVSu /@/ju!Ë@ZYft&fHu sgXfCFC fFC FC /u/t e[^]e[^]US ]/@/fEEE,fEu ?EEPSL/H/ u/t ]~]UjuTZYtfxup)X1UWVS 1ɉM11uh"@vZt(ptvtVuEEлɋE 8ctu ދM Mt4Ph"Ht}t5h"4/:t/1E /:5"/:g"RPh"m%jjV XZu}jV)XZGfEGEEfGfj/V@ZYEEԡ/}tEjVEPGEP\My`uh"XZ/P/0Ih".j w h"wh"/ 8,HP,H /P/0YV_8uVPZYmIwh "owh"J /P/0/PjEPV1MfHf5"tu"Ph"iY^jV_Zuu hE#FYV`f 0 PhL" /P/0 u%h"uh." uhC"fVh"/P/0_Xt!/P/0E.h`"YEE~uh"넋Ee[^_]UWVSEPyZ/+,PY,XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=V,t"E u /xB [P}눃=/u[/,8uu@hX"XtVAZ^E %E1b*Pa YuVZZP X VZXu‹E|}u5F< v@ //y8[P/Csu2B% <w //yZP/8t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:Mhm"VZYEąM9EЀxupx9u%EEE9s2>uF9utsE%tdU9UvsԋUE͈@ĉƃEM9MUP YPEP EXZt\uuЀ>-utF<]tm/uu}NtFuc=/Uqxvtu@r t@١/;}u5/S[rxRPlZYyZ9tt1t9s'@ZxvttE]S@ϡ/;EtP9Uu8/t}G -$͢$PXE9/t@/Džp>t F1ptJxw@tu@o/tS蛎Ypu{F/uS;Zt߀x .u o.uǍx jWt tptWu5/ 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu/skY@uP/DVƴY/u+,,+,EEt;t}1ɻN)ЉE=F,8<@.<*&}tE<VE)HPhp"(1ۅI~@/H/Cx/P/S։MAP/SM뻍G1҅~օ)xu u܋E%PV1ɀ} k/+,ыE))// /@} uSZ}EtsŠB% <w2 /x/H /U@H /U /x/H /U@H /UԈC뇻11EԀƒ v! /xM/H /CuJ /x/H /ĈU7@H /U뫈U@H /U뫻1111ɋE%Et>@u=/uM @1 1E @€}E$%U5/Q8/^_Uzu LuЉU E PuY[ExU^1 //yB?P/5/+5,uuuuVuu%/+,ʉ/)@/uZ0uuuVuiƒeuXE)/ Rh"誩}O#uOQVHPRh"#u EEEPVE)HPRh"g u9u1ۅu"uԡ/+,Pu 1Ҁ}t`]uu E]Etq|wt / /׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tE,@/u D/E/+,E;~uE t u SXZE 1Es}B~< O$L%:=J{s{u{y{@u{=uz1/E} t //ys<P/e s //yI<P// //y#<P/ t=/t"/+,M9~xuH/ uE uE 11 //y;P/҃}u C< w //y;P/S /x/H /U^;H /U߈ ts/E#E PVu R/pl//VrXU /x/H /U:H /U߈E {~=u}1Eu V[X u/ /x/H /U`:H /U߈EE Ru0ZY/+,jPHP wމe[^_]UWVSEu ]=&,t1҉/P /,/,/1ɉ / /P/Sp_Xu&/=/u9// //yg9P//+,Pq6//XtAh/W&/1҉//Y_ÀtS5/+5/_Wj6x//Y[k/1҉/tNFe[^_]Ujju5,@E5UWVS$EPEߋ5/+5,hREС/H/ZYx/>8P/=,VWW]S6/+,P+55/WݔEԉUS6,/)Љ/// 7/uuh!j5/蝜/׉Gu}"tj)PV} /)O/)=/EЍe[^_]UWVS]u =/1}DPSXZ/=/u7//=/}=,}t }tA轭;tWh"hЇ,褛j%Et"PV)KSh"֡jWV肥+/=/)/e[^_]UWVS]u=/Cv5E%PuXZ/=/u56//=/ ,}M  t?9s@UVWQM MUt <CÍY9s1:UVWQM{ MUS9st{u8u@@9r9sS륍Y9rVSQM, SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+//)/I9tKCCG+///x C/4P/ //e[^_]UVSu]Sc2F /,/,/1/jv/H/ x/4P//+,P1ju PES2Ee[^]UWVSuFPh"蝘,xWP[_yP,H Y J19}E 4ZCWhE"?,xWP_YyP莖,H [BJE 4x,xWPYyPF,H XC9| J1e[^_]Uh "Uh "םUUM 0,t 9PuH]Ë /1-0,B t xt 1z1/ x/UWVS}u ]/@/0,z tj.0,J B ZB$B x/P/P|/P XtK =x/5/ /u/t e[^_]re[^_]UWVSQ50,^ /@/{t-WRUZtUD< t< u ,Hg Cx/C/C |/F $9tS% X /u/t e[^_]ӛe[^_]UVS0,H /tBu y8 /xxh,ǓhЇ,轓XZ0,=|/Xx/hS0,pʁ qu/|/jw8tġ0,xub8#ujjjA xtPjj) xh-"茔Xu|/0,1p 0,Px/x/1ۉXъt< Y|/t,1ɉ |/ /hJ"Ϛ)щ /H|/! H|/)H/3=,t5x/ד5,[XZx/Px/~e[^] /xx/Px/U=~u! /xx/Px/]]U0,/P |/Px/P4,Pj8r+0,@1҉P P$P0,YUVSu] /@/hH[ VwjjVgtt0,@~PwY0,s{uh*CZ1/|/4, /u/t e[^]魘e[^]UWVSĀu/@/jVSY[y Vhd"ÍxPSs_ZuE%=upjjjS2 u]jtWS~ u"jhr"WgL uSVhw"jjjS tSVh"MSu^9uS}h"2u Px/H/ZYu/t蟗e[^_]UVSu]/@/} t5x/VZ/|/4, /u/t e[^]=e[^]US0,/@/CxPuXCtP: Y{ t0,S 0,P /P|/Px/@4,/H/Zu/t ]顖]á0,US]0,9t =@/tD@/t h"і]Á=0,@/uU=0,@/u]U}u"0,@~Pt0,1҉PYUE9,uE ,]UWVSU/)i5rO9,t5/u1#,(9tC߉9} }t}tVǁ[,t?iӀu.tiրu,,XZ[^_]UVSu95/=x/2,tPmsYjhh"{,[Z1@tI5,r,hb Ps5,i/y;"SS,Z@uCt S!Yth"!,X4[~;/t jj[Xjj?jj6jj-(~¡|/9t PjRZY@uY0׻ hd5|/5,sY[@,0誻 hPh/"#}¡/9t&Pj[Z@u0q hPh "5/5,ZY@u0B h5,q,jjGjj>jj55/e[^]UWVS]u+/i5rOCShW"/@/19~Qi@tǃu=uFjRSZY@utPc Ph~"9+/i5rOCSh"輒HJ΃utBƃs /u/t e[^_]e[^_]US]/@/9t P Z1ƃ1҉ /u/t ]霑]UWVSTÉ։Mt&uPh"Sv =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=/)i5rO ,+9t# ti1;J-R@Ph"jEP舊h%'"jEPs URZEUt%‹E0h"jRUDURǃE@T=uh"RYXu*tQh"jRfh6$jRTu =t̉UQ舷 j URP/E@Ut$RǸ@)$D=Ph"`/ U:Plj$URXZKyS赇P Y P G~SEPHXZEu EL}tzKySgP _ P KySEP|Y@P|4M}tWhV#S藈 iEM0EKySP Z P EEE}S{X>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~W..[tW-XY"*Ft~uH<-tB<%t<+u:,",i/"//E1MxdtS~JH~?u(UFPQMYZMUt UQW,YZUu뗅uV7-ZtjV,//XJxRt~i90tM΅x29/~*i/t"" ""1ۃ} uVPL؍e[^_]UVSh5"6X=/tYh$"r,HP5,H Y肈Sn/Z8P/xj/0Y^u h4"請=P+/i5rO@PhV"8 9DiPhV# FXZՋJ ;1e[^]UWVSQ111Uh^"5ZUt$jtptguܿպλǍH~hb" /tyt h"辊UjPYXUt 1t+/i5rO@Ph"t$Ph"'XZ1tiHi0i0h",BHBCY_y3R4X9H ,z99y9H y:؉؍e[^_]Ã=/u!UjuZYu11á/u!/ /Jxu 1øUE=,t@=x/t7uR+/i5rO@Ph"5,趂UWVS=/t.5//NxtS{X1///J/B/uh=ViP*Ë//i߉_19~i9uFP ^//iƄDŽIu/ /u$/t膇t /@/=N,1ɉfǃ/)؃} ~iE PZ /u/t؍e[^_]UWVSu]=x/tSSzYXuM1x//@/jcjjz1/XZ}u*=,}u=,)=,t u fc0Vjr_X}u-V5,wZY@ue0 hPh/"\SjrSjr{}t/}u`SjzSjzu }um߃u2`u)j3mjhDg$Gl thDg$hd"Ѕt$=,tSj\rSjTrSjLr_e[^_]US]U M=,u1t uEM E[]).UWVS}tE1ۉEPu EPǃ u 8D/t/@//E1i/M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉[tgu tUP=x/t =,u;u uEɃ@ ;u uEuEu򡴇,P /u/tȂe[^_]UWVSjjjà ~ jjj=,tQCtN5,Nt_^9t7_P5,sZY@u0/ hjPh/"訂1/95/|btPu=/u>SX5E t t&tt M ڋE8F떍e[^_]US1h",Zt$ltptZu⻀ۻԻ͡/u t8t Ph]#*cj*Y[=,u =V,u@t4j/0‰١,/P/YZxuS5,?XZ1]UWVS411Eh"+Xt)ntput h"&5/Eƃ}t1E̅u4/E̅trH/8uEu=/tO*jjV~ uVh"jV9Y_t Vh"蠀=/t}/ /=/Ix.}t ?u1҉1E؋Eԅju4EZYtxu M؉}tDE؀u8jPqZYÅt j7V薃 =,)ugXE؊u CM؈`/8tu E؃]ȉ1}ܡ//1Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV贂 OuA1ɉM܍EPjj @usE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_Eԅtt h^"'X6jsjs u7{t1h"Xh#jsh%1[(hb"js u h"_hIh"js { t&u h"n^hf"cjs T u h"H[hm"h"hq",XjsZYu h"Xhy"js u h"Xhi$h "s h"jsyhx"js h~"Cph"s t=jvih]"djv U; uh"h"A_vh"s)h"sE"1H"%1iQ"1K"1N" B"S9tRh"j}W^oWV^w-C yh"/t /u7;/P//jPƿ//XZ=/t6u h"XH //Pt//////1ۉB9tt 5/ /e[^]U}ujjjjuXE/@/jc/Z8tPX /u /u1~WUU0 wj jRY  Hu1//UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh"}[à uVh"cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh"[à tuVh"hЇ,>Pjh"`1H9ujQh"Zà 1Mjh5"h"Zà M+E@1?1ɉE11ɋU Ph"j MQOhMQh"_Z ÊEEEjMQu EZ( t1E1҉URjUe[^_]UME  h"UP u/=/u/1ɉ //h/h/RppUVSM/t:u>/u1:-uztX/z-uztBu /ͅtɍr8tuPh?"9Yy:u܀y:u.zu /J /2u PhR"T5/15/e[^]UWVSj,/^_zthh":8->E /1/j/Ytzthy"(T/uD8-u @P5/P)Xg/9Zyh"9|EPá/@// /)<}_߉ƋM9sω9s x19r )ЍpkME9s 15/ /u/tRS[PY/9} h"/B/)أ//ljNx=/tE7r ZEy1ۍ /1u1/ /u/tR1e[^_]Ë,z8U /x@ 6@,J8,z8]ÃxuUSt Pq XK]HÃ8uU1҉P8u]UVSƋXCF~hy1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P,JHR P UPUSUJtXxv-u~u C $t hv",B0+B8PCXe[^_]UWVS4,E=u6E8t hH%3=,,/} E=,,/\C/\GNà " / G4,(=k/H}t/G u͡4,@4,=-} uE( u ƴEu 9E@E菴t9u& u4,,HH FՁt| tf,jE)VP+ &kx\[x /@x 4,,HH /xO H,)Q,X4,U)Ѝe[^_]UWVS@} ,B ]urVY wVh"Vh" 4%h"j"S|GS܆Z؅tWh"}xM4%h"jPGGSUWVS]S;5,MM E,ZY9,ulPh_H= /9s<wDu 9rMW5/ai ZYt%/= /M܋=/5/ ""S>e[^_]ø5",ztGUS /ttt* "#//54,P /ZY]UE /jZEEU\uHر u"4,,@8xtjjX聮jjh!耮 镱UVS,Xt 1ۉXX=x tjb,1҉P Y,1p84,P0 /xx/Px/0Fƃ)c t,~tŁF $% 4,,PP @\ |td;Z=t 蘰 uc?&u,@19,@_|u,@,@$&t;u,,@ ,@ 訬,@,@r,@_蒯=t0 u74,@4,,B0ztjj[Y,1҉Pjh%Và ؍e[^]UWVSSá,@tuxt =,,uyGEt7%t,O8uQP茆ZYu%^_8Et2jwE.Y_t XS4$PSd Rt ,1҉P؍e[^_]UVS,p$ t jj,ubX(x,u{ upV Zuh$"P: uBPVL,BC1ɉ ^t‹(wjpVe P0+P8RuF Xe[^]Um,B]US]V9tjS]UWVS 3t u%j 8XpZʡ,@؍e[^_]UWVS,@}t11[W4%t1MHwRFuv,@@},jEu-뤃uj p1AXumtCMuj 18XMHXj 1҉WPMHGYljރ}t' }uZߨjE#BW}uG,}u:,@@ 4%}t jj,@e[^_]UWVShEӉM,@E1E/E豮E+,]jEPrZYtujXY>tt-uVƉCY;$/} ;(/~(/}>uQy>u |u &u !Utv&uya1ɉK,dj`dB(,@(X4,PZ-,@(u @  1҉P 蜘y1s,X$,@ W,\H,hP SV,p,@ X P(Xu1 /GD/r5H"0ǗjhډMX/HXq{t %/X+5,T /`X@Džd{1d#kDžd}tm%uWP-DruJt?:}u5$/%/jjh$/ٖ 1ɉd躖Džd %/t> /x`@`H`%uKЃ wC /x`@`H`iÃdt@@Ѓ v6t'H/X`XX, Džd /x`"p=d%:t #u)Ph@%8[Z…t!Džd[Sh@%8ZY…uH% /x:F p:Džd /xF p?%{`@9Ë`uBW``Dd u(}t# /x#F p#Džd詔d1ɉdGfxufxt dT,Jwd@ ӈd ӈ{dNj@f@f@dK@%1҉P:'uAW|%u1/X\Nj@@B%f@/X$諓H /JNj@@"%@f@e[^_]UWVSS,1ۅtXC1,0x tjR,1҉P YF8Pv v^S‹FP U8tSj,pZjhb%P`,HUJ@ B 萘]e[^_]UHu+]UWhPT/lژd,`/\}1󫡨,X1pjEPjZYE//E,Tjh` jhb%Pc ,B t$Pt=^, hppDžt1ɉxR|T}E,jjtP袉 ,pnX,`,d蜗Zl/\//u jlDžp5"u^j-Džp3"X,`,d.Xl/\/pu hpp}UWVS ,@1ۉ]}U ,u@$x @40$ԭ%j袿jCjj Cu;jiF EjUBjbjUB뻡,xu jF Y1҉V @j]j á,x 14$pCjj_Cj,@A. u,x,u pr[u hK"j腾 ,PS @0CB,Yx u`x,uZh$pi^ZuGu ,up0pY1҉US@PvjjfHu?8j@,1҉P P,J0HCBHYvB,@-ttjjjCV,@^Xjk ,B0+B8C j f,p0C5, ~ uh$vhZYt h$CEFu,xjƋE0FEY,xu;,x  jj p0‰EEU表,@Zu UBE밡,xt jj@0FjF ,@Yt-Pv jj u ,@FEM1҉@{j jeC1҉SY^tNjjLX=V,tt3j,@X&}t,@uWd^_Tjj ,u@$x@1ɉutt;tj ;XZÉs؍e[^_]UWVSV} uE E1ۉ]1]𡨇,xn ,u*p0QƉXYtա,pZu1뿋H up$E0FE뢋}9u}} uwj, 4,H4^S ZYuha"SZqj/v. t h"t ,4,+A8F%F,1x4R@@u} u jj1E1҉j1ɉHEFE F ,@0F[e[^_]UWVSS,@1uG u=V,th",@puWj Y1BUjBËUBpXYUj)&C^Ut1ɉ ֡,@tj)pZƉe[^_]UU,1ɉHHPtjjYX,1҉P t/Ht3,@j,Ytrrh"n&,1U11ҋE]FUU Et 9Pt]UM4/tPt9JuB]US]j袷SCU PUPUP X]UWVSEP>[y h+"%u;5,~5,ExW^Z=w PWV% `jjj uNu jj/_jj&_jj_jj_$jj _SEpuj?aug Ee[^_]1=0/UWVS}u }t~h@VW=à VW=ZY}t9u9t:W X19t-yi0%L PVWhy"S SVWh"$9,},؍e[^_]UWVS]{tN7Gu 0/} t} t&Wxjw PR+GxPh YWC Z1Ce[^_]US4//@/uSw4/SC /H/ u/t ]T#]UVSu4/t1u(jS#ZYFxP X6utse[^]UWVSu] 95,}5,9,},9t7S jjSV%9th8V` WJ PSh" #؍e[^_]US, @, , ~.CPjj  x9,},P X͹ؙ } ,/]UVSu,/ ~;$/|l5,/j VB à x9,},9t PSh"A%ЋM !%9t'PjS @u\0> PSh?"}j 1}PMZh^"/Xe[^_]UVS]u M1P1<%t#KySPMX P\%<u~tvh"S S4\%ZYt vVuQShC"MShr"EF y)KySP-Y P-Ph"Sq SvXZۍe[^]UVS]Z0u&=@/u /u/t]=/uTY=@/uZ/tO/8tCt>/D/@D/=,tu/u /Z0[^]US]SVYt ]]ߴh&$S8 YZtS赺Zu]US]"t%S聼ZuSh"j h/D/]UVS]} t"KyS P ^ P VPh]#S  t?uSh?" ZY?t.!KvyS9 P X뭋P 롍e[^]US/@//t8t P3 1҉Y/u1@/ /u/t ]-]Ë@/u/t9u=/u 1UWVSu} =@/t=x/t?u;/tۃftGtt;`/Wt2<=,b/uQ=/uH=n,t?$=,=,`/u> uUt/tY<I<tG<0<#t5<<`/uw EPjVN @}ttKtR1N=,t tFv =,u <t9uyn PVKZY@t\u`/u jV蜹ZY1E܉EEEN>v wV DjEPj e[^_]UWVSu] uh$sNZYtsh#VNY_uh"B j5,h h"VSN_ZǾ/tl/@//Pw0 1ۉ/^u /t/tjW/H/ZYu/tG@u15@/1ۉ].{h"#WMZYth&!WMZYu/p[vtEuEu11j1}h$3BMZYDžt}N}u N_}1/t@taGwuu%h"WPh~$ WvPh~$C ~h?"__1똅t h?"L^11/t\/8uPu%h""VPh~$'VPh~$tC ~ h?"[1F@ut h?"Y1ۋ/t7/8t+h"/P SPh"C@u}u3=@/t63{Zu;?-uu1t 11EFh"EXE=}}uU/t/Ph"tY^PƃX?vsh]"5,- h"/Zu h" /P XVPh" 넍Fuuz/@//@/u1 WX/t/P, Yv [N DjEPj SP XZ5/9EU/E/]UWVSh%P~ZYj'V_Zu <)ș19e[^_]á/@/,t,UPq( 1,,Z /u /t /u/tUWVS]߅~91Wu u2 ~ )Dž~E u F ~) M8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu/CfKS u>/@/s6C CC/H/^uV/tMFfu9s/@/6CPRC S)S/H/ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9,u]e[^]e[^]U5,uXZU5,u~XZUPuu EP~E u hw"ouPJu'& UEPu u UE Pu5, UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'V _Ztt~tnh"V0ZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h%VzZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9,u]e[^_]we[^_]U5,uXZUh,MhЇ,CXZU8ruPh"Ph"@UWVSSEPE X85,,/j=RUZYj=SZYU))9~߉Ӊ /I /t$<=t xFU蔗p UCɅxUvU] Ue[^_]UE1@u,/+/Rpp h"jhT/2T/UWVS]} Mt t9u t113%ƍCt9t%u1@t)؉[^_]UWVSS11/tZuA=u܍P襓EY1/t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE"e[^]h"S',ZYSM:Z9u;Sh]#j'SY^ƅu+Sh_$XZ/<'uh "sXuS)Ph"t e[^]UWVS]} sSt"CtS҉XuEs1Et Whd#!Y_}t5uhd# XZ$,Jy R` ,z9 _F>=u y:Cu}th2j"FPZY,HyP,H X J e[^_]UWVS=l/uh/ h8l/Y11ۋ/tJG} tE t8tEt.h/9P5l/l/%h/XZl/1҉Ѝe[^]UWVSP/P/su",s ,s + 論YVCƒJujvXZ=StuPF K DPY_F u v ZCFC FCFS X`e[^_]UWVS111Eh"{Xt2vt&etfuEՃxuп뽋E u/t0}tUP( YUtW2U XZUʉ؍e[^_]UUE  E U?t h" jpp 1UWVSUUu /@/j臅XU:-u0zu*5,k, ,C 1ɉK^1jEPRUǃ UuSj=R[_ZUtRVVP?VjR E81ɉK C1s@C O t0KOKGt u tGG <=uRUVP tjRULXZU w/u1 /< =u|/H/{P/P/ /u/t e[^_]e[^_]US]tu s?XZ]US1ۅuh"'NtxtIuh"貜Yu 塨/P/t SPXZ]UEU )]USME )u AR)[]W|$wUWVSu61҉j EPSC9Ɖ\6 8t9O68"u/EUE9EsShH"P-9]u ShY"EMDJ@t@E}u9tՉe[^_]g_UWVSQƉ ukIe9Fu[~I9uJjjgY_UP(PUR> Hx N9 uW/ XF!؍e[^_]UŠH8-u>1tfzuhI jjh@%1zuHh^ jj h%BR_.uhI jjhP%hj"P_-ZY1uH%UVS|ƉӀ8!uxu :\|fxqpftft!f u&PZ?;*;"|f uPS[^1PSlZYuNf$%|&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!]]9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$Ա%SV2+Y[SV"+_ZYSV+[^SV+ZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV^_xPSZY04]E9uc9u_E98PV詟^_uWxPS薟ZYuD04MU9u9uE98f9]PVR^_t1PxPS;ZYu鋅|9u;xu͋ 3E3U r>~u5!uډx!(u;)u{u ?e[^_]UWVSu] h"#3(_Zu!Nu xtP!zUW膎Yu URP-DPtÅt SZ@tM}th$6%ZYu }tM1EE8%u!Pz^X6h" _Xz-1ɉj EPuljыE 9Et:8u5 t/u u5" 9uM,8Mt#y޸$"uPh" EGSW1 YZ@u'`"|!RPh($$ Etu jW XZMurUVS@l\/@/X/@/5\27t j=SYZt hSLXZ Ph"j@]S3jSh$"|j h,h !k(j h=#h"Wƒ $u,"j Ph9"2j,h)"h"!j h=#h#"$e[^]UN=/t 1/|/cO,/1///=4/t jY,,,Ї,ȇ,tP 1ȇ,ZUjR1ɉ /N,1/,Zxt@ۆj/@/jXZ1`/uƀ`/@@u /u/tUEt]UVS]u tVs XZe[^]UVS]u %$%Vs [u CEe[^]s VDF4$VsJVs Vs[Vs GsVDF[ ]VsVs C[XZD[*uFE$Eh`"VOY[EEE8.u(px*u Eh`"VyO_ZEEu uh"}f?f}‹}G}HE @,1e[^_]UVS]ss 3sh$"D%tVTRPhO"" S S VPhV"e[^]UWVS uj:u ZYE u hk"jw@E } hd%E PY_8j=P_ZqxEPh"W E à }tuh"&_X}tuh"ZYu^ ")j ^ "Xr2"& "r"~("Àu'"Àu#'"^W." r-" r"-"5.6"u5"u"5"<"u;"t"<"C"uB"t"C"J"uI"t"J"R"uQ"t"R"rkZ"@uY"@t"Z"KDc" ub" t#c"$l" rk" s!l"w"xv"y#w""r~"s#""r"s#"}"r"s#"[T"r"s"2+ r"a'" s"">}w t2"&" u""r"r"""@u"@t""y"Àu!"y-"Àu"PI" r" r#"' " r" s#"" r" r#"" r" r"""u"t""~"u"u""^W"u"t""70"u"t" u^"?'"t"^"}wu1 "% "u ""u"u"""u"t1"`%Yt@"J'"@">uM"*tO&""M" &""^-"3@'""^-"^-"}w s " r"%=t)wt=u&p"=ux" l"t"Q" r"<}vw s35"#'5" r4" ="r<"r#<"D"rC"s#D"L" rK" s#L"T"rS"s#T"oh]"r\"s#]"F?"s"sj"^}uSd"P%;t3CaP3hk"jd,W 1 11ɻ%;}t SC8t{$(Wht"j ,(PQCPht"j }(P*$A u,Pp9Wj9Y_1Ƀ bt,PN9EPE9XZe[^_]UPhy"h,jU/"=/u$"PRPh"h,jSUWVSQÉ 10;#uCj EPS 8t Sh]#jjE8tWShv"j)e[^_]USÊt%<#u$"SܺZt@/]UE E EE]UWVSÉU}utj VSn @t 9E s 08"u"3O;t)t:EtP-fDB@fO1e[^_]UWSPh"xZud/.j URPà u8"u h"j31ҍe[_]UWSPh"%Zuh/.j URPà u_8"u h"j1ҍe[_]USÃ=X/t =D/t?\/9t6t2^"tK"K"=u^"QRh&"T \/1X/D/]UVSƻ@%t[PV6ZYuICƒ`/d/Ch/C$/C 1f‰X/te[^]% VhB"je[^]UVSÉ֋t8uVh["jURM1YZtVhs"tXZH/1EEe[^]UWVS11Dž=p/~ Vh"XZ1 RPhS# =t=p/Vh"n&f}Uu1.=p/Vh"[^v49tV"hX,q5"STtRPhG"hX,Q1E9E>hX,h"vEa6WhP"hX,vWhX"hX,F (tl$u ~#EPVEZY9#SHu jSW~ uu VG PhQ#S t4Ph %S HtShm#xXZ붋fv(h#SW Dt0Ph %S HtSh#&Y_뻋F(v,h#S t0Ph %Sg HtSh#XZ뻋F,v0h#S t0Ph %S HtSh-#Y_뻋F0v8hL#Sm Zt0Ph %S HtShn#<XZ뻋F8v4h#S  t0Ph %S} HtSh#Y_뻋F4v #XZ+e[^_]USBHBy;B| X RQhXZ]UWVSQ]u uh !SF fw4%h٩!Ph!S[ FPjh!SGFPjh(!S6 Sh7 %QXZFXt Sh5!QY_FXt Sh@!QXZFXt ShE!QY_Sj v(hN!Sv,h`!S v0hs!Sv8h!Sv4h!S$vu~8t/j} tu Sh #9 Sh}%9_X뿃} tu /Ph #9 벍/Ph}%9[^띋$t $PצYPʦZ}tEGjPS/ y h"*9XAЃu ƀt/tu1P6$u hoE" e[^_]UE/E /]á/á/UE Puh,$h,j jeUWVS]8ށu=/t5/h !贷YX=@/t"=/u5/h #萷1@/XZuu R ZYyW:Phޑ#e t7=/t.j oX=/t:cP5/h" #.j襰e[^_]UE Puj' UE Puj UE Puh UE Pujj@UWVSx1ۉ/Ph͢$!8^_yhR #hVuj ]t Ƅ1PS7ZYySha #LY[u%=`uz 9u;u/Shh/ ƃ uShq #뜍xPVW7_ZyV끋%= Vh #e= u:u*ShVU t ÿ"Sh #0Ss[+SsY0hV8s u|h/h]#5XZ|듉e[^_]UEP谵ZtPRPh # u uh #hh`/茳`/UD/tjXj USj0h%jg H/jj裼]USj]@jjyjjp]UWVSÉ֋x CPww wwփt=0~j @X0e[^_]UWVS1=///1///1 Džru/h #h #N[^Dž SUYupÅu~3hVUq ǃ uVh]#3XZAP~XEtVh#& Euu듋CuOHujsVsUYE >9 C 8H1u"Wh#h,a Dž CC jhPjV誈 Ãt'$Phzd@S @uSg [W¹YD P-9rDYt)PH/t4KRWQ u <tPȉjx W x C1ɉK C C1{;/C//XZ{ t%Vw3YZuVh(#XZ?j6x Vw Gw G w GG1CG8{DžaETuDž/Eu/} u:E 5j үYtshD#蝰s _Xtvh~$臰6M 9~=/ 1ۋ9U tE 9}?Cԉ a^ EtPs sshM#…g=\Qs sshf#h,\ҋC'BDž 1/C/ 1F0H0~ + /(P^t5/9F6냽tr/t`5":tV#h#Ph#h,葱/t/?";tf"Ps ssh#h,\͋ m Ph#Y[0F1҉StPVS sJsBS< uU89;//?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs sGY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssFY^} GWssFY^GWs$s FY^G W$CDȉGDs,s(wFY^G(W,C@ȉG@s4s0\FYYG0W4CHȉGHsY^S~fCe[^_]US0tcQRP~0]Ƀ=d0tf‰Ã=d0tUWVS EӉMԡ80EE@,E؋EBEfEꡠ0KMK d0t EEM MEEE1;@0D0Ef}:}Eؙ}E)9"EхuU}uI=0#=x01}t Ct C{toCd9E@(M9Q$}1uD 9~ txNjCSMEAE@ufFZ[tA 10Ee[^_]UWVSu^8C@PvBBp+BtPR|[^t 0$0 h#qY=0t-5(,jjjj 0$0 h#Zu5,,RPjjPt0=0toh#b5 0=$0 t(jj[[XA!HfAWV#1 0$0XZ=0tj z_ 0$0 tjjRPe$0  0u h#+5$05 0[^f%f=@h#h# ZY5 0=$05(,jjjj 0$0 xRP5,,jjy\jj5$05 0ƅDž WV@@PP WVf@5$05 05$05 0蹷^_8th&#1ɉ 0[@0D0 tCjj RP3 {C9s#Qjj RP0 N019r)#u 5$05 0u"hG#Ah?"(10XZ謶fH^_f@t 5$05 0hC"u6!@t%hC"5$05 05$05 0)Z[@@fA\5$05 0f@5$05 0Cho#<$u th#ه =0j XeY[^_]aUWVS}u w wTXZCfEE9ucp0t=0t =0tj jjjw w'up0jh#W  w wNYXG $09O u,,; 0tf%|"f=@u"Rh#w wgE)Puh#豆=0us=0tRyNj 貅h#XZ=0t2h#_=0tfE)fCe[^_]Z h#eZHt1ɉ 0x밍e[^_]UWSá0p8hSY t& 0q0RP¡0H01z 1҉Ѝe[_]Ƀ=d0tf‰Ã=d0tÃ=d0tUWRPY_}UWVS(}M] U P0T0;E] w+EU 90p8}E9|+F]!É]E !ЉEEUEU9}"=0tWN#uVu uh#؄50}̉Euuu up2 EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=0tlSQu uh # 0\Tumq֋]!qISQuuh8#讃ZE̋UEU؋}9Ћ}};=0tSQu uhX#j0uuhq#O$럍e[^_]ÍL$qUWVSQ0QEU}9Es9=@0D0Esuuh#"{h0l00sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuu ) ŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuuM+ K` t1Ɖ׋Cu}ܡ0t`s0WVխ00@x1҃ RPuu) M])Ӊ h0l00@x1RPuu) 0R=0tЍeY[^_]aÍL$qUWVSQ8QEUX0\0Ӄ X0\0}9u}9u9=H0L0Esuuh#yP0T0E؉U܋E9EEE@0@Ẹ@00\1ҍMQRPuu ' UEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuuN) K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=<0u ,000 4080EUܣP0T0Suu5(05|0腧=h0P0})E5(0=019}VVdf%ZYf=u Gvdv`^YYF`VdvlvhKYYFhVl1tttpM1YYM؉DpTtA u1MYYM؉Auv<=X0u 0(1E؉Ẻ}EċM9MSuu5(05x0躧rVVif%ZYf=u+=0u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡(0`0`0=0`0ЍeY[^_]aUWVS u} 0M]1EuuWV%  ‹Mt WVh#u1H0L01h0l05X0=\05P0=T01@0=(08#AH40=0态1ǣ801ã<0005,0t C<0 =00 ,0Qht(0ZYu h#te[^_]á(0tUPjZ1ɉ (01(0UWVS u=0tFVFV zEU0H0AEUSQRP)  w 1҉UtE4PoaX30RPuu # 01{{E U 1҉CS1CC E UC SEC$EC( 01E v 9st DpTtD(D,T0Gу} w0090ub11tDXGu뺍PReZY=0u h%#r00d0P00e[^_]UWVu} 0RPWV" 0t9xu9p tWVhD#re^_]Ã=0tQUS00\;0r 3 ЃW$0  B=0=0tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u1P0T0X0\0FV =0tGFDG FHGXGpFDGtFHGd F@VW[X=0=0t =0G\uG`Wd uGhWl tlh#Ch&#ou 1ɉ 021G\G`GdGhGl f!0XZ=0ub0X4 ؙN0ʋF4f0F0V4=0LGWF 0W\tF@I0D11 0 G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPhN#mA=0t h#2Yh #7mZ_XF0=0tV4CSCh~@jjv4v0vHvD wh#@h#lH ZY=0t 0@ 0 4e[^_]UWVS 0E1ۋ 0;Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEUH0CBHLY4DEUE9ƉU}:E1EEUH0븍U1E 1ɉ 00 40 (0 ,0M0];X,}|1Eu| 0EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh`0p5|00}=h0t =d0t =d0t50u5|0P =0tE@x 01҉EU= 0t60p,kEd1<SVuPh#h, G1 0=0=0ExU t1U u E#uh#=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEE0ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EE0ËE} u 1s<}%?}u}9t uuu(xYuuh#;jT<1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]5H0=L0|UH0L00M]11 19E}eu509|]s1-h1l|]+hlȉ uv/0]1t_}}9u}9to<%?u9tSQh#:j:M]Wx ,Y[M]u Wuh"#9MEsE)lj1VEi1`0e[^_]UWVSEP@EUE@ E}juu# t`0t`}9xuPu9puHEuuhs#Ep p{ `0qyEpxu}qy `090u 0u덋=`098tEUMK؍e[^_]UWVSTU1EE 0`0111E0x,9}= 0t2kEd1E7uWuPhO#h,TB1= 01ɉM0M;9ظVSXZts]ud0=0tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=d0tf‰Ã=d0tÃ=d0tUWRPY_}UWVS EX8=0t 1Q=0tt1;@0D0slj}1RPk@C^_DžE@4} G0.3Ch-$PIZY'Mqy u9tXY_8u695$0|_ssدFXZC SCS u95$0|)js s]Ahw#,#h#%O 3ss訦1ƅs{DžV ^_=0tBBBpBtVR`ZYu h#["_PsstQDž ss輥VPtVf@Y[5$05 0~VfHXZ:e[^_]UWVS(EP@EU 0E0RVuu5 EEmƉׁ\TtCЋU!CQC RPh`0S5|00}=h0t =d0t =d0t50u5|0 ExU t U tuh# XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUMH0EMB0Åt4}9{u}9{tPHSK0P!X#E}tlExU t}G`ǡ0RPuu ӉE1EЋE̋Uǃ0040Ex@t+jj0@4 ؙRPEpHpDp pa 0Ez89x t0}t*E@$ EL@ EUMM}ttto0E{89x u^E@EL@jRPEpp K` tPuSYdh 50505050W=d0t0PP-zXZ50"0h`0zR0e[^_]Ã=d0tUWVS\U1E 1u0X,9] = 0t/kEd1VSuPh#h,W'1ۉ 00u1EE1ɉM0MU;9WVWVQEu} 0tCECECXCpECtECd EEP$%EXftbWVYZt=0WVh#!WV^YZt!=0WVh;#g# SEP襛XZ0Ѕ9xu39pu.JZHX0R7jh#EPLjh#$tC CC Cu jhc#jho#EP躴`WVPhw#E?Ee[^_]UWVS0 0|jj'P1󪋅h_X=0xX$=0uh#*G^uh#)[=0t؋1ɉ$0h 50505050+T=d0t0PPvXZ50t0XHXI$~6}#9)#~$tl<hNjH`ltW,Ћ9G0sVh#$^_n=0tVh#Y[h#EZC=0uՋB,t|Fl$1~H`F|@ltË#XLS5 0n |^_u h #| 00h 50505050Q=d0t0PP/tY[500Z0tt DžPLDžHLPP1󪋅lPP TCHX$~@=X0u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPh' #1hDž\L1 0׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtxH0ttx1tX,9t= 0t4ktd1=VStPhJ #h,1 0tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh`0F5|0|=h0t =d0t #=d0t50|5|0r =0u-|xU tU tthr #[^=h0th`0(H0Y=0t =0uh0 0 0 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505x0kC 0𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh0E=0tth #XZX0ph5050q =d0t5050*n_X0\8 uǀ\T5050KY^=0th #PE_Zu)5050CY^u90u 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505x0Aj50HXZΉlߋpËlቅlpplp8T<DT9ƉD} TD0Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh # CVtuPU u PU u P1ɉ`T9lpDH08lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P  =0`t'W3VslsQs th #(h8!#PX<ZYtej PS薿h 5050耿5050A =d0t0PP-d_X50 0^1ۉ0=0tP|x\|P uT|PTxU u |PTHU u HhRP运 h\!#\P@;ZYtw\S|u HU uHڋ|xU tT |GThRP,h`0c;010=0u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPht!#,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPh!#OXZlAu농U u PXRP txh!#P8Y[taU u P|xU t |G\XRP蔻h`080t j SVp  =0ts h!# Dh8!#Pu7_Zts󥋅ƀƀh 5050菺5050<=d0t0PP<_Y[50&0Z10e[^_]UVS1;] s8Sh % ^X1E0Ph"# FZYuj XÍe[^]á0!UVS1ۍsrT =0t40,hM"# YX""#t5"#P.Zty=0uɡ0t4象01ɉ Lh P50O5050;=d0t0PP]XZ500X150Kt00=0t he"#O[h"#-Yti=0uۡ0 h P50荸5050:=d0t0PP:]XZ50$0X10jWjWYXuj]Zuj]Xe[^]UE( 0E 0]á( 0á$ 0UE Puh,tth,j !j$UWVS]8ށu= 0t5( 0h !sYX=0t"= 0u5( 0h #O10XZuu  ZYyWPhޑ#$ t7= 0t.j .X= 0tP5( 0h" #jde[^_]UE Puj' UE Puj UE Puh UE PujjUWVSx1ۉ$ 0Ph͢$^_yhR #hVu臺 ]t Ƅ1PS蓇ZYySha #LY[u%=`uz 9u;u$ 0Shh 0ƃ uShq #뜍xPV_ZyV끋%= Vh #e= u:u*ShV t ÿ"Sh #0S [+S Y0hV u|h 0h]#5XZ|듉e[^_]UEPoZtPRPh # u uh #hh0K0U塄0tjXj USj0h %j蒷 0jjb ]USxjjj8 jj/ X]Åt3USӃ=0tPh !YXSh"#XZ]USu=T=Tu =Tt=Tt=8 uIl0t=u 1111d0\0 `0h01<=T=Tu = 8u1ہ=l0묃[]UE0 0t,\Tu ǀ\8 Tu ǀ\ 8=0t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC"Zu"h?##'[=d0t h^##)Y=h0t0PPQXZh 5050 =d0t5050QY[0\8 u0ǃ\T1\T0uSChEZu##= V 0΋0ѡ0ƉϋKdC40RPWVɩ 000 =0TC,HEƉ׋Eǁ\TtC!C1uCRPh0'=0=h0t0PP^PY[0ph5050m =d0t5050&PXZ 0\8 u ǁ\T50Q50u tc=0u##EKh##A=00shX9s΋9tRP+0Ph##h050*h0 0[^ 0t[h 5050v5050,=d0t0PP#OZY50 00X0e[^_]UWVS]u 0x00xPSB{Y_y 0vPSh,$#f=0t(jSF |0_ZyT 0EPSh?$#5%= tSh!wh#p u18=0t x0=0t"hR$#/_jS趭 x0ZYyShb$#1ɉ 00 0u Sht$#XZ10 0$00001000010h h0h hǣ0h h0h h0  ʅ ʅˆt h{$#VSY_¡0t"ujVl _ZyVhd"Qx^|0=0u%RRjPVM8@t00t:0 0 0PDPj5|0S7@u Sh$#Y^Tu Sh$#h|$tV_Zt%h$#VZYtVSh$# `LuSh%#C\uSh$%#+50V4uShP%#uShw%#f^_uSh%#܍X1‰11p~u 1ۉ0}Tu%HSQRP] DžTӃ~ ƅtBtѥPD1D1É1P1RPWVƢ OډSWRP裢 h%#Z1ۅ~;srPƉρ}Tt!1׋ t101t ;r5Ch%#h &#h'&#h@&#he&#h~&#h&# 50h&#@^_=KÅt0\Tu [t1ۡ0!0=0tth&#[u h&#YY0 h P50耣5050%=d0t0PP-HXZ500_1ۃ=0t0Ph,'#Y^0=h0uNtJt2=0'$#=0tZ#Ph8'#XZ=0u h]'#X08<P0T0C,@01=D0C0k NKt鉅 ׉ ЉNj׉   =0=00=0x=0t h~'#^h'#[01҉XǀP1ɉh P50F5050#=d0t0PPE^_500[=05=0t h'#Yh'#ZX0PP #0ǂL1XǂP1\h0RC h 5050J5050"$=d0t0PPD[^500Y0 tyPh (#h# Hu^0  h P50迟5050 "=d0t0PPlDXZ50V0_0vuh0(#ghU(#`[^Hu\01ɉh P50<5050!=d0t0PPCXZ500X0@_X50?00^0(=0tx<Phn)#JY[=0ăx0(=0uh7#ZHuqh(#/_=0th 5050֘5050$=d0t0PP=[^50m00Y 08<qH։9u9RPh)#q0BHЉ8< =0uh7#. ZHuqh(# /X=0th 50505050K=d0t0PP<_X5000^ 0@DqL։9u9RPh)#0BLЉ@D =0uh7#U [Huqh(#3.Y=0th 5050$5050r=d0t0PP;XZ5000_0=00PH҉8<PL҉@D1500=00=0?,=0t h)#i[h*#I Y00ǀ, 04ǀ(<PH҉8<PL҉@Dh P50ϕ5050=d0t0PP|:XZ50f00X=0OL9=0t h*#lXhF*#L _00ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S50y5050=d0t0PP&9[^5000Y =0tv0=0uhh P50 5050X=d0t0PP8XZ0ph5050Ɠh05x0 50Sh‰L^_u Shk*#1׉1ɉ509)~09~NjLWF8HLNd t1RPS5|0 t>t Dž)h*#h#^Zu1ۉ0j=h0tHWSS6 0WA8HLId t1RPS5x0 =d0t WSS6 0@0 P0T011Sh6£H0XYu Sh*#1׉^,jSA0_ZuSh*#}=0 @0D0 ȉڃ9 sA0001ɉ 0 0jPã0j500…ˆt0Ph*#"Sh+ 0_Zu!Sh+#[^10jZ7&0 0=0u*t!h$#PZYu X0 0>hSP5<05|0ƃ (0,000<0=LBALt[=X0hD+#h7#Y_jjjjjS6:=<0fGW69fG@0CJtejPhc+#k =0uh #BZu9h#&X=0tC=<0fGW8fG@0_fCff=v]h+#Y=0uh+#Zu8h+#%X=0tfC=<0fGWZ8fG@0_fCffuih+#Y=0uh7#lZuDh(#I%_=0tjjjjjS8=<0fGW7fG@0f{f9}zD3<:uƃu}EEUEURP50u u 09u0E ;}|v0EUtJ9tFRPؙUEЉEe]EUSQRP蔄 RPhh-#RPh# Fyj Xe[^_]UWVS}u EUEUEE0ؙMʋEeEUMuuuVWŏ 9Eu0UMG"whv-#X19]~KؙEURP50VWt 09tؙEURPh# 0E e[^_]e[^_]UWVSQƉӋJt,B=0-#9u5"s sRh-#C 1҉Sss ssV01E1ۋ09)؋r09~ƋL߃=d0t VWWj) 0VEA8HLId t1RPW5x0=d0t VWW) 0X0Ede[^_]UEU z t]]UWVS]0Hdu } t1@ 09{ u9st7S5x0D 0uWVs5|0Cs{ ECe[^_]UVS 050 0t+NdEU  t19S u9CtCt[ 0uh-#uu uS$SPC 0 0X 0K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPh-#9{@uRs s8 Rh]#XZ=0th-#Yh-#Zu 1]UWVE5 00x=d0t50p5 0 * e^_] 0ÍL$qUWVSQQ9@0 D0s RPh.#H50 01ۍ}WSQRPnx U Ƹ8,;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE ͢$)uu1_Z=P 0u <vuE !]e[^_]P 0U1EEƃE9Eu E9EEUEUEUEUEUEUEUEV ]uuMURPZSD)lj$SWƀwG/ 9raEUEUE Et@EUEUE EC"RPMURPcZC1ɉ P 01҉P 01P 0E EtF?N)Eu ]e[^_]UWVS]\TUH} FE 8uh`D} XE u h=.#h`SP =0t hd.#_L=h01@J =d0uE PP1$Y^E \=d0uPP#XZ1fEfffE@9uރ=d0tE PP#_XE \Ǎ=d0tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P| UWVS}u=010x0y |0h0P^_=0=0=0t h.#v[h.#VY=0u׋0 0=0ux șRQy 00h S50{050S2=d0t SS XZ5000x0Xh 05x05<0yh`05x05|0^$01t- 0t%FS5x0{s/S)ϡ009t )Ph.##1=0=0=00=0t h.#^h /#[u 1ɉ 0=00ƀ1҉PTXh P50wz050S=d0t SS(^_5000x0r[=0u h /# Y=0tshF/#0h 5050y050S4=d0t SSXZ5000x0_=0tqh_/#z150h 5050my050S=d0t SSY[5000x0hZ=0t"D 0 @ 0kdPQShy/#/5|0Y~ Xx0Ee[^_]D~ e[^_]ÍL$qUWVSQ(E11҃}50~8]9 P0T0)ӉMЉ]ԡH0E1҉])؉EȉE9‰؋]1EEЉEEM]KE9t*EȉEËE]̃rAMEEE؉U܁\TtFЋ}!FEU܋ 0QF EURPh`05|00=h0t =d0t =d0t50S5|0 {U tU tuh#XZ=0EUؿEЋEU H0{U tEC`؋Uu؍  0EU9Uuu500=400MLU9P8u+KIjH`URSPU)S$) )Q h 5050"v050So=d0t SS^_500h`0 0EY[E]9]yV11ҍeY[^_]aUWVSu 0!Ut 9rt8R}t-jXu h/#s1rBЍe[^_]USM 0#AUY9u ЋR9uX[]USEU 01!t4^Fu(9u 9t331 É[]UWVSu} ]9WV+ZYWVqZY0L 0t9ZtjSPL 0 L 0M]XM ]$HX H 0t}9xtju50eH 0 H 0UMHU M$PH e[^_]ÅtUWVS E uV8%<}EEH89~kًEuC`%E4 %ߋE9x8|EU!9u(EU|EUqU߉eMMG빃 [^_]US] EUR`t(t7uS /u<<+  !8]Rh%h/#UU ME@`t+tDuTɃu:< %ЃPh%h/#oUSE MUR`t't6u?Ƀu)3  Rh%h/#]USE MUR`t't2uAɃ)u+5 Rh%h/#舺]UWVSu E$ %EFlU(EFhUEEM}}~ ExE$E8NpU9r UùupE9} Etуu EFB܉)EX؋})EyEؙ}ǍW?ك9M}tu :JI)ˍD}9~} UEU~E U+EU~E U+EUE$E~CUuI[^_]UWVSu]tV轓 _uVh!j謒 `1ɉPhd@u 荰 tGRhedAu \ @u!8tuh!/?XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(hC$=' ƹ ߋSh!Vk CPhC!V] C Ph!VK CPh!V< CPh'!V- CC,$C,Ph:!V C0PhO!V tPP X}!uhzd@u  @RhedAu  @uuh^!j 41}󫍅Pu>^_@4ȋ949t(Ћ}1ۉ1E1ɉ [Eƀ*P;j PEP賶1e[^_]UWVS4}jhPjW[tGjPjVWVq u$U ʋMQ؍e[^_]UWVSu] 1PV=ZY1ɉ%= j/V_ZxrPRV)Ph/#h0WjPo ‹ 19}e WPZY u$PVT<ZYyA =@uuuÉ1ɉ PS;[Xuk%=@u/h/#h0V޸V ÉD= jn XZy.hh n à 1҉PS觞ZYt-S-o Y 1ۉ 9u 9t0P_Zq8T8PRPS° s>PhFS诱 yL48Stn Y h/#j$WrjjWjm Ãy}tWCcMZt8PhF|@S4 y&hF S"^_PttP_Y}}Wt9P+XZtP Xiutߋu0P٥_t P̥YtdZxS)m 룅tHX؍e[^_]Ƀ=d0tf‰Ã=d0tÍL$qUWVSQ0EЋAEqy AEĠ0Eס0X0]؉E܍EPuuWVz] UMUȉM̉E9މEsMp1Mȋ])jj`SQ_ ǡT 0U4ڃr h/#迯_W!ʈEċxlEHX0!9tPRPh 0#uT 0u< =0t h(#-^h7#2[u 1ɉ 01!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=d0tUWRPPY_}UWVS EԉUMQƉ׋] 0H0ș9Ή}EE5EPWVuP0;B0u Exth,0#tX0@0RPWVxa UBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hC0#ˬ,=0t h(#Yh7#Zu 101)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSN0;B0u UztWV2K_X5d0u  0QrRP3 E@ `0M ȐȔh P50b$5050[^=d0t0PPEZY50/0Xe[^_]UWVSE XChSlEEUE EE=0tP@P @ƉuOEXuh~0#1҉0YX5d00@0RPWVqS E@ `ChSlEUE Eu h0#蛩0H0ș9M}sE E>EPuuunL0;B0u Exth0#PX0@0RPuuY UBEPT@PChSls}EgUBXEU}GWEU G8W<50#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tE$""# Eн/$"#00}}{rT 9RPYXJ0ws$%1҉Ut4Vh0#=0h#Xt4Vh 1#賨=0Fh#tYRt4h,1#kjt4+XZf%f=tC0ڔڐVPh\1#5=0h#XEPjjQJ=0;G0u Ext+Crt4ljE G0E1ɉ ‰L_XP=d0%JXF^9t(ߔߐVh1#蒧E`QB9uР08BufJEf9uwh#@_uS h#/Yu(h#Zu10}t0ؔؐ,F_X01ɉؐؔ0{rT uDVh1#ʦXZ=0t h#^h#YsS50,XZ0t4*EEPjjujH0Z09u Extuh1#1j膦@E܋E=0tP@P @u4puSQRPV EPLƣT 0X1}9}~h0X01uE)ù`1j@@P/_X1U9} MȉыU @ۍzEE܍Hhhus EPUEk[^1E9E~+u܍Lphus EPUEFEEFEE9EE} EEUEF EEE܋EU)ЉEFV EԉU؋FE9}sREU tEURPuuS EEËE܋M)NjFVEUNEU tFV RPvWSg Eu21M]FVEUF V$9|M]EXEe[^_]UWVSÉЉM9}y}܋K9th2#h%h} h2#s{u}M9MMU}u׋S K$UM]UӉى)9s )Ћu}1M]M]9ȉ|EU}We[^_]UWVS1<C08C8t3h2#h%h, 7HC8tJHJRXF9s4sth3#h%h2 h2#e[^_]US]{,tYY 0t h3#Ys,轐1C,MZ{8th3#h%h h2#蚫C0E]逐]US]{,th83#h%h h2#`CPtPHX]];UWVS\u }1tJ www?wXY 0tWuuuVhQ3#蟡}}shuuVPWvEԃ9=LBAWtPh3#2Y[EOE@ 9G r}jTj輊É0pEUCS {,EP,@(CSEPD@@EUCSEpHxLs {$@ C(EP<@8E؉U܋EP4@0ẺUXZE EuE EtAh3#hx%hF1EU+EU܉u1ɉMuuRPL @EY 0t$uWVuuuuuuh3#(EH,ESsS{0th3#hd%h h2#<6}؉9r<WV‰C0Yt1EHC4Ep8x<@0EE@4EKE3u}}u9uG}uS,EPMEZC,E=NBAW?=OBAWt=MBAWCEMEEEEu;p|EEE}D8ME1}̉}ЋEUEĉUȋ}9}E}T8D8 uuRPRL EUЉƉ׉‰t,;x u;pth 4#h@%h ouċ}ȉpx6jӃpx UċMȉPH#s4S0 ^tAPC8MUEU.EKEEEu;p]EE̋KE}̋D8E119u~wEM̋TD uuRPJK щ‰t7S8h2#h,%h pJS8tHJHPWXENEUKLM̋My t*{DsH1{LKPtE؉UQ1ɉKP^E؋U܉CVh]#htQDhdv$v tQhS:#W>,jVjhdv$v W 6lQPl/S=mX1e[^_]UWVS ƉUMjQRPtuh9#V_XfUt+tuuh:#VSl^111 tuB t@uمtr} }uWuRJtjjh:#V~jjh:#VjSjjjjjV pfuuh:#V~uuh:#VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh:#V ~#1ۉESPuuRRh:#V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 SjX렍e[^_]UWVSu} hjDfY[u)Vh";#XZÉEEU(,E$E U$0418%jhSPVJRuhVSVvh7;#Sb<RP`ZY@uhC;#B$D%=u?$Phd@>t @uhO;#S&^_$uhf;#M, ((Phd@s @uh};#뭋, (h;#S딋Eu ǃ$$, (uO1҉MRQWV'  ‹MtQh;#SV (,u(,EU싋$1҉MRQuu( Ɖ׸9ЋM|RVh;#StRVQuuh;#SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tP. Xh<#SSqg 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@q @u%h*<#SXZuShI<#S E]Z. ]US]jSYZuh<#jS YZuh<#SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|PtijWR/ uYjuWUu!@uuZYjuPUu@v0sh=#us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h=#S 1e[^_]ÍL$qUWVSQ qyAQEUy uh=#S{ZY8$E܉E1EuuWV  tuWVh=#SBHEPuuuu Ɖ׋EU tuuuh=#뷋]9ً]}eY[^_]aUWVSu 1ۉ^h$5l63 _X1td1SщU%M}YZMtUBuSh%>#u} %%  Vh$ju3 XZ똉e[^_]US1 %%uhA>#q`u܋]UWVS ]} Wh5"Sk 1%%E؋E!ЋM#M t:5";tf"UWPS4W%S4UҋE!U!E`uE Et;uuhO>#juVo5";tf"WPS-4WVS%4؍e[^_]UWVS]} tEU E U uhV>#S_X S^u E@P;E sPu he>#S؋E pVSZYEtu h>#S 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u h>#Sn Ee[^_]USP] ;u:j EP5l6ڀ U:u1҅u5l6hO!u Ћ]UEUitstau+u PJ uPZYUg@Rh>#P UE ft*u 5l64ZYt5l6h>#uA US] ;u#5l65Y1҅uh?#u%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h?#PY[E1eRP6 $RPn[ZR@8Zfu%S5l63ZYQh(?#P\ ֋]UWVSu }jj h5"WVj]S yEWVuhA?#fm}t Shޑ#RmZYj jlXe[^_]UWVSQ]M tu E𿉴!E𿙦!QhI?#S'M $jVXZM uWhd?#S 9jVQjjuuS U 1ɅuWh?#SKVZ‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_Zth?#2jS,Y^ujjjjSbEUE Eu h?#SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h?#PP @9E}}EU u h@#'EUjjjS@ $uTY_u h!@#jPjuujjS9 uVXhF@#SZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u hf@#a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9p,tE `%1҉Ue[^],(hA#)$hA#h$1RP,(f RPhA# hA#蚯jSm uhA#聯XrX CRPhA#Phs,s(hB#s4s0hB#$C8Ph"hxVi-Vh,B#hsPh>B#g 1e[^]UU E$E8E U]UWVSVEUFV E܉UEUEUEUE9E EM|vuahC#WE UEUEԉU؋E9EEM}6u&uuuu uuuuhC#W(1FM]3M 3] t?uuuE Uà hC#WEXZ맋M܋]3M3] ut.u}t#uuuuu hhC#WEFE F E$F$ku}tRB#}w+M%B#}w M%B#w %RQhC#Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu  t/E؋UWVRP щΉE؉UMWVuu  t/EUWVRP щΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuu EUE Et6EЋUEȉUWVRP Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuu ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw UyhC# %uhC#urXZ~thC#O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuu M؋])ӉM]MЋ]9]u 9M9ME}uuSQhD#uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uu  ‹M؋]t&M]uuSQM] M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uhC#u+GxpF)^N^ 9MEu h+D#~t hOD#FV E؉U܉ȉ+EUEUE9E؋E܋U} hzD#E؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yu E @tF}pt&}At/}fu:E΃}su+E뿍EPSeZY@uE95p,th%jEuSẺUjSE t @} thF#S"E@ EjVuuSBu@P EE1uEp@Eă~Z1}9 %u %(@=uUQh(F#j@h` 0U` 0UUPuhF#SUEt/wwUX8uatCt tN-}uA1h 1h RXYS}uMQhF#S jHJ8QRUPUr 1B$E1r(z,ꀃEE}SI_@tPSY^@tFUȁ¾1uuuRLuS@uhG#SmZY1EEe[^_]UWVSSÉЋt񾉴!!!!Ujq Pq qu uSU uWhJG#S &PS9ZY@uWheG#VWhG#S1e[^_]UWVSÉu uRP@E Ut}ME䉴!E왦! }MEE䙦!E쉴!@ Ur $Ep PFVEPF V$EPFHVL1Fv V1FE0S2@uuhG#S uuhG#S1e[^_]UWVS]} tE %1}e[^_]SEUjS thG#SjSjSu jSgjSY u u%hG#S[^u4usuEh'H#NjA };x$uu;p t+I }9y$uu9q t:PhYH#Sl jjZY@xu 4 tjSY_0uu tjj__Z@ujjjjS u h8#jjjSƒu h8#ljfǂUjuu썂UPajURjjjjjS.0PSY^@uh 9#SlvhH#SXZ1 /u}+rz WVe[^_]UWVS4u ] 1El"hH#uVX7 tPSu @u95p,th%j6ZYjh Sue[^_]UWV%}^_]UWVSH]u }1ɉM܉MMMMMMEhI#WV6 Eԃ @t=}buEPSXZ׃}qtuԍEPEPEPSB@uE95p,th%jlE1;EE}1SOMu_t xuPt9pu 9uU@uuuuuSẺUЃ}u }E܋UEĉUȋE؉ESZEHEPSEjh%Puuh>#S) e$1RPuu; EUSvXt E;AtIhRI#SXZqy U19кE}Y9}uT9uuOU Ut(U19ЋU}9MuuWVN  ‹Mu}t 1}hI#Si[^uuuuQMSẺUЃ}Mu}t{9}u9utű}1yMăEp(x,SY@tJup(x,S@t$uűMq1uh2I#S>Eԍe[^_]UWVS@]u }(,EUEhI#WV3 t(qtsu&jsEPjjS@uvE95p,th%j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE EuuuhI#SE$1RP,( Ɖ׃u؉}܋}9ЋU}uuuuhI#SjSEZYtE̋EЋ@E Et hJ#fEЋ@ EjS^_u h<#?jSzZYu h*J#!x G EG$EjSG jS9 tu hLJ#S^XPH UMċM9Mu"M9Mu}u hcJ#SY[1p GPGT<9s/jh%V tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuhJ#4E؋U+EU9E̋M| hJ#U9UEUиM}9|E 9ȋU|&}tE؋U܉EUhJ#SXZE9E؋E܋M u}uU4}u hK#SYX UMH0xhJ#S{XZ1}9}[uujSD@1jp juuEU+EURPS uh$K#S @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋EhEK#S_X}ffuS7Y^@,hcK#À}|hJ#SXZje[^_]UWVS]1uuuuu11hK#uu . btENtoat%itClhz%Y1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9p,uEU t th%jZYWVRPuSe[^_]UWVS EЋu} jj h5"RPj]S yEWVuhK#QG}t Shޑ#=GZYj UFXe[^_]UWVStƉPZt 9St[RhK#V *{ RhL#F$1s3щ¸L#$1s sщ¸A#Wh]#hV (Wh"htS SV*Ruhh %V@ SVhK#@FGPh"hS ShYM#!F$jmSj$G8P7ShM#EhM#EG0W4 uhK#X1RPhP?Pьލe[^_]Ë `,Q`,y ;p,| tX,J X,UhX,PJXZUWVS֋U} $%E(L#` u>h8#EX ׋󫋃V6h/L#DXE8#e[^_]Dh?L#DX8Sh"htS Sh9L#DshNL#E]L#EkL#뚋A t h/L#aDXhyL#VDC SX1ۉ019u 9tCuEL#!L#t5"PPhz$C hL#C_tjmWj$8Sɽ1tttSh"ShL#hWWh:L#[CZY?h8#MCXu+u"EL#VE EL#e[^_]Ce[^_]UWVSxh{$ hL#Bh;#x hL#BhL#Չxà DžpL#DžpL#s3x ptBs sx pWB Ct PhL#$BK Cs31 W{ Wh]#hPD Wh"htV*VPMuhh %P< PhL#AXZ{ h 0h"hVVh M#jAVh8M#_A hcM#RAjj h5"x$K x$cRPjV x$K x$cRPhZ!@ "jmVj$G8PVhM#@hM#@G0W4 uWhK#複X[tVh M#o@GPh"hVVh]#K@ZYgRPhPP>h$'"@K Cs31 OC tYC 8P)s t󫋆Rh"hVVh8M#?1e[^_]UWVS}] u1EEEEhM#VS^% t^l`~\a wT$%ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9p,th@%j^_xjWZYu hM#ЅX]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4h{$ hL#C>h;# hL#.>hL#7W+ƃ EL#EEL#v6 u=v v u=  FtMPhN#=XZ N Fv6U vXZp h&'"`=Y볉؍e[^_]UWVSD] 1}%}E6N#uhCN#uu # tditHTt*PLt7olt Pwb&hz%Y1tukVS_Z@ut6PEPSB @u#tjh%Vɾ t E 9p,thT%jZYVht EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMhN#uV" tfitLat%bt0lhz%/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95p,thh%jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0hN#RSa9]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk%W胼 uu wu4 uRCu1jSk%VH u%u vuh4 uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh O#W@ 4 uEyƒtsV'ZYu+C xu"mt s sFYXj ZusXe[^_]UWVSE @80ƅ77Ph$"u t 7u.Cu X0u: ^t hV#0p jVh|R'# Ttg81ƅ9tR'@󥍅8PhV#jPSڃ0PhV#jPuV VShV#j' Sik[t hf#j; T˅t_S zuR(,Ws%ZY,u1(zu%B sVC ZYu+C xu"t s s>YXj pZukXe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h%hU#u0^uh%hV#j sP3s Wsh $u| t.PS Eh,#u| E tZu1 EYLEPh"u }Chs@Pu  @qh X#u*| XZt VĊ YhX#u | XZt Q覊 XMEPh"u} E Mu {hE EEEM؍CU`EPu u @Muh%hX#fEftft5fu6t2C t Wh-X#j }tC(UhMX#C0ut3hiX#j t C0sHtS4KL9sщ}t:s@shu  us@s`up  @u;4$81t/sl`}t$CU[s@s`u:  @uEsd6CptSuZY@u s\hX#s8sXu  @u s\h]#te[^_]UWVSPu-x Zu1iu Ny _tQV表 Yt=W} EWu tz MuSx V艨 [^PQSz uVn ZSw X؍e[^_]UPEPhy#u% ƒ 1tEUWVSu\Ph%X#V t\Mfnj4Zu\VXtd$1jRVVhiS@tt}f1RPh%X#u  1e[^_]US]uu S? @t ]]1]UWVSu ux [^u "P Y9Es"?V# Ƌ}M)1Ze[^_]UWVSu uMx [^u k"P貆 Y;ErN"?V輆 Ƌ}M)1Ze[^_]UEPhi"u+ ƒ Eu!UWVS8uEPhX#V uhx|$h%hhX#hX#V~w _ZtP ƹ}[E]ShiV5}ĉjS7 PhX#u w ƃ S覠 Yt=EUu؅yكۉM]! EjEP XZuVhX#u }w VG He[^_]UWVS1Rhiu4 @t|j7RPhX#hSހ>tVhY#, Vt j7RPhX#hS;tSh%Y# S}\ e[^_]UWVS]hX#Su Y^tVPO Zth5Y#h%jVhX#VU ƍUܹRhiS3@u hWY#j< e[^_]UWh%1󫍅hPhiR3 t|}UWVS\PhY#ud uhx|$h%h0hY#dShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPh#V uhx|$h%hhY#<uS1^Xu hY#j CPS ZYu h%hY#Ph X#u t uh%hY#j S1e[^]UVSSu] EPSV @uh%hX#jL hZ#Vs ZYuhZ#h%hhY#r X#Eu,#PRSs He[^]UVSSu] EPSV @uh%hX#j Eu h3X#j hX#Vr ZYuhZ#h%hhY#PhX#S}s He[^]UWVS}h+b#Wr [^uP pY@vh)Z#VZu h>Z#j VPh+b#W@u hWZ#j xtdPhiWp0 thnZ#뮉`S X`e[^_]UWVS}h_#Wq ZYurPH pV6YXuh{Z#DVSh_#WE@u hZ#j! 1҉Uu]EPhiW/ @u hZ#j S_X1e[^_]UVSÉЉʉƃ ι"u5"QuRPShZ# e[^]UWVSu1jS,Vhxi P@uhZ# UЉUPHXۋUu hZ#jv U]Vhxi WA @uh[#ڋE9E~E1}~ Wh]#`FXZ;u} j oYj eSZjUVSPuVZt"ÍEPu V @u Sh[#j @PhUWVS$ƉUЉh^#Po [ZtP~ ƹY1@]Shvi V.j S| Ph^#uPp à V HZe[^_]UWVS0]EPh*[#S uhx|$h%hfhY#YMԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EP{ XZtVh^#u so V= He[^_]UVSuV[th $Vn ZYuhZ#h%hhY#sP } ^fx PS+ZYu hY#j P:X1e[^]US]EPh0[#Sb u 4&juS,ƒ 1Buh%h]#mXZ]Uh9[#K1US]dPh}$S uhx|$h%hhY# d|lPhiS+ @u hp[#X1]US]dPhj$S{ uhx|$h%hhY# d|lPhiS>+ @u h~[#pX1]U1EEpPhiu+ t hnZ#j] 1UhZ#ul ZYuhZ#h%hhY#z Ph X#u m HɃ0 v+BwBÍBwBUZ]UWU1ERhiuG* @u hZ#j 1}W|$wUWSÉЄtGjj h5"QPj]S S z5"t"PSh[#i h!"¸f"Xe[_]g_UWVS7Th uhx%h[#j jLh,6_Z5"t[#jmh,ZY¸[#u5"WPSh[#h,=h,t VW?Xjmh,ZY¸[#u5"SSSSSPShd\#h,H$V jUEU P]UEU P]UEU P]UEU P]UE1҉T,T,1]UE1҉\,\,1]UE1҉d,d,1]UE1҉l,l,1]UE1҉Pt,t,1]US]Sh,YZt =CЃ v؃߃Av h,Z>u ,1]UE1҃t` 0]UUp,t H9t@]UWVS81ۉ]܉]E䀖500EЉ]ԍEPj ZY@MЋ]u h]#EU׉uȉ}̋}50ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEPP[@tEЋU ЉEhf#j uGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEP` Y[=0u4]늋U9ыUjSZjuUjEPj& ZY@UE]9u]9u9}~ 9UȋU}h{!"j UWVSÉHPZtP_D 1D1V9"LY@u h%hU#&RPHSƃ uh%h]#j[ R1RPh^#hWWWVh^#W jVWWhiL@u Wh^#}t Ph^# XZjVWpWh~iL@tt Ph^#Y_j pHZ@uh%h^# u =`,j:RPh^#hW?tWhI_#VW| j:h^#hW?tWh[_#W| tHSW?YXjVWSDž@WhiLkuhh_#XZjS#jVTWDžd1hlWhiL @t|hXu h|_#l@1dWhiL @@u h_#@lh_#@R = 0t%o͡!wH%Rh_#Y_HS XZ= 0u0= 0u'DjHSDP jV`VͿV 0-{k?PL@uOd#= 0t]#Pj h $_# 0%X the#f"X th͡!f"oX th_#f"MX tRPh_#f h $_# 0j_ the#f"^ th͡!f"Y th`#f"Zj 5X,X%SV65p,tjHSVv e[^_]UWVS]S^t EPu S @u Wh[#j# u b^ SB_ YP^ Etuh%h `#j EPIEZt hf#j u1EVtRUWZYU}tRUu|ZYURhy#S tFE= 0tFtj= 0tFu[= 0tFtL= 0uE= 0u+Hu)}tj VXhX,v褄ZY U6"= 0tj #XS蘉 u萉 upNjbUWVS,ÉUP(^uhV#@hc#S_ ZYucU̹ Rh8i(S @u 8t h#c#jT jhc#ux uh%h0c#j- Eܣ 0 0u VhMc#j e[^_]UVS։PeVSPh_c#j UWVS]U hwc#S _ ^_uh$h%h2hc#‹ 0ށ؃E u %ERU>m NjUR[m WP负tDPEVZYUu s"9ER|E ËE É 0X1e[^_]UVSP]U Chc#S8^ ZYu VWPl Sl VPÃt7EPS5 0ƣ0S1Fuy"U 0e[^]UVSP]U hd#S] ZYuh$h%hhc#Pk Sl VPxÃt7EPS5 0Kƣ0SJ1Fuy"U 0e[^]UWVSS]U h%$S] ^_uh$h%hhc#Ƌ 0%EVPk Vpk WPɝƃt1Pu<ZYuc#EM É 01e[^_]US]U hEPhc#S uhx|$h%hhc#D 0%˃ uˁEU ى 01]Uh,hc#EXZUWVS]h%$S[ ^_u3hd#S[ ZYu"hc#S[ ^_uhwc#S[ ZYtP 0 00!‰ 0d$1󫉕tVh7iS @u h(d#j e[^_]US] u薨Ph]#E tPYt Ph5d#XZEPEYtPSh$ $܋Et Ph>d#XZ]UWVSuV[u hV#/VYu1P4Z@u h%hU#p 81jS8P裶8Ph8i(4@`%1󫍅`PhiVT @uh%hKd#j tWph[d#X%Ht#t8uP9u Q7XVhed#|XuShld#_XjPY^u h !j \8Ph8i(4 @uh#c#HQPhd#h$HH9Tt$h#h$Tj)j P4Z,H%(h[d#l%_1ҋ0t`%xtO(9u 09t4#HɋL f"u5"QPh$ ,딅u h %^j YjmZti 119X~M%9u>uWPhd# hd#hd#4j F뫃 u]e[^_]e[^_]UWVSӉϋuuqT 0{T Zt2tVWPX u3ŀ 1ɉ [u1V谀 ZV觀 J Xe[^_]UVSu]}t "jj NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6uBpWQc Y_u x ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URPƉ׉‰ 9иr E8t8"uo;sC| C 9s} "WV Y^u  볋K(PUE Z@tE}G _C G1e[^_]UWSËtP~ X1e[_]UWVSÉUMU1}E;E t[ztMUj8j^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1@}u -E@} uE@ } u"PR.T [^uPRT ZYu덅LPhi"E 0H tu 112L 17 uu2_tHh$HPH,ZYu Dž,#%E@0tj/S Y_0t @0`1DžTXDž\@PTP,S9ǃu.@xuP0 kTtHu@xPS*YZHu.fDžtt0u_S~XDž,uTtt,1҃0u$SCZDž,T(j DP0l,D (t8t,v ,v"SX%Dž,(SX(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(PM_,fCNj ֋$B$@tP ^(S~\ S LEHVUE [@2Ex0$,S ZYu,Sh%he#jȹ @PV[ V uh%hY#j蚹 SEpE0}O uSBx h%hY#jk S+x XE}G }xG }G1e[^_]UWVSu]}t WZv Wk Yur #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAuv }uE$EXExtHu E؋Exu[}t1}t.EWJ}ue[^_]UWVSQu}uEX$Cu S{0u3PE 0L YZun?-uGPRUGYZUu{(WR2YZuA{ Cu CuHPE 0fL YZtPE 0KL YZu^`CwH$t%P_ -w7v w7 XZ1u(7# _uCPh6e#j\ ȋK 11PE 2Z@tEF EFC4FCF1 Ue[^_]Ujj$ZYt$%U PUPUP UPUPUjjZYt%U PUPUP UPUWVSu] FtVuVVPX1;}t$jRXt0TQ1҉FNG1 VuVVPXFue[^_]UVSuj(jY[t2%EC1҉SCCuu SB @u SJX1C؍e[^]UVSj,jY[tDÉ%E CEC1҉S$C$C(uuuMU @u SX1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79rGM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EVNr EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u j-Zt$pSuCCC]e[^]e[^]UWVShNe#ujG hUe#u[G tÅu'j`h%h\e#a VU SU Y[@8Fthbe#^F1󫍅Nv󤍝tJvr󤀽uCU9 t he#j1 |t uhe#jP jS PhJiu @t1 he#]Xe[^_]Uh,he#jXZUWVS, = 0 ƅƅF1RhKiu3 @PXujP^ Y_VjWhQRP qpujP XZpVjRhVpQP h#%W$,h#%RZY,|j#tRVRSPh f#e[^_]UjhIiup @u h$f#ji 1US]D,9t@tu<0@5<0 X ujjSs<0 u D,D,]UWVS ]UUEt ;0uKL-f|JxuEuE} tˆUPu ZYUtC}t:=P-‰EHffUtSUBf<fuh@f#E9r^hsf# E9rhWf#X1_EtE L-WtU0 L-fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uSL-f|PxtN=P-119} fLOu0t ,@t@ޅtt SVhf#SPh!} %h#nY19};Ph1("XGXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s;1LuÍKكt :M؍AMPEZtfP׋Me[^_]UWVSQUU} uj[UuhU#RZu hV#j, jPV u} ]e[^_]UWl$1E|Ru ul}UWVS,E u:[u hp%hV#j6Y@uhp%hU#j耫 P(Z@u hp%hf#ݍF1jR s^_C xyDž@Rhi @uhp%hf#WZYq:u]S 0PjjhVPR u+t"k%tf#VPhC"m -Xe[^_]UWVSu FPZup8+u1h%j \`%1juSft \vSh iRy @u81t8/thf#KVXpe[^_]UEU = 0uRP*ZYE Ef#fUVS] t4sVuZYtC P;UuPVZYft1e[^]Uh,hf#bXZUWVSSÉ։M1S>_u}uJhf#jx jh'g#P uWP-DPtVh:iSf @؍e[^_]UVS]u1ɉh@uh%h g#j0 EPh,g#S u)EfEVh9iSƒ 1Bu h4g#j e[^]UVS ]u1ɉ@uh%hU#j譧 EPh^g#SY t,juV E؀8t-EPh,g#S u)EfEVh9iS=ƒ 1Bu h4g#j2 e[^]UUE9@t-EMfuu @g#tURPhGg# ËPt<ng#Pt2sg#Pg#Ptyg#Pt !øg#ËtI'sg#t?g#t2ng#g#tyg#t !øg#UWVSljӉʋuFEE9s]19tc  ^w@v|USh#WK 1UvAE9s:2UFPh1(")ȉMPWM UuRW: u9utD7...}e[^_]C1e[^_]UVS ]uVhiS @u hg#jP EPhg#S uhx|$hx%hhg#qE߉EVhiS uEhg#QXE1e[^]UWVS$]uӹ!1j EPh8$S?uhT%hh#j{ EVhiS @u hh#j腤 1e[^_]UVS ]EPh&h#S uhx|$h@%hhg#uVhiS @uhg#E؉EVhiS @u hg#j 1e[^]UWVSxhSh:m#u@uh4%h5h#j董 DžDžDžDžDžShHh#_Zu?Dž1ɉDžDžDžDžjShPh#s u ؉8 P-DytRx:uL҃0jWVh$Pt;9u8tMhYh#jM jRVjPdƒu;t 1҉Ŕ@|Phi8uƒ 1Bu hyh#j e[^_]UVS0]juVh(m#Sо@u h(%hh#V Zu Vhh#j蔡 Uf@fEލEPhiS4 @u hh#j葡 1e[^]Uh,hh#[XZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Phoi#j荠 hi#[P\P <fDžLVhiS @t%fNthi#= 0t hi#rXfDžLVhiS @t%fNthi#= 0t hi#2XfDžL VhiS @t0Nf=) Phi#_X= 0t hi#YfDžLIVhiS9 @t0Nf=) Phi#XZ= 0t hi#X1|󫍅|Phi8S @t}u(j $PhiS@)_hi#<EEEEĉEEEԉEEEEE|Phi8S^@uh@/#Xr}uMu u uuBEH~HEP-DJtx:t~&jPhHh#ߑ uWhi#^_EyhHh#hY111Pt՘hXZGj,[DYyhHh#%Xhi#Y4t8hi#XZ hc"Xj _PhiS= @PhiS! @jh %PK u ftePhj#}[^Vf"fPw Phj#H ft Ph"j#-ZYj EXe[^_]U81EE1҉UUUUUUUUEPhi8uF @u hyh#j補 1UWU1Rhiu @u hh#jj 1}UVS]EPh/m#S衿 uhx|$h%hNhg#yuVhiS @u h+j#j 1e[^]UWVSÉUPh]# SǸ) 6 9|j<)X$j<))_ j-[/UEPh1("EZYUJt)Dj>Xe[^_]UWVSƍt1fDžfDžRhiV y hk#jК h' 1p)֍H(@!P }_9p}p' Džp hk#h$h"k#h&k#hj#hh#hk#pph+k#(G(\G!PO(!W Y`0t `0Ea0tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P h`0Sld`VPPpphTk#G"`G!\ƃ0`*w/wNtA2FltU0W= 0FQSPhk#hk#Ql= 0=Dj#=j#= 0$YdPh]#XZiQ"d9 ʃl5"yg#lRPhF"rC$빀= 0FPFPFPhk#hk#<F1d^1ɉll9d&j>$[S= 0FFPhk#WKStRTRPhk#RPhk# l대= 0FPhk#XZlF=Ptlbhk#h]#IY[= 0FPhk#+FPhk#^ fdV\Lj#t5X\PQh$\K z!XdˉX\lT\lhj#XtWlQj#Pt^j#Ptng#Pt!PQh$<lX z!렊dزT<\t=PuEFu:hk#h]#XZ= 0%FPFPhk# t#= 0l=l#hk#h]#}Y[= 0FPhl#_XZ1D dD ҃L ll\5"ltmj#dRP\Q4%hl#CuhBl#h]#ؿ[X= 0FPhk#躿FPhk#觿^V l\lLj#Xt5dlPQh$^lK z!dNjXfld\ Td\hj#tR\Qj#t^j#tng#t!PQh$ƾ\K z!lXkT؃dPhk#|ZYkl= 0.N= 0'$%rj#}j#tsj#ti[j#`j#Yj#Rj#Kj#Dj#=j#6j#/j#(j#!j#j#j# {j#j#F)`j 谼)hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEhGl#=XE1e[^_]UPEPhRl#u譯 uhx|$h`%hhg#ME\UPEPhi#ue uhx|$hl%hhg#MEUVSjjj"g y h[l#=\1ɺxBhPSp y hul#<ZuufiuSq Xe[^]UpPhiu< ulhl#f<Xl$Eu hl#jM EE1UPEPhi#um uhx|$h%hAhg#MIE@u hl#j 1UPEPh($u uhx|$h%h4hg#&M E@u hl#j趎 11 ,USE UUXt=EEEE1҃UjURP7 뺋]UE Pujrf US]S6PhPm#j/F S0P0~ UuUE PujjE UE Puj Ã=0tMUEE EjjEPEPjEP_ƒEBuham#XÃUSPIp jh%=n jSn uShm#6jPnZ@uShm#j]UWVSd@u~Q1}=0tC&;Et7EE jEPjjjV虫@uuShm#O 1ۉ]]]]]E}W]SjPVSjG`Ãjhm#ٽZYum#n#1uuuujEPjk E!1}jhn#h": EPhQ$$ hQ$$hjn#jC j\u6hn#r[jjj / jWjjVjv_1ɉ ,jEPj. u8tihn#Z+U9uU,Rh o#jWjjVj q Ѓu,t$hn#BjS$l = ,k = ,tjWjjVj ,SӃ  LEEEEEPj Xe[^_]UVS]E pt&I>v ![^]USQjj]Sjjh ,th D"u0Zu h !j jjSPjh ,Ĩu‹E0]USaPho#h,蓸h,ho#ACShp#h,t j(UE E ]]UWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9tD%(  9\$ t,% %11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9tD%/ $ 9L$t,% %11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]D% $09tu,% E%11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9tD% $9L$t,% %11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]D% $9tu,% E%11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]D% $9tu,% E%11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]D% $9tu,% E%11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$tD%9T$,%uwy|$y|$L$ ˋL$ ˉ$4$19tD%9L$tq#$9T$tq# %11 [^_]Uh"u jjh@,u赫1҅tPUWVS jEPd Eu_X1E9}2uSP蒼ZYt!SPZY tG1EEe[^_]UVSQË0tRVh r#EP4yV蔞ERvZe[^]UWVSQ1:nuzouPvX1҉Uh$Pq ZYt98nuxouSPrZYu}SP`ZYuE1VEe[^_]U[PPPh&r#h,}j4UWVSÉϋu ,PQ ZYu Whr#1}uHt*hO!VyZY41y!Uu1u4h͢$,P踺^_u)!~u M }jPb ZYt1ih#Vjhr#W脹 uU jZP,PK t% 9|\ 뭋QRS  u0 0u1Bhr#Wj Vhr#ͭEt!a"Et"Ety!Et60$%u0P,P ZY@tjj@{t^_,t#jhr#S  uhr#VY[0>!tShr#Sh#hV苫0 ,Dž@h$,PXZ9 PWsXZڄtVB L<-u.1j=VKY^t$S@ #S4Q ,t1ɉL=0t>}uhr#蜫_17=0u卅$P Y@uNhd",XA=0u}t2ҋ4h~$MGXZ9j `X=0t=-St t6htA"+X t XP=0tj}t0$Y` jR` j(ő @u hr#K+_,,W3h$h,R.P,Rg| 詽8tV,Rh #* ;u8uWVWh s#*j肴 t &[PY}u, Ex]([_ jj ձ WS$"^ ~)t}u2hX,,P6XZj P$] ~j,Pu @uh")X,Ѓu ƀt&qttPPVhoE"覿H}0 00SV^ Y_@uVh s#i)XZ e[^_]UWVSj Ph+s#X;11to%tZ%t =0t>%F#tf"QPh$ !ǃ 끍W"#tf"WPRh>s#蟧udtj#tf"PhSs#ouv t 0h]# h"DXZ=0KtSp+F=0u=0KtSp#tf"QRPhas#=0hf"h]#Ѧsds`sTsPhss#軦slshs\sXhs#襦0=0~chSjjhO!ju.t%j Swz^_tShs#9 h%? Y'?"t#Ph]#XZ 5"He[^_]US] 1t-tPu袱ZYu01=0]UWVSEt48nuxou 0P7PX1uh"%&X1Y,u@B uP_uh !%Sa[^ljxj,SXyZYt X1e[^_]UQPhu#h,軧jrUWVS]!11tE1҉p6p,111ɉplhv#u u蛊 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVSh|$藄 ,@uL蝲t!t"臲0Z!t!PSh!jr j舘UVS]u VS| YZu Sh`!jr ;/t"Shu!XZu E!e[^]he[^]UJPh`v#h,_jUWVS]E1ɉ#11d111lhhv#u uS HuLf$M,9tQG.C|g$&UC| C|C|C|5l6 CpZDžlL5l6CtXDžh.5l6CxX5l6Xjuh&5l6LYu h!jq PXX5l6 XDždC|p,P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPWY^@uRWh#j=p xPWYZ@tECp'xPWYZ@tǃluECpECtuE%CxdupVV荍@$XZK|ǃe[^_]UWVS SVdPhWu u hWdShUr$辀 ,@uSVh!jMo f@tKRPh<&hSBoShv#%0j虔USP]jEPSU :9uySu h!jn ]US]SYdZt@ h$"SZY]US]S*iZt@ h/$SsZY]USP]jEPSUU 9t :uy Sh!jm ]UVS]u VS YZu Sh`!jn ;/t"Shu!ðXZu E!e[^]鬰e[^]Uhw#jm UEh0w#hAw#h^w#hw#hw#Phw#h,{ j/UVSQÉj EPS} U:uVShx#j*m e[^]UWVSuEE@t"0 1VFe[^_]PC_u h"jm VP ZYuj蔒]e[^_]#UWVSQ]E10u1,hsx#u u~ 2F$&=H0tD0뷃=D0uH0c뛁K뒺al6C8K t L0hK\cPDl6jC@K@2K&gl6@Pn s4K Il6C(KK@KEPuh&5l6Sƃu h!jUk Et L0tctKtK@tK t=H0D0 s=D0tH0c@tKt1҉,,sc sKsC  sC sh$"V~Q@0Y_Eth$VfQC$KXZEth7x#VLQC KY_Eth=x#V2QC$KXZEthFx#VQC$` &1t<16 1Ƀ 1Ƀ 1ɅtuRh!jN 1ɋuЋ} t1Mw8"t$M tM9uM9t Suh!맋E9ƉU}7=|0tuuWVSuh9!{uuWVSuh9!?9u؋E}<=|0tuuWVSuhi!:uuWVSuhi!jN e[^_]g_UVST&=0tPh|#h,} h|#Ph|#h,|h,h!XZ=0 &ttsh"h,| jTs=|0u UPBsUWV=L,uHH׉=40t&ɉ HffJ=L,u f@ffB^_]UWVSƉ˃=0t/=x0t 1}mQd080PuP) Pסd0RPSu502 9t 70nPWVh*#xj"Ure[^_]ÅtUWRPY_}Ã=x0UWVSSƉˋ d0=0tSu 80Q( S׉ș։ЉEMRPSu501 9t 膋0nPWVhP#-xj$qe[^_]Ã=x02W|$wUWVS#Å=0u0BB400 d0 ;h0l0ؙ=0;|*90_1)։ؙ50pؙQ Y&JtRz!9t !9t ҋ1҉ؙ=d0Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ 0A Id t150)X=40t050PPV 0xU thw#n {X0H xU t@\M؋]ȋM؃=40t050PP 0A Id t15000JH,1X9M؋}ruuh#u 0\E1ҍMQRPuu lj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuu K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK0500_\T0@xRPuum Ã=40tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋuS%ClRPuu Ã=40t]Su,XZ1Etttp Y_DpTtF u1E Y_Fu @ߋu%CP0H050EЋUpXe[^_]g_UWVSQEӃ=$01}=L,tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Sh#h,t ]W|$wUWVSLEUȋ 0A Id t150yY=40t050PP 0xU thw#1҉U؉U܃xhֆ#襸 _1E؉E0X`u؋}܉ tu}}zU tStX~KM< Ʌ0@8EU܋0J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh#h,>s Nt% tSt1\uWEah#Í Í ? # ShC#h,r 0$~?0EE1uԋEЋUEUClM 0EH00EHesE@E=L,nKdu؋} t1RPWV }WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV MQuuRP EыEȉEEeƉϋMUeuuRPx Eȋ}EЉEeЉƉϋRPWV }f E9C0u'=40050PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋0 09A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 0A Id t150$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1󫡀0=L,t@fxfDžAix/D ‰|fDž ,=L,t,0@40u 1ۉ,0@DJL!ȉ!؉ pZ4JdQyt@f fDžAh !C ‰P(,iKL04H8 0Hdx| t1Q[X0ؐؔt= Dž<e[^_]g_ÍL$qUWVSQAAA |AxAtjP;[^=0=x0h0d0u 1ɉ 80 \!jjjhjSjƃtjjjhjhj\u1SV]jjjhjSj2ƃ$uuhP(XZ580uj h h[ã0^_t1ljhh[£0XYt@׉󫋅00L,u ǃ,5ǃ,HHăx(ƃ=$0tƃD,@,ujha#c^_0ujh#tcY[0\0B0 `0J4PtPh#?c_XZ0@4PtPh#c9^_0@4d09}RPh#b 0@0=hPh>#b 0@0=~hPhi#b 0B0R49}RPh#nb X00s0;\0|Pu 9\\=H0ș9|{XCX=p0~ Qhψ#bY[0PX~~$X0ډPHp4ډPLS8<V@D1҃~BPP1Ƀ~AHTP81Ƀ~AH`~$ؙPSVh#Waw0C4=d01ɺtA t@9uKdh0l0 t8<=L, Ph(#j4 9sRPhF#` 0ǁ\Tǁ 1A0QtAx1AA8A$1A@AD<A4=d0A|ǁǁ1҉XǁLǁP-ǃ\Tǃ1C0StCx50~4F8H GډSWRPk ӋRPSQI ȉN8ؙ)ˉ^ <~Ntn0؋ËቅkF0 HËË048<k9}VRPhz#[^{ L00@x<8@)׋@8tD11UP0ӉʋKT t1҉ u1RPWV>  uDž1WVd 9؉s(WV ȋƉϹ19s11ۉB,$1~ ȋʃƉ׋˃1ɉ1׉11ۃ~hH` tσ1 1Ӌ@0)H11ҋ)׉ߋ1RPWV  1Ɖ׋ȋʋRPWV 9sv Dž19s H11WVRP KRP ȃȻ)щWVRP F 041~ H`9))HRPSQ 1ɉ ؋Fȃ1~H`F9}Sh#'XG 0C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=L,(C|HL!ЉjjjhjC4Pj£0uj'O0H41󪡰0H000H4 ډ0)ʉ0@`#PL ~ PhH,P<H0PXD0P\T01҉PTX Hfǀƀ0%ƃC4D8<KC,ș)׋C)ȋ1)׉C8HK` tƉ׋Й)׉!lj!׉11ҋ!~ ) 1҃1)׉@D04=L,>C s(H1 0t ǃ^F=p0s0Kd t1RP߭ڍL0%VV$hÉ#R 0 ؙy8PۅI40%WW$q,h#R 0A0= @ 00=0u\Tu kУ0jjjhj50j£0u090uh8#$ j&K 01=x0Lh0l09|RPhS#Q h0l050 d0&[t?t  Lș)FOu뺸2=$0t?jj5(0S$=d0STb d0uPؙVpjV uؙ=d0VY00Xlj=40t PRXZ0x0\=p0~ hk#Y XDž=p0~ 0A,XÉƉ׋ǁ\TtA!A1׋AId t1RPhK#jjnNff,ftRhht@PBH DžPu ftp0=x0tu1'1=01w,10;x, hX,|+ 01҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h#輔 (_01=00CU C )C50$~N`Cp=L,u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=$0uCh|{lN`Cd9sh#C %P[00P t+)lj1ɉ1xU u@\€ 0H xU u@\€ 0H ?xU u@`¡0@`0$~%0Bl50F0=L,~!{809rKd1VT~U uVT~U t PFXƋP1~FKd1111f30@8P!tx 0)D4)Љ09s?zU tR`ك 20B$C1ҋ9r)0H`艅 00BY89&zU tR`A`0$~%0Bl50F0=L,Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rN050$.Nh񉍸Flx1Dž1҉)D40;xsxU t@` 0@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹0B0;0u^=40t0s4PP 0@00Z4Jd150000H41[0Z0 } 0؋50=40t500P504 0X050ދvxx 0\t4Tum%Fl[%CPO붡00𙋝ڋÉƉ߁TtAЋ!A1׋AId t10Y\Tt=p0]s80){0ƉK`Cx1񉅰69s)9s0%Cl뀡009rߋ 0A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==x0j.BX܋ 0𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1$u5"WVRh#B9]=p0D0P,t,=x0t hC"BX1j AX1b~j AX=x0tjtx|m_u=0th #v5004=L,0FF4+=_w h%#jP 0X󥋅`1=40tR50蘾[^0=t0t ǃ\8 50x\d0RP SMY=40t00r4PP蔽 0X4HdLH t1500Z;0sE=40t0r4PP8 0@00Z4Jd150X50500@4P50eY[^_]aÃUWVSu]tV _uVh!j `1ɉPhd@u v1 tGRhedAu E8 @u!R8tuh!XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(hC$& ƹ ߋSh!VT4 CPhC!VF6 C Ph!V46 CPh!V%6 CPh'!V6 CC,$C,Ph:!V5 C0PhO!V5 tP X}!uhzd@u 6 @RhedAu 6 @uuh^!j 41}󫍅Puk^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*P$j PEP71e[^_]UWVS4}jhPjWDtGjPjVWVn u$U ʋMQ؍e[^_]UVS]u VS` YZu Sh`!jW ;/t"Shu!SXZu E!e[^]Se[^]ÅtUWRPY_}UWVSuuuuB É֋EU)jj`RPH Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8C1ɉ %1\,hX,3h,)%1 &1'XZe[^_]W|$wUWSøth&2h#MXZ5X&1h+#;5P&1hD#+H(2t PhZ#_XX&1t?P&19} hk#[()H0%MMEuQQ$h# j P&1Z1<(2H(2EE(&1ۃH~- &1]PP$9 l0%RR$S0&1QQ$SEWW$S h,PP$Sh#<<(2%1%1!]%1%1Ezu0%ٞzu0%=P&1\$=X&1$hٓ#e[_]g_1Ujj}XZ1=P&1P U=`,u =P&1ujhZu4X&1ZY9`&1~`&1<(2ueUSá%1%1xFأ%1%1%10%w0%r\,y1]Y]W|$wUWVS&1X&1ff'1T&1&1=&19=&1u ; &1&1f'1f&1]f&11Ej]Sjj5((2K yh#[jh'2jjh&15((2 y<(2t h/#n_EjSjj5((2 y hL#jn h&1jo [^&1T&1f'1<(2 s$ &1ɡ&1ȉ '1'1s'1 &1'2}f&1Bf&1&14fpjh(2jVP5,(2 Ã9t:y hh#hYSVh&2ho#T&h,%Z1`,X&1% X&1 `(2X&1@X&1%1 &1%1%1 %1u%1 &1 &1 &1%1Av.}fE fEm]mE%1%10%58&1=<&1 %1%1%1@&1U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}%1 %1%1 &1%1H0%؉ %1%1 %1%1E%1%1=ɚ;~ %1%1-ʚ;%1H&1rW 8&1<&1 %1%1 %1%1@&1%1%1=ɚ;~ %1%1-ʚ;%1<(2t ;<(2te[^_]g_UWVS<ÉUM<(2tUUEčs}uyMăA}9}fE؍t E;T&1uJ1&1&1u5}t4<(2u+JEPuh#v  Ѝe[^_]W|$wUWVSEU܉M7C]<(2MQURuh# t h# XWh# <(2Y_t,%E l0%RR$PhȔ# =(2t"uC,e[^_]g_d%e[^_]g_US%=d02u5"_SPh[#h,jUWVSƉPl ¡32_tEtPh#E 329U|} Vh#j tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ 321҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPs9 PVh# S\/ PVh*#? BhPSjSPVh8# S^PCPVhG#hX,vXe[^]Ãt"¸o#7tU#tURZøb#USљRPQhShX,S ] `,yUhX,j XZáX,PX, UWVSDuhX,e[^_]ÉÉh#% &aXE1ɿ!t0\Љt }uCEtHP1DA u1tЅ}t2}uKU1ˉj.h32EPjER:U1ˉu7 VPh]#j.h32h32h~$XZT532VPh~$G 0=32UWVS @<tPh#Y[C&tRh !Ph#^_Phğ#XZCH<$ &h5"C Ph͟#ZC& Scssh#,C! &<t`&<t|&COS C #CPh#CZYPfwk$&h#h#X1Zh#h)#h7#h!_3h<#^!hD#{Y Ph&#hXZ뢍A9shK#cL EԍsfCfhw:ffEPEPEPEPEPEPhX#jfEPEPEPEPEPEPEPEPEPEPEPEPEPEPh{# Y[V YVYVAZqP}Wp @0u V@ Y{ȋMUPCUe[^_]SEEPV> [Zt?EXS,- YuWEEPV= [Zt#}uσ=32t$V Z@u6'V XuX }u MU1#% 32U1EDe[^_]US,tuPZYtC]UPu*fxu#@Ph"#hh62<62 Htu DP# Pr! ZU}uE ҃' h*#hգ#RRh$PPh0# UEt#t#Y#c#tPhi#F#P#Rh-"XZUVS$ &E׉Íu 9stMtJ@Sh#XZe[^]UVSUIh$tYE uLjjEP>à uU1j.0eY^ƅth52@PYZuUuRg* ZhPh62k62e[^]UUE Pjjhh62PR2 thh0$h62\ 62UVSE UMYt @ȅu˅t6t1R )˅t8u3jS@ZYt%uIh$hPh62 VSh#hh62mVPRh#hh62DσVQPRh#hh62nVSQPRh#hh62M 62e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uhIh$h62 [^vth# YEPjjhVPPQ t h0$V XZSVh$hh62p62e[^_]UVSMQ42Q42يۊ&BZ&XÃ@.)օ~=42uC42[^]UWVS uE Eԃ=4,tL1ɉ 4,hh52)[_u(j.h52-_Zth@Ph52[ 52uhhIh$h625 F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP5 [^uԍEPmZY6e[^_]VPFPh#hh6262e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPh#hh62h62]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV. _XUЅҋEtuu SVZY SPV }yE E]#e[^_]"tEEԉE E:"e[^_]EEԉEE E!e[^_]UWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]SFyh.#)Euh#{: Xe[^_]PXu jj jjVWjSyhɦ#݋EEh#.: XE9^CU!‹M9A}tSyM9,sxEt  Cy;8,t8,PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h"h"h#`,H`,$yhX,j RXZX,PX, }e[^_]UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һ#~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(US<Ph#h,Sh.#h,ShO#h,$Sh]#h,Sh|#h,Sh#h,$Sh#h,Sh˧#h,ySh#h,i$jUVSƃ=72u !3 3t!m#tVWjVjjhRSySiX X3e[^_]U帥!}uc"]U}u ǖhį#hͯ#hد#503~1X3UWVSE]uu1҅‰uTpuCE xh!WݼZYu u0Hhc"WZYu1t/c"* u븥!PVh#503e[^_]Uh#h3u uIX3U}u͕X3=3t03E E#]6W ]Uh.#h3u uX3UVSE] u1=33u{!yt Ksh!V豻ZYtBhc"V蠻ZYu 134V۾^sh=#503 맣33노c"Ph^#503 =3t53ht#503 503h#)V 3Y[t1҉,3X3e[^]Uh#h3u uX3Uh#h3u uX3Uh#h,3u uX3=,3t13Uh#h3u uMX3UVSE] t~ Ɠ1=x3x3u=sh!VZYux3hc"VZYu1x39s>l2^hsh`;2t3`;2x3 A l2t3c"8u"QPRh#503x3X3e[^]át3t8u503h˰#VT 1x3ZYƋ l2!Uh%#h3u uX3Uh.#h\3u uX3UVSE] u Nuosh!V诸ZYu3 u2_hc"V臸ZYu1ɉ 3 u2HV軻Zy$shJ#503 1=33 u2t ! 1c" u2PQhd#503a1=3X3e[^]UEu\X3Huh~#E PEP tЋE ph#{aYZu9=X3uJ=3t503h#R XZE ph#=aZYu2212USUE X3u c2Pt ]鐐pYtePū Z@u Sh#,E@ض=2t"h2hұ#5031ɉ X3 503h#Q XZ]]N]UEt~X3=Huh#E PEPM tӋE ph#%`ZYu 2USSEu觏X3Huhp#E PEP tu2hlLjE[Xjh<20 XYE tE ;u1ɉ u2jju 蚯à uu=u2tڋtSh#S_[Zu 2E =u2u=3t331ҋtu23tuj(XZ1ɉ u2]UEu}X3}Ht}6h#E PEP追 uh"#E PEP褽 t}E ph*#v^ZYu!E ph2#_^ZYu 2UWVSUU] 3E=3t5331ҋE _¡u2t@u253ujΗZY1ۉu2EM9t EPVXe[^_]UWVS}u <jj耗fÉXZS}s CYujjPh"賥à uQ$$j/S= _ZڅtPhRW =3t6503SK 03HQPY^y Pj Y^ J }~j5H3h^"WS  jWS Sh#=X3j葶~P+ Z9uWjo[^WjcZYt1 h#=XX3e[^_]UWVSPEEu蛈X3%HhѲ#E PEP EwɋE phڲ#X^_t 503h#I Y[}h#o Zu ]E XSh#_XS1 t뙃}h#Ko Xu ]E X Sh#XS]1 t-U}u"E X Sh#WS+1 3/e[^_]UX3}tF=2t =2u#í=2u03E E#H h2h<#503ҽ1X3 UX3}t׆=2u#<=2u03E E#>H h2hR#503l1X3 UEuvX3{Huhg#E PEP tӋE ph#VYZu9=X3u<=3t503hv#G XZE ph#ZVZYu 2UEuمX3{Huhg#E PEP# tӋE phӳ#UYZu9=X3u<=3t503h#G XZE phҳ#UZYu 2UWVSu huS謳 9}1hE4S|F 9~hh$Sl| GSh]#?UY[Hu jNZ2e[^_]UEu资X3/Huhڳ#E PEP tu uh5"- UEuiX3/Huh#E PEP賳 tu uh # UEuX3[Ht}6hs"E PEP_ uh#E PEPD t}E pph#T USE3u螃X323Hu h #SYE ph+#SXZ3]USE3PvAX323Hu h9#xSYE phC#eSXZ3]USE3uX323Hu hP#SYE phU# SXZ3]UE} tu萂X3=3th]#RXU} t}uTX3Ã=3t jjXZj`Y=3t jjuXZj襯Ujjj蒯UWSREEuX3=uE Xhb#3i Xu]Sh#RSO1 e[_]UVSEu0Hu~LPh#jd]S$~!03fJftPSRS jh>2 USdjlyX=3t>LPh,#jd]Sž~!03fJftPSRS jh>2P UWVSƉӋ:j:WsYZuWhF#V豦 :W耠PәYZtj%WsYZtWhO#V{W薍C uf{P Huf{tCPh#VI h"V;XZe[^_]UWVS ERU赦ZEE0U;OwuCuRS8f uCEÊ u w)tu C;OvE1e[^_]UWVSË@t P蜌1s_stVY1Ct Ps1CZe[^_]UWVSljӋu3u<MP^wEPMQSW螪jFw>yFE8 u@EuhZ#莴 XZ,HEHwuE1e[^_]Å8UWVSH%Pt=P-ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u hs#jhp ljjh#Pc uW1ɉK fCPjh#Wc uWC fCjh#Wc u WC _t36v CvCF C FfC (Wuh#谲 Ef: j/RUo^ZEUu R蛜8)ЉUHQM!ƋMQURP { uEubCYj@VoZYt_{ u1҉2Mq@P2j:Epro t@PMAYE@E@tu[uvVj]RU+oYZEtH:UttWuVh#)PERVJMVu WuVh#tEx:u-u%p/Uj:VnYZUt>t3 3ׄtK3Gpj EPVѫ >tU:u PvWuVh# /fC*C tt5p2u5t2t5"VњCZ{u΢${ t͢$P豚CX1e[^_]USZKJy ;J| t Y RP%XZ]UWVSP1ۉDžfDž1jh#P` jP=#CZY@tt8tt8uVh##蚯 uDž8tj;PI| [_Åth4#PZYtCh<#SY_t>hD#S_ZuhL#* [gVShy#Dž DžsDžVÉj@PRl t1҉2@PYj:l^_@P輘[H8?u1;u11ۃ/j/S{ ZY9u$uHsjh͢$S‘ cu)uR31ۅ%pu'j3u911ۃ=3Džt*1;t%h#S5YZY11u @11ɉ>t+h#VX_Z1ɉ=2=3t jjvXZ=2BhPW{1 t1ɉ31҉3QPp33YZu u*!#Hu9z uWh# u Pj踾Pj艾Y_t ;1$j/S"i_Zu Jx;hh[ %R51ɉ 2Pj=2u/; =X3h,hǻ#! XZt>ut>uGt>t݃t3hSShh͢$SfWhVSZW$hh#SH1 tL531ɉ 3=`2t hh}# hhe#S Wj;53Fd2uj/Vv [ZtP1ɉ=`2t WjWjXZX3-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh>2 ZYu P=#Y[@S]^K<$7Zffu0t#;th#S舃ZYt h#3t$?t?u+u =d2uh.#聧 W衑Y,,d2t <,j/Pt _Zt@,P[Z PHYd2 t 8uthT#c1=3=333DžtDžx=`2t0 tRPqZYu33D3#,h*A"PA^_44u ,4Pחt$PhtY[u/tx3353=3 t14Pu1҉$WVPy,Ph#=3u=u2<u2-,Ph#503耑 33 03 u503j q [^RPh#QHhSh=2܈ 2=2p8-/@dj VPJ 9pd8/Pdx*u,j pPRۗ pd83 3Gh#H#d+tXH ׉dR(s^_Džh8HRTvYtxW#dtd軁2a#dt]s#dtht#V Xr#d`ujh#0 ^_p@9#d't#dƅu #dutP1nYVZt<oZu&J3 3h#I _t 8uh##ڡ8>2P8>2~ hN# ^}31uQu2P7ZYu SMlXh#Δ XtSхtXS.lXOtSlXt l_t k[uRh#DžDžDžDžDžDž 9d2u h"PZYu Dž8X,\ 8|uQjj VY[ h!@P ^_88u @Ph#Dž08633 !At9Nj}3uNuE3 3!F9=3X503h# XZAu t=3=39u 9t Ph#藒  hZC" h!P~^_88u Ph7#Dž0 $hjU_Zh"jTY[<2t9u2tK<2tPqi^u2tЁ~=}<2P{[<21ɉ 3 $33@tPjWTXZDžjT_4P5<25<2 u h"#Ս10jP5<2Z ƃ <29u hD#蜍8"ty-莍"<2R)PhW# ( u @;t+h"躅Y[t$hi#At@ uƅ=2u 2șu<21jPXZ؉|tL𙋍|9Ή| ||=3S|19=<2|19lj||Nj4PWj5<29ǃ1 3$3|)ډ|8<2@DžftS+ uQ菋tڃ#tՋ9 PhW" [^4Pj_h)u뮃=,3039 3$3|#3R"TYU)Y=2tYjPg XZ++y @B19|@B)R"X맋VN1u%Y4P5<25<2J ujP$#h"5<2t^_th#J ft=3u 4P~[t`h# =,3u׋ 3$319}ċ0339|03 \뛸#PjO8$RY0= $xu tjS XZtx1ɉ08R18 $PX _Z@u*tPg$'g$h#503x 1; 3$3|3 3y )jEHX33 3$39؉|1= 3=$31@u @u"PjNNY[㋅Pj 2=2u 2EU 1oEd2t%h"Sw}ZYt;|tS_1ɉ d2[E~E@EE@E\=3uE]ËE@tjj褺XZUWVS$} j hw#uVkuE1ɉMMuqÉEPxDj>=X3t ujOY|[2@!ȅ!Ѓ„tt jZx[2!ȅ!Ѓ„tt jXF(#e[^_]UVSu=[2uh#Kz X3[11ۉ|[2h@j<ÍE PV5[2$5[2h" 5[2?u2 h]#Vn^ZPƋ|[2Y!ȅ„t tjYSjk<XZe[^]UWVSDžXP3V2V2jjV2P [2 yh#7  u2tjXRjhPE V2<t <=2=253=3u 3h#WÉ53_~It,=3t#X3-wQ503h #V Y[=h[2h"503d =3X3-v+2hG#Z=3=2=253=3u 3h#xÉ53_~It,=3t#X3-wM503h #w [^9h[2h"503c =3X3-vtP2h#Y=3u9 =L3t 5[2P503hL#y# #uh#Sl_ZX3$ w=t503h #,V2<t <flpRPdPRRRP`P\PhX#h W2:g , \`dtk=V2X3$ lpRPRRRPha#h W2f #V21fV2 Ћ Ћ ȣV2lp ffV29V2YlpRPdPPPPPPPPPPPPPPPPS`P\Ph4#h W2e \t-503h#l 5[2x [2 \u`u dt 503hc#붺V21fV2V2@ulp ffV2jhV2hV2 503h#F503hs#6h#Sh[^^1ɉlX3-w 503h #ERpRRRPh#h W2=d t503h#$ XZ:u:u:u˿V2V2󥋅pffV2jV2PhV25[2YXy/[2=L3wP X[21P3>=V2%hV2j5[2&[_Zy h# ^V2=3<<V2<V2PV2PV2PV2PV2PV2PhM#Ã=3^=3Q1҉3V2V2=3t fV2[2tP _jjV2P[2 y"h# ^ 3=3u#jXRjhP= @uh#$V2PhV25[27 y%h# Y5[2 [2x u2tjXPjh5[2{= DžhV21󫍅hPR5[2 @h#x=2,2=2 2t$=2=2\tV2<u1ɉj j WhStPtPD 53=3u 3WS\h=#aÉ53~5t=3t27h[2h"503[ =3u Iu<t=3V2PV2PjV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2Pjjhd#HÃX1st 3<uBDžXjXPjj5[2; 5[2@ [2X1=&503h#e[^_]UWVSD}[2=P3tWPHjjP~ ƃ HPj5[2_ @-[2EfEjEP M]ġ3ZZ<ډEUjEP M+M̋EZ[+Ey@Biy1QjEPV i8ti8#th#V2EEPEP5[2 à ty5[2 [2VjSm @t?}uEjEPjjSZ9 W5[2`LY[Quh#l X5[2} [2Z1(i8\ i8#Nh#^ 뽍e[^_]UWVSu1ɉ |[2h j/E[_t=3u@B2K2=3WK2@B253332thPBUPO UBC2 V2V2 󥍺V2V2󥡌[2<<[2[2@@[22DD22HH2u2LLu2p3PPp3l3TTl3h3XXh3d3\\d3jh43`UPNNj`Ph43;Njh 3U썂qP%N$jqPh 3N`3U쉂`3hh 3PMhPh 3M$hh 2UˆRMhÈSh 2Muj,|[2 t1|[2EEe[^_]e[^_]UWVSQ}j/Wi6 [^t#9u jh͢$jW)XXZ/jh-$XY^y Wh #G nhWh@>2LA>2ƀ@>2. d1.F9t@BUUjh@>2WXZx9U0t8u-Ou503h# XZ10jh@>2WYXy@>2F<.u1F@F0볍e[^_]UWVSu[2u/hB#wh X=$[2t X31Ee[^_]<fDžƅfPftjjWPt hd# Xhh}#5[2T5[2- [2Ã(t hd# X=$[2t X3jZ<Xt(t#fVfthWPQ jYu=X3(ujtZjlXe[^_]US E1ۉ]hh#uI\ZYt Eh##=l3t#E2u=2t=2ۃ92u%hG#kYt!503h# PjSxXZjOX=3u)503h#\ [Xj,XX3 92uh W2h#ZYt}jSWx[Xjh@[2貼 ZY!h$j(Y[E33 uuuh($ Hu.RPh# tԋEPj(XZjxXbj $_XE@E33 uuEu Ph($# Huv [2j1$1$vE$j"(XZjY1ۉ [2uu h#503CQRPh# sjhV2{ Y[hj'XZ1ɉ [2hh#uY[Z¡3tt =u2tSjtjUXEt1=3P9X=u2t(MEu Ph($ Hu\j[뼋Eu(Eu Ph($ Hu/=u2tjY1=3PZ=u2tCjX=u2tqj]g 1ҡ[2~j1$X=3u06u=$[2tX3 h# XjD8Xj9Yj1[=$[2t X3EPj3&XZ]UWVS1X`3pt3U!1\ 3$333,3H=3t}u=3tTuu u E 8-u}tuh#503N u h#503N ʡ292u:1ɉdDžhDžlDžL!jhV2Ǹ [^u#jPLtXZ뺃=u2 j9Xhj$XZhj$Y[hh"u W^_uDžT,1,3E 8|u]jj $Y[lE Xh*A"S| ^_TTuSh# XZi1=,3Dždh*A"u M[^TTu u h7#Džd $Tfzt T@xRPb/ZYxE%=tu h$#503M EЋUԣ33?jhV28 ^_o53=3 h#uUZYth#uUZY2twCTfxu TjWVPݗ T@jWVPNByu h# Y[X5353h# 6DžLm#}tEuuh($a H 2LZ\\uOuh]#^_뽡tU2t9u2tKpU2tP6Yu2tЁ~=}tU2PHZpU2j)"_l@ujj !Y^l=3t=,3t =3y 31ۡ28\fxt \PTfyt T@S525tU2 pU2F uu h1"c XZZ8  3$3P ta\`RPP)G @\@ @ 3$3TXRPFPY^@uzt[pt95 3$3|@03#.503f#_pt3pt륋\`RPj mF @uu!P\@ @u 3$3pt 039 3$3|03 T@ @t,ʸ#slYXu h1" XZ\@ @t"DY`Ih;# XGjXdtdTR^1T\P?1ɉ\ $Z[zhPjXZDžh=u2u X3c[2xP X[2\t\P>^1\j[X31; 3$3}jYh@u l@u"hPj\XZ㋅lPj J^_[2xPV [[2du \u)TtꋅdTRY؋\P=XH,31҉33 3$3e[^_]UWVS1,4(03PT3G#1= 3=$3L33,3 \3hh#uOZYDDu =3uVu=3t}t}u&E 8-u}tuh#503#F 뺋E Ph#503 F ɋDtE uPu 1ۉ8Dž<Dž@1=T3uDHjhV2 ZYt=u2tzjXhj/Y[hj!^_<}tWE jPG[^E j/P& ZYU8tNU8 tDE Ph # [^X3. E h"PM_ZE 8|uuU ͢$t,-$%E 9u jh͢$E jPOG^_/ jP@GY[n=l3t U8 uW@T8 u"E hP _ZyE PhN#6=l3t 뽃=l3tE P}YE D2uJugtWjjiXZ29u(ju/^_33X3=ujPiY[@ujhV2 $_ZbDu}u-k33 tRPh# ͋E8t8Puh($ Heh*A"^00uuh]#Y[ȃ}E h"PK_ZuDž(X,15,35\3E 8|uXjj v_Z@E h!@Pa Y[((u E @Ph#A15,35\3Dž8=E uPBY[((uE Ph7#. XZDž8 $(fzt (@xRP@$^_@tE%=t1ۉ,3\3lU2t9u2tKhU2tP&-Yu2tЁ~=}lU2PD?ZhU2j|X=3t=,3t =3y3$1$2Dt@33 t/(f{t (IjRPQ752lU2 hU2(fxt (P0ft 0@$VSW u0Q8 u 3$3h_#T ^ڃD3 3 (jjjP豋 11y4E Ph# Y[1,RP<[Zt׃ t;533(|jjjPI 떃  3$3$ 3$304RP<XZ tl(,RPj Y< @tz(@ @unz04RP;^_tA UL@L Hu (,RPS; @uq$u{PT9ȉ03#503WYPT3ډPT 3$3띃 3$3PT 0395 3$3|03 0@ @tJʸ#N4rN8 u 3$3 h_#費 Y݋(@ @t9N,E PhW"舻 XZjX8t8(R^1(0P31ɉ0 $T[Lu 3$3y3`LPht#503 = 503h# XZ뾋D$ u=\3uj6 _苅8= $ju)[^X\Bu@j`S ^_X\lp1tE SP ZY@XP5+$L+‹E $Ph#503<<`jhV2菦 ZYt$X31; 3$3}4jX Y*hj^_=u20P+[벋<@u @@u"h#W=ZYEt ue[^_]o2ø"=3t#Ph#503u4 ,t$=3t~ tPg2PS92 SQ%YE ]e[^_]8 QMZƒMuQWhL#5033KSu QWhh#ދ}u#Uj PMQv+MMEPjUR rPj h#5033릍e[^_]UVS@2 u2d3$t!uItJuBd3H31d3P@2,8!, u @ ud3tJt d31&d3H3 tGtBB@"u\uXu@!@B؀"@tՈButB u2@2: u2@2d3tHt d31d31H3[^]US@2`2 u2@u21ɉ d3u21ۉX1u2{P5u2/XZtu2@ڋ]UVS 03=3t,SP芼 $^Z8tPhd#5031 503j jh@h`2h,\)y}uB503h#t.=3t 03Hy Pj 4Y[ J Rx=u2?u20ZÃu 503hk#+u 503h#x t =3u503h#葻 [^1ɉ 3j 3uVa(u20P5u2S =3t3{t-03HQPy;P| J Pj,3XZ{ qhjh#j e[^]UEt]1]US]u h#j SZu Sh#j @]U=,u  ,03fPftP Z9,ÍL$qUWVSQ@3 ,3 jP +|33_[+ 3y @BX0%ڽ߭ݕ 3$3=319}a؞v3߭ٽf f٭߽٭؉ʃ" u5"1"WPSQh#hPP*ٽf f݅٭۝٭Q~:Qֺ5"t"RPh#)PP)Ãօt Ph(")PP)Ã<RPh#)PP|)؉1ɋ9ϋ}'t' @Ńu4&%%y)Džkdd%1 P%1҉ RPh(#)PP&(8 3$319݅33t53=39H)߭߭ٽf f٭۝٭h<#)PP&à t!Wh(")VP&Ã<RPhD#)PP&Ë+p3t3Ɖ׃x39}19},hN#)PP@&à h?")PP&؃ u03fJftPVRd eY[^_]aUS]:1; 3$3}6=3t%03fPftjh?"P jX:]UWVEE왉U1E}ujEPj e^_]U0E E1EԉE؉E܉EEEPEPu1ƒ xEÍL$qUWVSQ@@u5jh|3 p3|333h3l3XZjPڻ 33 3$3+p3t3_Xx39}39=h3l3sBp3󥋵5h3=l31w~s9؋}gWPhZ#hS#03fJftPSR jjj-jh3 =,3uh jjujjj =,3l%_hA"P ; 3Y[tPh]#hP"x3319߭y\0%ݝ݅ H0%߭ٽf f٭۝٭y1d~dVh#)P=P"Nj(3~-3t P*Z)Å~:ùdh5")Sh&Ph#)P=P!ǃ119ʉst @u4&SQh#)P=PM!+|33+ 3y @BX0%ڽ߭ 3$319ظw ȉ߭x0%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4&%11d PVSh#)PPá339lj 3$3)ލ 9lj݅99Ћ}h#VQà +33߭߭ٽf f٭۝٭?~~h#rtPh("VQ7Ãh$VQ$à <ЙRPh#)PPÃuh?")PPà 03fPftSVP! eY[^_]aUS2j 2X]á3@ `t1US3HyPAYu1ZJ,ƒ uɍPv"u|33HyPZuJ"\u%3HyPZuJCC3uh#4 Y333HyPwZu ZJ, „t@Pv8\u"3HyP8Yu JCC3uq,=3th3P)ZYuC ߸ ]UWVSQƉUh3P[_tHj.V+[_1ۅt6uPZZYÅu#)Wh3V+ u1ۀ31ۉ؍e[^_]À=_2tUWVSh*A"h_23^_u"/8th_2h# Y[1$hSe_ZyƅEj.Sb[^pu Džp5"1btH uuzG uҋp2uSpEƅt1;4 3*%u_3uGE uh37} h3P'ZYtE thM#P&[_tB3fPfttRPZYx|?th,#1 hU#w$xAE85h3}X 3fPfttRP[_x"|?th,# 1 h#1 E8h3}z=3t53PYt u 3Hy t u503h#Jɋu2u503h#Xks2s2s23HyP@Zu@JP-DB@uGG9u uu2u3s2c2=3HyPYuJkPks2Bs2ks2s23HyPZuJ< u6u2ks29s2u@u2 {u@u2KZCh3h#:/ _X3@tR[503h## XZ53Y 503h#ۍe[^_]1US]P-uhI#S ZYu2DB@tCjh~#S> u 2UhN#S9 ZYu 28h<$S ZYu 2hZ#S ZYu 2]USZKJy ;J|< t Y RPZY]UWVS3=3u 3h#i^tIh_#h[2lZYƺ9¸} [2.uh[2Vhd#503jh#h[2 53tjhq#h[2 uSt 2 212j hs#h2 t\h2h5#503  Bt 1212t*j h#h[2 ! u503h#肣 ^_222222[2hL#Y1u<2u 1҉2@u21[23e[^_]U塈[2tPX1[2322=2u12[2122|2tP/Y1҉|2=3u1u2U[2j X=3t%03fPftjh?"P jh3 UVS]'0jX=3tf[2t-fPftjP 5[2 1[2 [2x jP 5[2 [2 13jrX=3t>[2t-fPftjP 5[2: 1[2 1ɉ 31|3jPZt Sh#j[ &0e[^]UWVS]3=u2t =3u$u 1ۉd3`3Pu7=d3uEd3d3Pd3@1ɉ d3=`3h52Va  /thh͢$V; hh#V(V\yVh#Z XZ1pP5 =3Xأ353,313,3} t1=3P襼X!EEt!jjRPPh?#ZC"ҡX3-cvt[2} t1=3P;X=353,3h*A"V`3Vu[ =`3uuh,#A( ^,#5`3hh`3( u5`3 1ۉ`3j h`3mZYu`3e[^_]UVSQQMq3=3u 3=2ut9503hL#g Phu#YZuBj h[2^Zuj UR@P& M te5P-DN@tVu=X3u=2u1ɉ 2t=3u503h[2ϝ 03 XZz3eY[^]UWVSQ4MY=3}=X3}=3u 3=2u}503h}#R fPh# ^_j h[2ZYtj.h[2^_th[2Y[2uKjh#Vr u7Vh#503f[220h[2h#503[2 1}VZtVh#503 EPh#V tEEP_uu 3u\]3gu=X3u=2u1ɉ 2t+=3u"503h[2 03 XZE3EX3eY[^_]Uuh&#j2h 3Թ u h@#j 3UWVSP}u jj3h"j%Whn#V ƒu&Wh#V ƒ uWh#V ƒ USjEe[^_]Uhh2$6 ZYu2UWVS253X3=3u 3hM"荩_uSj h[2[ZYtA8thUWS$]؍U1EEEEPSh#%u ƒ1uu Xe[_]UWVSu] }VuS u1N tuB#tP#fN lS ZHˀ; uLUJ9uD ,y h,Y,H , t@u҅tb#ff t1҉e[^_]UVSQuh`2, [á03?vPhy# j~uh#P(Cƃ`2 1҉UUR@)Ra2Ph,yh#uh#503ju219u2 U e[^]UWVSD]} Sj j VhRuW t&hh!Rj h!Vh2tzW9Vt vuvvS @uT8jjjhSvv thh!S \8Sh#贃 Y[4jjS0 ƃ u(PPhg#h# PjS @uPPh#fDž=3~"jPn 3XZuWSз @8$}u~8A^PPh;#‚ >jP +‹Y_+y@Biy1fDžRjPB uY8u=3~{8#tLVjS觶 ƒ 1BPPh!nu< tQDžPPhhSl @u1 e[^_]UVS]u SXu ]e[^] 3 UWVS]} KyCS,Xu?C u8@t48ufc 8#tt P0e[^_]UWVSu }EÃu3F u,@t(O8uff >8#tt 0[^_]US] h=#S YZ¸t,h#%Sz YZt;uEuh+#C XZ]US]SZu ShO#jH ]U u hv#j+ US] Su9 ZY@u Sh#j ]UEu h#j P趩Zu h#j UWVShuE ]E1҉UUUt PEXt SE_=2tIEt P1ɉM[hM#nEEZt P1EXh˸#PGE[_EPEPEPVy$X35c2 ZEUc203t\RVh#P1ɉMEPjP]Sh,}yh@"uh#503X31Vh#Pn Sj=x3tTRU%É4$|<$WURPWhYt#SWVSE(tPf_]uhڲ#}[^t^}u-h#z Yu]SES1XZuh#1ËuVv1 tts;}u-h# _u]SES61[^E8uh+#0 YPh#蹘ËuV1 EtPh#茘_Zuu|23^ux35u29~Lks2Ph#ZYu0h@hǾ#h`2LWu205u2jWC212Et P1EX]tS _1Et P1ɉM[]tSZ1EtPiXe[^_]UEuX3=3t%52h8#503 X3gHhl#E PEP6 EPw=x3tl2uE P t2U u#Jt3t8u hc#j6 RPQrZY=x3t"=3t5t3h#503 3j h$h222j h#h2q`2j h#h@2V 2$j hV!h282j hA%h22=3tjjE p UWVS0u=3uue[^_];]ȹ 1SjhV u}uVh# S 1E0ES XZEče[^_]UWVS,EPu EPg? Uȃ u"  ỦEЋE0ufEjEP褎 3EUXZ1ۃ=3~yjEP耎 E+E‹E__+Ey@Biy1RjEP u 8t~ 8#tun <_^ 1҉jEPV u B  y3 8E% 8#7ËU9} )‰UEuX؍e[^_]UE]UE@(]UPEx$tEjURjj0 1USju [Zxj0jZYu SԬ Y11҉P$]UVSPuEj0jZYt,0@$jjV/ jEPhhV) ؍e[^]US]t&S13U ssS1]UWVS(]=3~jEPu 3EU_XEE E̋C t 9EsẺEЋs})C C)E}1u)EEЃ}uW3菪 u=S 8E 8#7 C(- 8u5C}9{r:T}|D@^uC,8#uPXZYCEЉC{uMEЉC 1{UfE؃=3~;jEP6 E+E‹EY^+Ey@Biy1R1҉VjEPY u 58t+8#t!C(9à53PhZ#503q <C(<1EЍe[^_]UWVSQ} ]{uhCZC{({,CS 9Sts C)9G1s sSjjEPlu{(uS{,t{uEKSBCEC9Cu3pVsZYu C(1E&Cs} {s}MC Ee[^_]UWVSSu] }VuS u-~,tuB#tP#1ɉN(YSZHˀ; u9UJ9u1VjjEPXt} ut#1ɉN(t1҉e[^_]UE Pu{ j- UE Pu{ XZ=h3u h3UE Pu XZ=h3u h3UWVSSƉ׉ˉʁv )…tRUWVf tUu؍e[^_]W|$wUWVS|xˋ7GEGEhjE_u h#hNEYtU 1u]EEEĉu1EEEEE11E11҉UUU}u}tp}tj}u^Wuuc EE)PEW|葥 u h#\XI1ɅMEEU1EEEEu4}uh#8_XEE$&U:tJ1u9u}uh"#[^}h?#h3YEEUBUHEjjj诶E ]U tt hY#OBUHEU:t hs#+BUHExU2uBUHEXFE7U2BUHEU  BUHEujEu U:u$ Eu U:u BU"u u NEHEj8h#jEP;u dh#7TjEP<E_ZwV$$&Eȅtu}%)Nh#YEEZh#h#h#uh#+MȉXZu~+Mȉt] QtuusEtUx 9tth#'[}UM}uEPp\[EEE8v9U];t hE# EUu}ugw}u Eh5#U];t hh#EU}x1h# v EP[Yuu XZ}tuEUVEUe[^_]g_W|$wUWVS\EUMh2h&EZYtu h#U1D& }Ej8h#jjjj5,R艧 t(h#u>S8 1}}djjjpE 1uu11}u/ڋEw=EU]E}uKhuu y h-"qtvPEuuEMș׋EEM jEPZYdKM)ىMڋEt;M9u41MU]E}tJjEP蕐EZYvh#AhX$Fu S EEEPfYt%h#0uS PPPPEPEPEPEPh#hS ,ڋEthX$n_EUu$SXZ]EUSe[^_]g_UWVSEU܉M=,t h#0 Y1҉,jjjuzBu11@tGjEPu  uu h# th#X1M1SQM]uuh5#: E1EUM]Ή)׉u}u܋} ߃1 tL}xA19ʉ}u}u}1 tiE1-PhD#j]ST LLD.ShK#hX,E uh"x $e[^_]UWVSǍxPWF^Zyh![1E%1=uUЋ]ulSYlu h !2=l3t1hQ#TځvRhQlW- tht l)u)Ӄu hY#Z/w hj#hQ#pPSG VnXe[^_]UWVSÃ=p3jPڛ XZyShi!d[_PVZYtV~ Sh#0 %1=u ThSPP'ǡ ,9},)ǍW5,3ZYu5,W1 Y_t3 l3uSh#(jPV詚 t@uSh#tSh#ljjjV=t3u[=l3uThh P菚 ǃ uj~ jU XZuPhi![_g=l3t1ɍP3Sjj1ɉUV t h#YtWΚ Zt h#|Xt3u,u#u P._Sh#n[^jjW茙 ƃ u Wh#xPVZYtWh*#V3 9u9t2RPhO#V P.S .Vԙ DVə jPܘ ZY@uShi!c=t35,Sh$hR =v ,)A5,=t3u:hh RT ƃ uRh#h, Ix _=t3uVט Y@u h#ZS,Xe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL Muj RPu F 5'35'3h#j莱 ؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh3M t Džh3)ȋDPS4F hY[< u5'35'3h#Ph1hn))=w(SXZDžh3Phh3S 5'35'3h#1_1ss C1C1҃u\#u~nu '34(3@ fL03L0354(3_1+(3='3u8#uxnu '3M 1M I t(3'3t]Ut @uKf (3-t(31ɉ 8(3=L03;G L03'3t1BJM pЍe[^_]U(3@ t=<(3t/=@03t@HyPKYuԋJ5(3P4 XZ1UWVS|u=(3uQH038u==<(3t h#j (3,'3#'3X,'3! (3(3tQHyPZt@ J5(3PK4 5(3h(3h(3 ÃYB(3=,u 1~1P[=@,3tdh@,39h@,35'3ـ t $L&\039p03r\03kP5`03`03XZ=p03k 5`031031503{u5'3sL Y[ =l03uuu =03z 03t503CPj V@ u03H @))Ӊ03SPVo Ij503503h03;jjh?"h03j503503h03Fj503503h03\ jjh?"h03Aj503503h03) 5'3sK 03<03@='3X,uX=,u[h{Q"Zt8tPz ,X9TPhht@j蚶 uVft,,<=,u ,t 11<tR<@PPHt%tv$@P 1DžHP u?F;5,r5'3h$J ^_5'3j$ 5'3j 1.WYtKW2ǍZ;,r5'3h$6J ^X15'3Hj@訑tfW^YtZPhH &蛐_ZNj,'3t;,r5'3h$}I XZ1@HЉ0,Ph#5'3莾 ,B 90uH@)< F;5,r5'3h$I Y^5'3j$S 5'3j F '3@ @¸:tPP5'3hoE"j׎ '3 03u45'3503j503=03t5'3j XZjh03g^_1ɉ 03jjh?"h03rjh03,@=035'3503j503t=035'3j # XZ=03r03=03BHPj W= ƅt*034)0303H85'3503jWގ=03t5'3j Y_803403'3 03u45'3503j503z=03t5'3j - XZjŲ \039p03r\03kP5`039`03^_=p03k 5`03CFPYFG=p03%=03CH@u. d03t$P9Qs@'3R5'3Ph#jR 503j1ɉ@9^Z"1ɉ 03031҉HLC0tZT03uH 9Hu;Ptj0Wh03CP QT03pP @9u9t)HL1LH9L}jjQh03T03PHσ)HLL'Hj@$YZ"L HjHWh039Q tUAQ )HLLHj@YZ T03QNu9AuAQ 똋 03j)ȋ5T03PQh03~CP T03P @@DjH+@P@Ph038 t03󥸤0303030303t󥡜0303Cxt45'3503j503 =03t5'3j XZsF uq=03u~uhh Pgj F @t"503503Cph ;03t Cp jh?"Cph Ht1 h03=h031h03[=03h{uhh si C @t503503s,h ;03tsh]#j赈 jh?"sh Hփ=03ujjh5"h03o\03󥸤0303030303\=0303Hw{503=,t 1x0303039IFTu@1*jjTPkH<9Hs B@9u[0QPV5 0uՋ@9s3<jp$(Pht03.<jjVht03 )H*t03󥸤0303t0303t03t󥡄03t035'3h!5'3舵 $'3 03u45'3503j503複=03t5'3j W [^?Cv1s l03ue[^_]U塀3txt1҉P x{u@jjh5"h03US];] ttCtE8tsc1:"u#C@؍e[^]USP~zYt@Uv‹EBu Sh#jt ]UWVS Ek<`,Ex19~BURE@u9 2u19)VD PR`kE:32`3&3Ƀ5<3-aX؋]#]US]E U$ &1Ƀ=3i3 3 w34k3_h]$h3iYZ3t=3t h &Z(3 ##53[`X؋]Q]Uh襷31U1 13jO1U1 13jOc1UhhC#h3RE UhhX#h3+E Uhhm#h3E Uhhu#h3ݗE UE.tgzEEPjjp׺ UE.tgzEEPjjo贺 UE.tgzEEPjjf葺 UE 0^Ph}#jjcpUE.tgzEEPjjhg UE jUE jUE jԨUE j躨臮UoU ]U輬U ]U衫U ]UaU ]Uj7`U Uj!`U Uj `U U踾U ]U@3,P1RP(U@3,P@1RP(U@3,jh(U@3,jh@u(Ujjְ1Ujjư1Ujj趰1Ujj覰14,Uh#` Uh#{` 1Uh#j` U@1]UT3jo1U跱1]Uj.1UY21]U01]U,1]UVSu] hE#C Zwt @t2E0f~ufFsHPh$h"e[^]Ee[^]#UEU ttu(X33 3]]UEU ttu( 3 `3  3]X]UVSE 0ڸuhԸ#] h޸#] XZjShԸ# jSh޸# 1e[^]U:3=:3uhԸ#-] h޸##] XZ%jh:3hԸ#貛 jh:3h޸#衛 1U3&=3uhԸ#\ h޸#\ XZ%jh3hԸ#Q jh3h޸#@ 1U3=3uhԸ#k\ h޸#a\ XZ%jh3hԸ# jh3h޸#ߚ 1Uh]$h3vZYu;3dOhh;3h5"h$1Uh]$h3(ZYu3dhh3h5"h:$1Uh]$h}3ڢZYu3dhh3h5"h#1U5@3Zujj5@3 US] @3)thkj`XZ0ƀxj3Pjj35@3S1 ]UE ]UE ]UE 1҉]UE ]UWVS É։M}}} }PfуP19~Pfz fSC9uh#QuR %s5h$QuR$CuDSu0Kx9tF( Far h$R.rXZ}uC8t uVSu8Ps# C9uCEe[^_]45e[^_]UWVSÉU@҉׃}fEs*S_u }}tiP^UUj WhZYƃUt)JMPWE@PRUs$Ut >t~UCuBEs =})CuS փ9~Of{ufKf9|A)fKsfuu)K9M|9~fs)y1fssf9u|MS9~09},CPuAERuFYXMCu9}ys(unXZ1C9uf{th#uQs"Cujjs߂ uC}S)Ps0s7e[^_]UE ]UE 1҉P]UE @]UE @]UE ]UE 1҉]UE ]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @]"U1 13j'B1U1 13jB1U3 11]U`3 1]Uĕ31]U`31]Uh腩31U`31]UhT31U`3 ~1]Uĕ3c1]U3 H1]Uĕ3-1]U3 1]U`3 1]U3q1]U31]U 3 1]U`3 1]UX3ep1]UE uU]US] @3)thkjOXZ*ƀxj3Pjj35@3]UWVS ]u t/{u)P>vPK t6vWYC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>P|C ZtsPMs 1C s]si1CZY]UWVSP`,1AƉE1U9}HQG t5fu.O)ljPD PR =kz5M6Y=5L-DBxsqh>tadt\<-u(=tK=tB-wH=Rt/=Su8t4+=03E9s$ X>t 03|h,j8 XZCyXCf.S K)y1fK)y1fCYCfEECЍP9UK fM)y1s9~fSUʋMM9EL8fKs(sXxufufCVt%z `~x~Ha (aS9USB CfC> =S=VYv1P-DB'h,j̜ Vx sHrC Zt sP0C_XsRYtF t!u S_Zt Cx~fF ft\uMsqC ^tsPBs |1ɉK s{Rsd1C03XZu W_XF u|svqC Yt sP^BXZs"RXCt2Po1s_$uCD0tPoC1҉T0YEC9E|ӋC4tu S_Xs1ɉKC ^t9P1C Z+uuQu5M6pe[^_]UU03U fP]UU1x903~03]UWVSP.503039=  MRPkY_Mu1103603034uj,t-t)903r!DP1 Zt;03s ,,؋]U513f11303ZU513SXU513XUS]uTu PnSPjQ]US]u+u P~nSPj(]UE Puj UGuPh]# UuPh]# US ]uuPmSuuu jPQ$]Uh5"uuu uUWVS}513513XZun},u4u(PmWPjj{t ǃE}t'E8tE$9}un}Y|EE$|9}AE6}Et)~%E8tP-}ZU$D9EeE} u)@E }y$uw[Ej PrIZYtE@M}})ȻEE9~)Ήuu uWQM5132ÃMu$u uWQh,#513Q11MHS3XMtV5M6 5ZYMM513PS؅5139PSfjjSd$SiE @PE@PWMQ513^1P,S视 P513vSP513u#u(PvkU,Ru$u uuP$t6SHcXtSV54V SCWPSe[^_]Uh5"u$u uuuuu u/$US]uuPjSuuu jP+$]Uh5"uuu uUS]u1uPjSuuu jP$]Uh5"uuu uUS]uu P4jSPj]Uh5"uXZUS513513 ؋]Ujk US]S1 hX"7ZPY sl^ =D3t7S螈Ph`$5D3t 5D3N5D3Tk1D3=3t8S^Ph`$53t 53SN53k1ɉ 3=13uh,ha$ XZ]UWVS h*A"Pt _Zuoh~RjP觌Ph"h,t SZ_ jj h"S- _Z؉Ph"5EY[!&tCVhS8 uWvx$W t ;u뵋Ct{ tዅh"R茴 ZY€:=uZh"So ZYha$SiZYWSj ;ViXe[^_]UEPE 4UWVS 1ɉJ P ^2 Zp j h#a$V uՃ{ uC Wr h͢$W0 VW0 WujƋ;7P0{ yC9C u=CPW Z_Zu YaCPsY_ZtۉC{ CPGC VY^e[^_]Ã=3u U塤3t uPSO XZj"h UhX"zVYtPU Zt h͢$U YhjhQ~YZ hZjXUWVS 1ɉM܍}1T3j1j蜇[_ ]߉jjPN =T3u:SZxEPj b_X}cjhy[^1=T3\ucj@3PgZY~>jh6j@3PgyjhY^=3;SZujh_XS^u@31ɉ$Hu\b@3Ph]#jXj_@3)t]SVZ4}EEjPFV^XEE119EtMԋ 1҅t9t; tB F@܋Ekl9tH41҅t9t; tB Fl19t!4EP_ZYu S&ZYG19tPZtG}WfX1;Us=klE@0 t.Hdt'yt!U؋ Ph q1p8p4kUB19t4UW:ZYmUBSY_S}Z^u`S[Ohj]jYju8j]SZYu'S֌SiS jj^֍EPݛXe[^_]UWVShPV7ehhGe$V.hVWe$hh$W-VNu1EW=Zt/SSSSSSSSSSSh"h4jj*Y[ WVSXZ뷍e[^_]UVShPVdhhGe$Vn-hVSed$hh$SI-St VSXZe[^]UWVS}11u܉5T3jj._ZyjVP7J e]@3$*u u^)uYjhb Y[,u>tPZt@3$PX@3$S|^_EScSDZYS<^_Ne$Ye$S^5M6]jj5M6葃5M6W5M6]EPj }tChj_jZju,jSZYuNe$Ye$̉SXe[^_]UWVS}11EܣT3cjj]ZYxjSPhH xpu@3*u$tPV_XEV\[u4EPj ZY}t!hj`jju VXe[^_]UWVS1HH;E E8u EH1LEL0t < tLEL8PPnY$}1ۉ889E S'nZ9$PuSq O]1<%rA <%t)P-< u"DB@CC8uj PPSw P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uP-DP@tC8u$C<5D3[1ۉD3hZC"he$Xe D3ZYt$SxPhe$5D3d 5D3>'=3t#7u0WPhd"h$j[#u0WPhe$h,xd j/[ 1]UVSƉ5M6Qj5M6*5M6iWhPjjo hlPhWPjj>Vh]#= h$FCPj@V5M6l @jPSR)R5M6$uh,he$C j=Z jP< lZYt'5M6 sPSq5M6CPSpjjS{SU؍e[^]UWVSӉVjVEVj(P$P<@  3h3hpt$X =,h,hbt(X ud=,u[jh%j h,hf@$LX=,t"1҉,h,hbt(#X ,D3tP;X3tP;X=t %13 Uf$(f$uj j jjhDg$ jjE $` 󥁍 Pj(|_ (CD3t#u h9f$P3a 5D3W1D33t#u h"Pa 53W13h[ %3i^_uhHf$siZYu s Xe s h`3XEt28t(P _tSPhKf$f S3O 3h]f$M jg31ۉ381󫋍$88Dž1 EDž1ɉ zWp8/h/$ _=D3t 5p0RPhgf$5D3_ jj P 9 X8󥋅 ,014,PjjXPhH , 8uE 1ۉ#XhVSh h-" ^Ƅu PV$ u1t@ ?uzD3tPW 5D37 8uE h"PEY ZYt f W0t0P C 1x{f$ D3xt SPk] XZSjM. ƒt=$  ( D3^_tP6[1ɉ 3 ƒuhMu $t"=th'M Z1e[^_]UShhjhjjjjj jjh ,h4y.h,hf$( D3Y[t Phf$ XZj S jP!Sa ]UWVSEPuhVW }uCxPVY[tE 1҉Sth*A"V7\ _XuA h*A"Vr XZ1ɉtu6D3tVh#&hf$P[ 둿tt txW;>E X1lSL pY@ltJG9r7tuvQxFE 1ɉ^dWQ CE XZtNp1F1}uStQS5 Xu5D3t,Rh#&hf$PZ }tS ZS(Qe[^_] UWVS0u 1EEEPVEP ] 1EԉE܅unVhf$E܍t0SE)Ph!VI hg$SU ƒE9E؀8'uE؋E؀x*h$u1 ^_]EԊp<'uMCj'S0+^_E؃}u S^Y؉E؋Eԍ4VuAE_ZOShg$j* j 벍Jg<%u<@T)IB*E6j/V: ZYDžuV` EXuVN E̍GE/X}u]_HEu^ M܋}ԍYtqUĀx .tx uuWa uˋU;2tEԋEԍRUu@EZYUWVE)Phg$E܍DP覜 y;2tVCXu XoE܋M1ۉ۾]Shht@j=N f}ufEf}ufEPEt|e s+M6EjP5M6Wp5M6[J6Et55M6Dj5M6 5M6,JM6EڋEEEfmEPuuًU܍Edh,"G tE@ Eu ڋEE]^SESXZ;M6hPjjotS9M6ut h?"|XunuJ_E@;M6uX]UVSh83W$93W$h83h@13J =93tR)~83.u83Ph93gBZYt+hh-$h@13Ghh93h@133@13e[^]UWVS1ɺ!idu$xtx jPh83I1ɺ%idu$xtx jPh83Ijjj] à < 1jh:3VvIVh8i(SGS ugL8PlhPh639Id#8P0Xt*hVh63hSh63$Íe[^_]ÍL$qUWVSQ-P 13T[hg$(Pj y,D3t Phg$ ^_h,hg$ jG h3Ƌ([1ۋ(?RXoUYX9hC$W#GZYPWV[P hC$W G|P-LDžX@,XtMQDU$HDQVaX uHLDAEXhViPGC (uV;W;XZ0iƄV:W:^_ujrjoY[ PDž$Hjj$V(Whg$ @u"Dž$ jjVWhg$ @u/ ;Pshh$jP|YZt,뱸 ;x|s:h1h$jPP_Zu(hre^t 13DžT jS5XZYt53zXDžT 9tf@ @ j+hujjjjjjjjjSXjuRL411PDžhjt`hPLϿh uLX#9_X  13hiPh:3BEjhug$h:3Ut(jhqg$h:3U qg$ug$1DžPhQh$j@$W&I jjPpPW $@t puh4#&h:3h$h-jct8DžpjpPjj$VC @tVhch$e^[^1=:3s(u=:3lu :3P-DJuPh͢$= ZYt;rPh͢$* ^X1h#PBUY[h#P U_ZÅu 1DžPkjv<$1󫍽p!󪍍pi\^@u 1ۉ$Nhhhh$tVZYthh53h53jf=53thh43h43hhZC"hTi$K Ãt{Phh$jh\hh$S]\hh$SR\hh$SG\$hh$S9\h53hh$S)\=43th43hh$S \ hh$S[^_hh$S[hi$S[S,Ah i$j[h:3hi$h(h:3h%i$h$SDF S.hIh$h639SZYhmi$h63 S^_hvi$h63SY[h@g#h63R_Zh#"h63R[^h$h63RZY=63h63h:3h}i$jtnh:3hi$$Pj8~ $X$4_hh63h63j~-hyg$h63,R631ɉ `33hhi$S[^h"_Zh:3hi$hj$hDÃ3P `33hj$\Pj_ ~h\h73 @ \3j h73 thj$\Pj ~h\h3? \r3j h3n t=3t `33hk$\Vj ~h\h93j? \3_=93u8hk$Vjh ~h\h93)? \2Yj h93_Zt=93t `33hh83 Y^u =83u `33111hP$V>hh83h83jxhh93h93jw,PVO^Zt%`33Pu*jh83h83jytjh83h83jzetih83 Y=83u=w jhl$"P?w jhl$-wjh)l$h83= jh83h83j{hh73h73j}`33u:1llPj豷XZluhh3h3j|VDžH73=73u DžH@g#DžD83=83u DžD@g#83=83u@g#83=83u@g#63=63uyg$3=3u@g#HDVQRh:3Ph83h93h"hV,=73u DžH@g#83=83u@g#83=83u@g#63=63uyg$3=3u@g#HVQRh:3Ph83h93h"h(jjj g$x PX`23Rh]#h hZ^L,XX/h4l$jktj 13Y=3h!hQl$D XZu>=D3th5D3PL hh,P4 j.: hbl$jTpWl W WPhl$hl$VT =93th93hl$VlT =3th3hl$VPT h i$jATjV9=83sh83h83h:3hl$j5hl$h33V hh33h33jjFj jh$<uch m$$SV h33S dh$dPM Y_t 8tV XZjj`RPPuf=83t h83h83h:3hm$jPh83h:3h@m$j5=83toh83xF$h83 [^T=83th83TF$h83迿 ZY~=83th83+F$h83薿 _XPu΀=73t&hZm$hh73hum$hhhm$hr  13j 13TXTeY[^_]aUU5"w#&]UWVS] }Vh]$IZYuu ƅ?jhm$yp:jj\f@jhm$M7ZY9t x/t/@?/uGjhm$MXY1iR 4$SRPhm$hu; e[^_]UWVSƉˍPh]$HZY5"uum$VQPSSĕ3t`3PVSWhm$he[^_]U 3E]ZUS]S+VZй3؋]9USPEEPj褰EZYt=3y`3=`3/ua3SPh$hh3u: 1]US]= 13ujXE]EPj (EZYtt33`3=`3/ua3dSPh$hh39 `3=`3/ua33SPh$hh39 1]U n$jKMh@+#V@M=63th63h^n$V$M h i$jMYX`33HSPh>n$jL=63th63h83h83hPn$VLh83h83hhn$VLh i$jLXZhZC"hwn$cYX舯Phn$juLhh$SjLhh$S_Lhh$STL$=93th93hn$S8L h83hn$S%L =93tPhd#SL h83h"SKS<1h i$jKhn$ dZu/h73hn$KY[hn$Kh:3hn$K =53thn$Kh:3ho$K tV0ZjXe[^]UWVSUʋM2uBIu tu< }[yt ut܊ y_vDmt4\ 0H2N0H2N0HB]9uXZ[^_]À\umtf\\Mt܈@UWVSdÉE1;{ URWSPLE tkEud Ut/tQjuuSЃt?u4EE,RQURVtjURV GqEe[^_]UVSUE 9| 19[^]UE UJʋ HRP]UE p1]UE @]UWVS lj֋tZRU<É$URWA@ u6EPjhjjj EPS1 E t8u }u1e[^_]UVSMU ZLALttbU M[^]@uEY,t:r,t-9r&9rY8r89r9r9[^]UWVS ƉjR ZYjh h PWW uPP=Tt=Tu<x3P9$u%SVho$hSVho$h e[^_]UWVSEt6ӉRho$EPuz E tjP8 XZtu!Y1h|$S(?YZu UEEtPuPho$VquH!tu9Vh"}W趸 hWSujPP$jLZpe[^_]UWVSË@@kPhPLpYh蹺PphI 1҉ll;Pl tVqdPRL t{5P31WVxtRPWVu|RPdphp$uV覷 EtjPpVK hVp6 l?s pC Xe[^_]USExtjj譹Xh蠹SPhoE"Epd]UWVSEU Ћp$RVSPL @t1҉ t VSЉ ^_5P31WV($RPWV0,RPshp$hTV|/ 8t'hh$Vh8pV t$hh}$Vh VV7Y‹E@9hC"DPG XZVh]#Ep#  e[^_]UVS]u {t5F fC ][^]o[^]UVSÉ1ɺ|$&ujVػh5"Sh)A"xe[^]UWVS\ƉUM1ۉ]1E9tXE 1;Y sHFE1U9t; u;Zt(@URSQMPL Mt EԃUCGjuEZYu 1ۉ]EjuEZYtMEEE}E9E1ۋE;X skFE1EE9EtE‹E;u;ZtAE߉MEURSuPL MtEuE_E@ EC덃shjjh_jhj_ZExN1jSEp&SuVSuVt~tg`PRQ^[^tEPPRZYtU6?8t,>8u"E@t$RP]^_uh|$EPA7Y[tEXt p$l(h,`d04t:$VSa]_Zt'EPV4Ph-p$hS) \EpFjh8p$ZY@ِҐhDp$hSp$S*Vhbp$W*Whnp$ST$WPh}DSS ?Php$ t0?u'hp$/[_thp$PZYu莼XRh%Pk) tjj h5",4,0RPj$W" S&1P- tHLDJ@tSPWVhp$hFP(  ;31󫍝DžƅDž;3DžDžShQVjZ ;3Džf=t#fyf<3f=NE1f=FX!щ11Ҋ<3<3t'w8X$'wX$$(uJ1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VY^ ?j!jAj.jj h5",4,0RPj#R} (PW#RVhp$hS% Ijj h5",4,0RPj$W! WVh#hS=% 0E@8@}~P# $uJ< uuƄ$jj h5",4,0RPjW茰 SWVhp$hFP$ 4be[^_]UVSPjjuVjjh$&@tbuK XtSjjVSjh$&^@u SY2h$S6ZYt PuU ^Zu S[ h$j1e[^]U EEE EEhEPOZYtEU 1ɉMEUh^EP%ZYtE1UWVS`NjEA w1hr$w" ^Zuh͢$w n0ZYth$&3\0[^G,Suh$&360ZYt\tBJ@u xt@w3@3$t)tVP҉[Xt@3$1ҍ1ɉ9@3PS/YZtXP,40Sƒt/t#VRЉXZu\RY8pu`$uVP҉XZtً$9jjjjhSQRPx jjjjhSQRPx h$Pv9 h@3PPh!VK9 h@3PVW(R)[XT`a9lhGPPjh_SV[Ah$S8 hwS7h!S8 hwS(uYhp$Vo8 hVhwS Ph$Sh à ƅG1ɋÅthy!S,ZYu!Ph$j à uh #S,ZYth"S,ZYth#S,ZYthr$S,ZYth!Sx,ZYtt hhp$ hh$V hSV ƅGw PV à {wh]#jj9Z؍e[^_]UE1҉UMU ]UEEMU ]UWVSQ]} E10$hmj6S=u Ep$4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVS E 1ɉ1D󫍕D1҃=T35M6h,, 5M6T3 Iuujj_AXZ1Ҁt,DžfDžDžj+Dž=v Dž1ۉ11119tD5fDŽ5DŽ5j+H5=fDŽ=DŽ=j+BC8[ty1t1DŽZfDŽDŽj+DŽBt1DŽXfDŽDŽj+DŽBhjjjjjjjjjRPj谛Ã4uDžhuh]#jJDžPS!tuiu5hjjjjjjjjjPj$ƃ4t@DžPV趐ZY^Hy V֛XS͛_u?t6hhPh,(@3,Džc=T3yuT3Dž<1ۉT39i8511ɉ9=T3t9i853t(~SW&YZoڋ3@3ƀy1҉LPTXjSPhCP@3"PjShX35@3,, 0$4(804$ u1҉DHPWHDFP$@3()l,, 0$4(804 uȉ1DH$=T3 pH DH9jj h5"RPjVZ jj h5"@3$P@ RPjP' D38t$@3VHDPh!q$R5 @3$pvơ@3$0`RRVP@3Pjj:5Dž1ɉ$Pj行^_u65@3h_u1Z%$P1$Xu@PT3P5@3 PA^@3$JZDH-1ۉ,048DHƂ(@348<=T353g_3Y3tu 3h>£3a1X@KyuƆy$tP,40WD$͋e[^_]UMw1vB ]UWVSDž1@3*)Phq$hS_ |$t+hf/^Shq$h訽 jubh͢$@3Phc$hS h͢$Shq$ǃ((h͢$ShjlE0p:11ۉR YZtsE;klEX{41ɉ Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CL_cLuПXZ=T3CLS9SRV茍ǃSRjj\ 1jjB6u$ $&v=IC`,tPhq$hV Vhq$PY C`,tPhr$hV CXtPh r$jWr WVC\tPhr$jWM WVST!t\9$t=#VPhr$P>Y CH@|$q$GCX,tS\tPh0r$hV Vh6r$PX w$q$hIr$PX XZUr$q$h[r$PX _Xgr$q$hor$P~X Y^{r$q$sq${Tu[q$PPPX XZq$q$d1]|$q$NKPQh($hcǃ-1ɍPY1e[^_]á@3*;UWVS ƅhr$Nh!h #聊谇Phr$j$=D3t"@3X芇SPhr$5D3+ u6hxD3Zt Phs$ ^_jj 3Y[hs$W*$@3[^1҉D)kSPGBZY;PdV& P,P& Vhgs$W#TP,PA$T\L1PL9Ph!HPZYHuuRS& VP,TXhh1TRjPZ*Pn(P V^P1Sh~s$W" PAVYkDlEXC uDED;rC,u{Pu C0u tCLtċC4jjjjhVs8PRx 1҉LtL{tCH5"DžHr$L"CP w$\$&=11DžP|j#L""DžPw$uL" DžP|$h͢$HaZY҃5"uhLP r$PLhs$Sy؃RPhs$W8!RPhs$ht$諄X11DžPgr$11DžPUr$<@h͢$HZY@v ExtSx u^~1;s}O19t }?;tBx(u PYFËEx u=Z&1ۋ;sx(u PXC1ۉ؍e[^_]UWVSu1ۀ~ tB~9s*ًx(u1;tB9uPXC͉Me[^_]e[^_]UWVSQ8ME111ۋE;Xs-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVShu$he[^_]UE8b]UE$L3Ƃ@L3K3fP K3fP1]UEPE ]UE E EE] US]$L3)PCC0@L3RoCK3C K31C1]UWVSÉM1u1sNуtXT3tJ}󫹷<0u%1Ƀs1t0uAqt⹋,J EE띃}tB 4BB3EEZY[^_]UWVS1󫍵HEPE jhjjh<.jh5T3jj jPSj|Ã8VPlrS}1e[^_]UWVS<Ɖ׉1E1;S sMQRUSPL <]UBjlu5ZY1҅E1EEE;C M9MMQuSPL k}lE̋UЉQE܅t8tjPQnHL >_4EG8EċUȉGM3l)hp ZtgP h9x .tW PlxPh@L3|@tA3t,9|qP5A3,_Zup迟 YA31P5A3_ZtãA3 1ۉ,E%=utA3@ kC<=@tA3@ +)Ph͢$l  A3A3<$L3@L3P/ A3CA3YƆ@L3A3uFA3fVh+jRPe[^_]UWVSh"_ujVp [^P螣 ÉYh"P< ZYthhPW& =whh͢$W =whVW =wjW _ZuS[ S}X1e[^_]UWVSh}^h$>h~jhv$*hVh$Vz53mhx GRjW53hn%&hn%&hSjW53(S:Zt PSV +RVlVjh5353O53jjhy$Ã(xj VPoSɬe[^_]UWVS։ϋ1׋B˃1t.0uKB1t"T3 񈈀T3ȍYu1[^_]U1ҋE ]U1ɺE ]UWVS ]ju ^_jdu hWv$P!| u hc$W | 19tNi sQWV1 uΊa<w ~[BjjP親ǃ :1ɉPhd@W~ u u WHZ`RhedAWPW(`9< RFaPu hWv$Wz jjW迩ǃF s9"hhC3W胮@u W7Xjhbv$hC3v u܁=C3usjOh(C3Pƅ_ OusƄWu h$sy CRPh#Py $1u2jau h$s}y CPP CtC @C wF-1e[^_]UWVSEEuu%&%& %&K31%&ƃT3@&u1T3@9uT3j@{T3j4{T3j({T3j{T3j{ƣT3=T3WxËT3$Ue9s}ËT3RUJZ9s}ËT3RU1Y9s}V!Z9rVh5"hv$jj$ T3EEe[^_]tU|EPusXY1uE%;E Uh@uÀ=(3tuUh(3hhv$j5 t1T3h3hx$h$hh3y h`3hx$h$hh3[ (h3sZ1Uhu.UQ K3 K3u0EEE jjEPhK3jEPK3K3USh$TzhJzjj hxo#hhxo#hhv$j S SXZ]UVSP]u EPVEP,7 E u Vhv$jq SSPhv$jƘue[^]UPEEPjeEZYtM3EWgh`3Ph$hh3 8gh`3Ph$hh3 (1US 8Ph͢$~9 [X1u?9t3h0!SZY¸thu#StZY]U  L3Sh@L35$L3hg$hh K3 jh K3h0A" (fF,~PeXYtSTSXZ1e[^_]UjjAXZE< UEEEEPj[EUEEEEPjZEUS]0SnEpFnEEEE1EEPjZE]US`,{/ttPuZYuC۰]UuZ¸`3uĕ3UWVS hC %EPo Y[#5"EEPn]Suh$hBnEPWYEh35@3hlx$jn¸u3u>ZE\URuh`3PVSuhx$j"¸$KEtVSW Và E)ËE9thx$h`%&h hx$u Ee[^_]UWVS EUˋujQEY_tG UR#kuSPQÃtPESXZEEe[^_]e[^_]USj$uZYtD1ۉ]XEPjhjjj EPS譶U Vt;M rj$S뱋]UEPM UXUEPM U XUWVS 1҉<P&jƅ Phx$Vg t#hjh y$h(y$j y$!hjh3y$h(y$j [y$Ph3^ Wj&V  Hvw= 13uj輒_1,Dž,Džjhh$jPj(Uu1 h3h,Wݢ 5"=,u.h,h]$dZY5"u=,um$WVRhfy$h谈VS@ = 13uj̑XDžjhh$0iWj'T-= 3+=`3=3hy$W W h3Wh$S\e Wh`3h 3hy$jڇ$VShY$jWh$j讇Wa VS7 Y^DžWj)SXZX=X3tZ=3tQ=3tHhy$W W  h3Wh$Sd WhX3h3hy$2;e[^_]USڸstjS ZYuShy$jʆ ]US13tjS ZYuShy$j芆 ]USS1$tsf1EEPj%REZYtt`Huȃul"h-$fX t&ji h-$fYXKuhy$jTXZ1]Ã=A3uiUA3!I3z$:ġ3z$+3P#3$ 3r!ȡ3]USE] tP7fYSjQxeXZ3E]UWVS18Z^1Dž@DžDDž<jjZuWU2ЉXt0t3haujPjP_SV t3uQX} tExuh,z$j老Y_}tuShTz$heǃSh}z$hNǃ V< VXZt-t3Sh]#hajj@=3t=3tShz$j E@T3t 3e[^_]UVS]u Stt uhz$OXz$͢$2uz$jjPVSe[^]UWVShhx$Y3_Zt Phz$|e [^311۸`,P/t 8tT3u uA؄t 3Dž`,{53/z;iT3\3u1uSZYH0353j5M6̎5M6AE5M6:=333P53hz$ja_13Pj wKtuT33uf3ƅ1N1tσ0u@/u(Ht!ȿ1T3uƇT3Bƅ뼀t/3'tju ^_T3t33u9uh_ja 0VR535353Phz$h^ jjY[}u%T3hz$j}XZT3tkhz$h}^_Hu%h,^jY[th0{$j}XZhg{$j}h{$jw}T3T3h͢$LRPxV urh{$eLxRPZV uT|9u;xt8h{$h{$.Q^_th{$j|h{$h|$MҴ\[Othy$jT|Y[ju XZ1e[^_]UWVS,{t0u1#W3(PYZtWh]#h\ ك1ujhXZe[^_]UWVS1hOw$$KPh]#Pl ytQPXHh0|$JPh]#P6 xhH|$JPh]#P y6륋tP:Xuh]#h3[jj_xPxhm# à t^yS h!P XZ1ɉu|S Wuh]#h3)[jjBRh"W] ZYu$u4 t*Wh]#V$ ShWL u<=uDžS/ V) _Xtq譈[^u薈ZYtCh0Zj^_u2aY[tjh2.XZ1 jh3G<1؍e[^_]UWS]S 1E CM [_]"Uu uUWVSSu] V 1EStitcklЉE1}9z4u@lM9ut@FjlP,‰FXYt*1}9{4ukl4 @lM9uܰ1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtƍCڍe[^_]US]s Os$GXZCE]6UWVS]1;3s8klCxdF@0 ttW X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@s裼XCEe[^_]鐼UVSjhPju蔤t)uu P @uu0S較h0Z1 S誃Xe[^]UWS] 1Sh|duw t#S;S t%iSR3莸ZYt3ֻX1e[_]Uu hzd@u)UVSujhPjV躣t(ju jPV+Sy 01e[^]Uu hedAuUU EHJ Ju BP m qEMt06t(Ȟt h5"5u3h}$vtstZ~ tS4C8u%uh u hH_hPRY[P5u35Č3P31RPss(nRP5u3%5Č3P31RPs$s nRP5 u35u3h}$v=Ȟ5Č3C S$CS P31SQRPmRP5u3몋P ]uC( PGP5u3]u CH@L؃PGP5u3]uCH@LPGP5t3a{uCHpX5t3{uCHp\5t35u3h}$ooCHP`u&h#GP5t35u3h}$vߛOEERh %jP茽 hFURjPà P5t35u3h}$v蔛S軬kfx5t35u3h}$vbCH@Hth}$vIXZCH@Hth}$v1Y_CH@Hth}$vXZCH@Hth}$vY_CH@Hth}$vXZCH@H th}$vњY_CH@H@th}$v蹚XZCH@HE }$FEe[^_]鑚nu%CHP5t35u3h}$viI+{jPMQKQWsPRdk B(0`EMQP5u3h}$v0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4I8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhH SPXZ1e[^]UWVSu jFHP]SmjSSjjjjj KHP-E܃,11t]DS@uu@tA^Ht҈Uth"WeZYUu CcL'/t C/jWjWSڵ FHHL1e[^_]UVS u vDh %j ]S j SSjjjjhG0S8FDVHB`1e[^]UWVS jj%趤[^9hBC _hBCC_hBC C,_ E1҅tuB '&tME4}GF _u/UDEjh譌MEZYU}B}$w"uuh@BF _X}$th~$h@&&hh ~$% jjjjhj^hjj jjj%SjM8ƃ4xu Pg.V9Sاe[^_]UWVSQE @4uE x8u-u uxXZttt =t ujj ^_x 1҉j4'&U茋G W`UBXYu؍{shAh AChAC h@ǃojjjjh_hjjjjj SjM7ƃDxu P3-Vs8S褦1e[^_]UWVS] ;G(S119tuklKI0΃@jj h5"GOOgRPj!WB jj h5" A1҉SQыcRPj'PXB 8uth?jPPVE@ tP?jPPVz5"u h?Xp?0p?'QWMQVRPpjjAČ3,jB=?SPh#j -P Č3jC?SPh#j :P蟵 Č30j->SPh#j GPz jD>h> 1YÃsv3Z£v3~ް-T1~CVƄ5T -߉TPh=~$jPhu3ִ j.6>hu3P5v35v3GP:P-Phx~$hh u3舴 Dh$CXe[^_]UWVS] @3$DV(Y_TV$ C8@@8 QPVRL YB r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjh5gh bjj7jjjjF)ƃ4PV0V)E)PB89B4<藓ZPufLW WPF8PP8 WRPQLP $AZYtj/S ZYt xu]UWVS]u}t1҉t1E U EU&& EWEURPh hT3uY= uˋO uEuHEtMUjh~$hT3! UMutt5"~="U3)uMUjh!h2U3! UMuQT3 u ƀT3HFu2U3tt 3U3'U3 h$PPJ Y^ v?Ca@' &P@Ph $jTP Tu1Ca@Ph$jTP輙 @&!h$TP輱 XZƅ&ƅ@h"ƅ4X10@ 90)0Ph#XP P31RPw7#HRPhK#pV GW W P31SQRPGRPhK#S ,P31RPw wGRPhK#R `dhČ3l`PjhXPV\(hSV\S蟇w 0P`TdČ3hjRY!`SjP肴01Dx tjS,!SjP[ǃ1ۃ tjT !`RjP5ÃjU `RjPƃtHt&PPSW0h$LPw bPW0h$LPY Dt%PPS0h$LP0 P0h"$LP 0EW?S9V3P3X1\1(9,Dž} p1ۋ P31RP,(jERPhK#jpPA t";tLSh"$HPG  LHjSjjFj jH#H 9LtP=^SpPעZY8:'@<`~15Pz3EPEPEPuIC~Hz3wL3Mh/hY CSEȉUjheRP+%Pusss sh$h(hMĉ Pz3hPz3j,F Pz3u/EEԋEE؋EE܅t+EPEPEPu,APUԋPU؋@ Eܡ@3$tuuuR@3,jhP@3$tIytCf(u9PH[Ht'@3$P@31҉$Yhh^X]9_~GL Hz3AEȾe1Puqqq qSh$hEX$뱍EPj-EZYDHz3DPz3se[^_]雃UWVS5Lz3t/uujPB SgthjbXZe[^_]UVSE X(uNpƋ0VPsjhSà uhjj ؍e[^]ðUE1Ҁ=Lz3t]]UE} t=Lz3t[1]U čh$ h$j!EjjEPEPjh0,k$@tEU th$j XZøøUWVS,uEE1H3L3uFVEUFVEUURURVЃ tԋ Pz3EUA @3;\`|.}t1hjq[_uCP@^N t9Ӊ}ډȉH3L3 H3 L3EEЋEE̋E E11}E,E1ɉMԊ MˀuMJ}uE9tEԋMu}t>MJ}u29Mu-*}tMJ}u 9Mu }ˀuGE }$vE0EDr%=uu r% = uuS% = t;}yhjΏYZ|tTPz3t&@t 9t9Pz3t@u%}*h7j袏YZ-OOBOu5(O~% E tSE ($~ v$ t$~ v t A$3$ E uW$E fUu)8t$EU @3;\`|ˀ}t4U uWNE (}uƒ ҅u uuth hhXjeZuWh]#hS$V艎e[^_]UWS0]}ȹ 1E1EEE =Lz3ujjS@ jP4E܍EPjS@e[_]UWVSM 1@3f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuha$j]UWVS4}=Lz3PklUVE 0G^ZYE UlVSClP#11CC,C0CLCPCT @3$F( t1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC}}w1] 1ۉMԉ]M]x(Ã}t*3M 3] uM ]M]U9uU9u y;u U| 9u܋U}U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á3"UWVSLEԉUȉM]E EUE}ԋwu}9UM}։lj]19؋]| E1ɉM;EE}HuuWV t4EUuuWV);uE}u}]ԋEUCSEU1҉ŰEUEU]9]E9ƉMEEEU)EUEE1EЋM9M#} E؀x @11ӉM܉]3M 3]$M]] ]9u܋]9ƉE9ƉUE9EEM܋]Ή߸;EE#EUuuWV);uE}u}E9Ɖ]w)]9؉ы]}EUEЃEE9EE]|Eȉ0xEUAQ EE̋EU׸;EE3u}uuWV);uE u}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]USQMAQRPRPjjjjU} IuEU11ҍeY[]UE]US]sh2$j ]]PUWVS]} j/WE ZYƃti)PCDPW@m ƒuNV`~EJ9s4t'19ty u9t@e[^_]Uju EDPt6UEvPEDPu \UVS]=3u $3K$9C |`539s sUjjjjRPRPU t39r,1tu{(u t @9|1e[^]UWVSU}119y u 9;] u}t uz(tt}h~[nЃu"9uǂǂ1J Z$1ɉƀJ C@]tB$1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVSz31ۃ<*&t9jS2FFXZSF w(&ӉӉƃ"ue[^]Ã=z3uU{3]ø{3UWVSUu}E EE9E sX11ۀy u9t 9] tC9] r8@9E}tMa}w}uWrVMY 0}t.1HR}t PRh$PRh$WVd] R}t PRhWv$PRh\v$ԍe[^_]US]uh$h(&hh$g suLX]]hLUWVSÃ=z3ujz3u1$hN$j Ã(V苞 Xe[^_]UWVSÃ=3u 3{s1ɸ9|,@89@|1ҁ{v@1҉[^_]UWVSE Eu}hj=[ZtAǀǀjhPju*@uSAY1RC,PhedAZL x0u<;|1ҋ9Ћ}SAXZ뙅~1E u CCCs {$s{ECTCd_19G t C <u:?C <yG1ɉPPPG1RPtA8tRPh}$j]SA FPTX0h]PRjP]PSC0h$h ~3X h ~3IË=Č3$WPh$j^W@ Č3LhLRPh$j|Rc@ 0hP|RWh$hh}39@ 1ҋ;P ~3@ ЉHHL0nPLPhL#jMQ? hMQh}3$OHt ƃ ~3 CGL9t OtGG-CBmhh$h}3;hh ~3h}3'h$e[^_]UWVS ÉUSP\E{ [_u}jS6*EZY1KȍJ9t9sfAAFurfB  ~3fB }uBqfBB B B1B1BB ufB*B,G0E)x9th$h*&hyh$H 1ۋEEe[^_]UVSQÉ5p~3-Up~3CEfC[e[^]UWVS} P,pjV)YX19sD @jjjhjhjjj j VSjƃ4t WP虳G=XZVӾS-e[^_]UWVS} SDVM;ZYu1#G @Pwe)ZYtW JO GЉ41x 4ȍUĹ ]{ u0SPH,0^}1ɉ<@EWjR<'XZL1<9}D *@>hujjhjjjAjjjRVh襼E4URPHu膽V+}51Dž<Dž@;us<`RVSPL t$hl`d<@FjH&4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV7)׉<@8ڋE"C t @]fCEf@ DP:Xe[^_]UWVSEMt]X$[ EXUjS%EZYtI ,Ut#E@$19tD BMNju1ۋE Ee[^_]UWVS] Ep+s8k H(L9tWIw\hWKQVs4RPdhWWjjjj@(48WVs4PRp Vs4RPh 1e[^_]UWVS0] K4Uus 0RQPVL Utss ssuu3輥C S1e[^_]UWVS0] K4Uus 0RQPVL Utss3CSuuPR|EU+CS;C {}C S1e[^_]UWVSDÉUEE1uu11;{ sGMQWSPL t2EԨt+M؃9u#F}y tEċUȉEUE̋UЉEUG봅u*}pƋ0VPjhKNtY}yS}ttURURSЃ u1pƋ0VPjhVSRYt }WSЉXZe[^_]UWVSPuIh=1҉UU:ÍU.WVh$jjjMQR9|ڃRjjh)$1e[^_]UWVSl}1E EEURj,1[_|ËEPRHEU@3PLEUYE9ƋE|EEE 1}EjP4E̋MEjjuuuuP31ҋ}9=P3׋u}EURPjEPQEƒ01EUEUEUEUhjjhhGhj6jjjuSj{ƃ4u S$ZkEPVVQS$}u#EMQ]SP @u uXUEEP tB]fCe[^_]UVSR] 1ɉMS4t&uVRP u uXfC<1e[^]UWVS] E@fHPR0_usCthpW/ ƅhWWjjjjp t%RWP@ZYuX붉Ɖse[^_]UWVSLu}1E EVUEURj,CY[tUÍ}UE;P s WRPQL hjjhhGhj6jjjuSjj4uS"ZwURPEEP7Sh"}u*UE;P s]SWRPu uX1}t UnEx fFe[^_]UWVST]SSPHEU@3PLEUZY1}9M|EE1E}u{3jjuuuukMeRPjEPS,HEUEĉUȃ}uuujP8E؃ jURS @tQEM;M qku0}u jjuuuuuujURSЃ,Hu1~Uع1EUEĉUȋEUẺUЋz!EjR4E؋juVStVPSRLƃ txtjuuSe[^_]UWVS|]@3tf(ttuh0$h*&hh$; xF5T3t\Up~3hjjhhhRjFjjjuPh}3肰ƃ45p~3Y20艹Ep||7oxwajj h5"jh0jUR读,jj h5"jhjMQ葻MQURW|xu@3PjhqN@h$@3$0ظE@3$pEEEEEU׉ u11MQMQSЃ UtEfEEXEĹf@ @ g@f@@x=3w@ f@*@,hujjjjjjjjjQRh蹮ǃ4t P苮@,EPWKW苯Et11!UMQWSPL UuG;{ r"E EtEuEȅtօt1hIjHY_uD3zPhH$胼 S3ZujhQ_XO:jS[^JsjhsO@3@u ǀ@>U1]1EEPVXZ}y1Q1҉u1Hùxt%| q1@ 4S-|GEE;xrB;Us E11ۃ}t E;]sP,C_PYV觭5p~3XZ}e[^_]UWVS0EDž}uEl3jS ZYt jS^_uDY15jS_Zu[^ƅ1;33} tE 9[uE(u)tMQRYu';s{Љ E, UHD9Ɖ}djj h5" WVjWehpƃ 3WVPh{$V] VX ƅ3诳P7 XZ00@ _w%tDž111=uhnjj h5"E,}H,DRPjV1E$ho觲RjPES 2Y1Ɖ<$1T2 ‰$SP A S1[Xf S@ $1f <$S@ WV19r$h$h*&hh$2 uձZ1hjjjjjjjjjP|Ã4tPS_X19s <19t4U@YڅttV8Z,! tSѨXe[^_]UWVSljfDžv/ƅujh-$iY^yhh-$S# y蝟t&蔟8t芟WPh$hS' hWS" =Džp!j/S _Zt-xv9tH9s8/t@QE YyߍxPW YZ%=pu;>hQW iƄ/u%蔞QPh$hS!& %hQS! =@uWz ZuhWP! =hSO Y_1Ҁ;/u 1Ҁ{‰hSm.p<$Y.ZlhЃpDl=w4uhh͢$S =whWS =v 9?Vg _y 9VYz9VA ZVf9X1e[^_]USÍEPS肧 YZx7Et.jSXZxj `PSD t SVY1$SK`Z=vf u]UWVSEUP^ ^ƃ}t11ɉMV| Zt{fx vX jhH$SG0 uSuh$EPl @u hi"ĥ 3Et}tESWuh$j+u[zV@ XEEe[^_]Ujh*Gj, UWVS h$11tY+ڸ$xuڸ$wu#WSϥ XZuWS軥 Y^1yah$觛hPSWS 1u hˆ$聛PSḧ$j,Sh؈$j7hS蕥 h$ShPPWP訥 u'h$S蹚PPḧ$jh$hPSSh7$jtPh$h$jjuh$SDhPWth$S'PWḧ$j-,h.$S hPWAh $SPWḧ$j,h$SؙPh $jMhr$S赙Ph $j*h-$hPWh.$S|PWḧ$j(h$贙hPWh$SByth>$S# Ph $j' h=$YhPW4h>$Sp14,Ph$hWC vtpWḧ$jC utjh+*DXZte[^_]UEt~3fP]USE@k +&t!+&ShWE 0Cx~3 ]UWVShƍPhW@jy@1jh$R_ZRhW@P0 11!tVk +&+&u Dž"BVP+ZYu=t~3DŽ Gjjjjh jjjjjj!Sh˞Ã4tjPS`S蠟AXe[^_]U詖x~3tPPRRRh$jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡP31RPSQRPhK#j]S ]СČ3EԃЃ7P٦URjP:jPPh~3S  e[^_]UWVSĀE@kl} GNjE @u FuG u G08uw0WEU1EEPj ĒXZ}E MQw8P uEP^G81ۉ]E ];Xwk]lE X{8tIC] su19Mtklu ^c0AO0u uu ]u]u tu9]}UEG0uW+EUu FV}t ]U]EUWE <1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A 8 B}lj,&fG G5GG G,G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{`S(xE+C$PR)XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQPYZuk{8ueEC8EC4FV SVCEpxP@EUH3L319| EU)AQ1,&Wv @u1]{]4VNUMEP$@ EU]9]s#kElx8uyP@P b]9]r,1]9؋]|ZEM]+HX M]11~8u(V] ]9E]|V1]9؋]}yV9E]}jM9MsWM]+EUuuSQZUUMNk]lUMʋUeʉT EUVEM]+HX M]11ҋ]9]sV]9]s kul7T7]9]s kulD7T7 M])ӉM]19Mt1E9t$E9t8uW t G0u)EUAlʋ}9}}y{&к 9ʺsbkEl}GËSEUu}+u}uuWV贵)9uE}u}u}EU)SE};xM] uuSQ迶ы}ϋUʉӉ]u9ދ}|}9׋u}ȋU}MOQ)EUE@EE}EpxPEU19]EUC<S@9Ɖ|]C0EU9ƉE@9Erk9EkElU‰UM]) Z19ʉ|EXH 9|1ɋEHE0xP0tqP0EH0bEUӋEU)uuSQ^ыU2zk]lu΋Uʋ}TE0xEPuFV e[^_]UWVS@PEU 8 31묃u1돃ty  ?VI$$@c)((A6,,B 1ɉ Ph"jS jSSjjjjW*[0S@0 ZS10 Xe[^_]UWVS(]}h"uV\ 3XYu81ɉU`1&MVP ZYU9‹M}ƒ$uӃ3} E $0&h4?V Wtjj"V_h5ku2P31RP {RPhK#jEPv h6&tjjUYh7u)tjjUZPh]#jEP h8t"u h"jEP h9t"u$h"jEP h:bt"u(h"jEP} h;0t"u,h"jEPK h<TVP3Ph}$sde[^_]UWVSX1ɉt @@33t=$txuP1$Xytƃyjh$裬_X=33|uÐ Dž813ktƒ8B1;8 8.T8 RPh$hW 531҅t8t%FWP ZYu Ɔyԋą3ƀy1LPTXƀ);3ǀ,ǀ<jWP hW3"P =3u/31҉3h3aljY t_3tByu/39u3ы9u􋐀뺃G534@k<Љǹ1󫋅PB qsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB q$CsC C8RPL u;H ruكtЋSO_Wk<<󫋅PB qCsC C8b]1fD @9s=3t10&󥍅Pg^0&󥍅P6[=3tcDž DžDž31҉0&󥍅PY=3t10&󥍅PX1B OeTB Ln3yFHfGe[^_]UU J E]UWVS0EЉUĉ1ۋ9}qGE̋GE11ҋũ<tw9tMBu9uSuh$jEP 53tFURP YZtEЉChjXZe[^_]UWVSl3ppp h$V# h$V_X1l3k,<PXR0PR GPZYtcOTt[8jjjjhRQPWxl3؋QP :jjjjjPqTRPx Ph"VJ 0)h $V)_X1l3k,<PXQ0PR GPZYtcOTt[8jjjjhRQPWxl3؋QP :jjjjjPqTRPx Ph"V^ 0)l3p$p pph$V*h5$V h i$jVW j脝 l3tPhM$hi uql3t詚VPhb$hhuKl3thw$hh u,l3th$hh u l3DpC1e[^_]1US]1{u4{ t; |1C3d!{x[]Ã=ġ38UWVS`1Dž1103P~Y5371ɉ$;H QPRL t tt߀8tPR R /th͢$RXZ03 QR ZY9st6t-Q[ ZI Y99}tt$;H s41V D 03$Vh$hP躼 5035"t)A"PP XZt03PtYV貙Ph $he0388  RPVh$he$tt;,($ PRPh$hbe$!PRPh$h?eu&03@40|81e[^_]1US]1{u&{@u1C43! {x[]UWVS33xtt$u ƃxaPYt0$xtEjjjRt1PZu#D3tSh$P誾 pÅtD3tSh3$1=3'3P_3p31:uJ Jt @ =u_k 3]ȋủ33BMȋu1k 93u93u93t Bu1҉333e[^]UVSMU193u3r93u;t = u1[^]UWVSGDž31|?1$%$;p WVPRL } t} t!} tWVS jVSSx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽj+| Fhujjjjjj |}@Pjj|Ph/Ã4u1}?PS%S0 |9ṣ3k<}Ee[^_]US<] EjP3ZxD1k8|<u$MȉHh!Oh>jRjKjjj@PVh&ƃ4u 3w1=3薖\SVVD' =3uL@3$t>3t5xt$h`G0jY^tjjXZǃ=3؍e[^_]UB=ȡ3tuhő$jPO UVSuu1r$ugjjjVyÃtjjHDjjFPt$@3KS;DH} DHe[^]UEx8th"h81&hm hّ$> @UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$n4$zuubPrYtWWZtNjE@ u WV_XWPV. tjVSE@ t VPZYVXjjSƃx3 e[^_]UWVS] uUYP}Ĺ 1󫃽PuPZt苅P$V_xt2jjjVǃtVYt P$VPHHLd 1Zw j41&RjP8x u0h"hD1&h hّ$Ҭ R1t4Q,1t9E t @11tt:[]UVSQMp@19|h$h@2&hh$ 9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]Ã=3uUhfXUS]=3u1;3s k<3[]Ã=3uU3]á3UWVSSÃ=3ut=;t635319t$USF Pt ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h$R. ZYuj ju[C,S0h$V Y_uj ju[C4S8h$Vޙ _Zu0j(u.b Y^ƅj)Pb _ZFh$V蝙 ZYuEhŒ$V} Y_u j(uh˒$Vb _Zuj`u@S OhҒ$V> Y^u>hf"EP͛ XZt(@5&>ttVP YZuG C<e[^_]USPQRhޒ$EPj3~-h?"uNEjhx2&P t2uz[1Eh"EP5 XY:tjME+[h?"j\NEZYuuzX]UWVS1jhPjEpbÍPhd@S @SAEP,[1Dž Džƅ ƅ tfÃuCt=ut2Ѓ  uuЃ A떋Ex@uS@4tPh$P# ƅEpPh$j3t1EE@@Ep0Et(pv0v,h$j\3V1y1ɉH0X,t(Eps8s4s0s,h2$j 3vE@61C,S0Vщ‹VZ*H{09L;C, P{89T;C4 PCP ^_;t' Ps0s,hT$jB2s@\PV谕 ZYt$Vs0s,hn$j2q{tރuJtjaYj jVSK t*t t/j jV KKj jVJ u7thh$P@ hVP@   h]L#VÈ ZYuDG8PW<G4&hkL#Vn ZYu)+hNL#V4 ZYu)j h2&V+ t򉕨hje^Xۋu0 jY19ȋWi[j`RC@P%v C,S0C4S8 u+t)CQ RP# YZuƅu_, G 1E u% G1ɉOOO_O _$UWG@jhRjPQƋ_,tjP4tKRPPs0s,V0t'8t"P% PXZ@8u ǃC4S8)G W$q1ɉSh|dVr iRy_ZugYSh|dV`r u܋1;s̋G,tpH,9H0u0;u"H49H8u;t밉jSPs BuV.Z1e[^_]UP3t 1=ȡ3]USÉIQHQH QH QH QH QH QHQHQHQ0hN#RS@w ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk5&Wb uu wur uRCu1jSk5&V' u%u vuGr uًU EGue[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPh O#V~4 u}w1M9Mt ]K1ߋH X$9} 1҉P P$ )H X$EE}Uz=tVwAtLw"Q w=RX<Á@1HøUWVS։M11ۉ9uuRjSP07Gуt `d1ɉMMu]썜SjuRVPEЃc}t09tGE}t"MM슌 MtMuʋ0tt9tGEC01e[^_]UU 1tEMh]UEUUU ]UMEPЃ< u1tE0]UE1҉U_U ]U EEEEEEEPU EXUWVS]xu,P4x1p3?J} @0P4x1p3?J} P PH1ҋuVi13k?] 319[^_]UWVS u]}1u܉]EPHU sZu tX$PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EEPEPEPMȋUEaE )EЙ]u)։]u]uEEEPEPEPMԋUE Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋuԉMʋEeƉωؙMʋEE)׉ t/E Et'EPWVuuEE Eu}tE}}5E؋EؙRPuuEU@3DH~1ERPWV}uuRPmEE]ÉUӉыUe9E1EPEPEPMȉEp xKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9ZXeY[^_]aUE]UWVSQME܋A1҉UE؋E܃0EE1Ɋ t.}uÃt&<t" ,1ۅu9ut@u0Eu1ƒ< PWEpWMUE{11҅xE1ҍeY[^_]UWVS,U$}(E,u01ۉ]]]]]]1ɋ]9ً]| E1ɉM܋]]19U}U19E}E1EEU ẺUЋEHXE;E9ME0juQuMU]M MȉE@E1;EE }H1u}u uWV<)׉;u} M}EE)9s U)‰U1҉UM1ۋE1ҋ};}}܃}uu VN^ Eډƹ19 Ee[^_]UVSEP$9p |$1jjjjSQSQjURP>,1҉Ѝe[^]UWVSuMU ];k _(u/ȄtaB 19t Bu,1u.R E@M,9du 1dd[^_]UEUUUUUUEUUURYU UEUUE1҉UP0UURU UEUUEUUP0UURlU ZUE1]US]MEE k B(u#1tAƒ<!Ѓ;ukE U1uQЃ<![]UEUUE1҉UUURU UWVSÉ΃8t2$41jVRgc $Rh{dЀ3a jhPjR?@ue[^_]UEP0RPNUWVS]E EC0E1xp@u@3Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@u}WuSZ yуtu G{0Ea;hh ZYohS9ZYa }U׍e[^_]UWVSEX01҉U1Eߊt]}tttR<tNwtw A,<vy 3CFU,U9u 3@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU P4 1]UWVSUE}u NtGtRutG_tvpS{4 GPh %vSg^ FD64t(vtvPSY e[^_]USR] = 3uj EPup ƒ =w uE8tt h7X1kD3İ3u]U U1vEEUEP U E7ZÅt*UVS14LFZuSLXe[^]UWVSQu>xp19|hr$h8&hxhB$g ]9|@89@|ue[^_]UWVS0uU=@3]ډ@E =~Mȉ\1ɉ`Uډ@8;FF| FP1RPz~ tjURjVPL tWEċUȉḾ1 u@dž9|Ӄ!lj! t9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E E th}$h8&hhB$e hj"F^_ 9&u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP @ǃEPu9^_t!ẺEЉEԉEȉC1҉ ؍e[^_]US]= 3uF1Ҹ; 3s)=w9t kD3B1=w kD3[]Ã=3u ^3UWVSƉ $41󫋅 EU RPVho$h4PgY E jhPjV0xShydP5S @u V X1VjSuT e[^_]UWVSlu] E EE$EEPSV EP#ډzXE8t%E8h$h8&h hB$b 1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}t }t#1A}tPhc$%uPuzS "}tPh$Phq$uuW ؍e[^_]UWVS8Ɖ˹1jhPjV.1ɉDž11؉1u51 RPhS=|=ZbƋ!!Љlu9tEXH!ƹnEXfUtƒ<<„t <uh[0101ff=Ut f=u(Ћ,D1ɉNu1󫋽~wRXu[tO ttGEt%,MPP,1RW P Pشx rt6t%F,dDž $t tW9,sAu1hji>^Zt1ɉF1*1҉ X1u1fǃUe[^_]UVS0E E th}$h8&hhB$:] hj=^Xu1E u CEUY~11ɉKKCSǃ?ǃjh>RPk@ECǃ1҉K0SUE^@uSAhރ{ u_C$9S }NURjSPL t;M܅t43t,31@=tD9u=uSXe[^]UWVSSMӅtY0uƀ1҉8,0)߅uU,)ƀX[^_]UWVSP}U] J3ȃ<tu&`t$[ch\XQ1EEJE,K1CB C 1CtqE1ƀEDtP?1҉TY}`t01`1ɉEǃ<t}tAu1ɉM1EE9`uƀ1҉vN09MuCt:$29Mt΋0ukE00,09u/1O0t0uu 10M`0 e[^_]UWVS,É11@jhRPS&yPhd@H @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< 󥋅EE 1h1󫋅,t20t"uh"h`8&hhB$W  u/ƁƁƁƁƁƁ} }t~1É1uvB? ڈD>1É1uvB? ڈ49 fDžU1 uAWVhPx30J12XuWV)׋1҉!!S9uE9u=H!؍S9S:ș[9-9!X؍e[^_]UWVS]Euh$hl8&h .1uEE}lj1Ʌuhe$hl8&hhB$#U s{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{1Ҿ33tBt D9u3{u}s{ u}u}u}v}t 3M1;})ωxMH PC u h!kE UPa XZ܍e[^_]UWVSE }Ĺ }Put&3u{}1ɉt3t_31 h$hP8&hhB$S D9t Gu]u1ۉ]]]]E1u)E $}vuuE}t8tރtu݋M\Z]1ɉMZ1]u뼋u^0]M Mt3] ]tu$}rEdu uXM]M9M]uUMUMUMM9M]uP @x|EUx|EUE9}}}EE`ut.1EUEUE9EE}}ދ0Ή1}9}}U|s1EUEU,Mp1t1ptM9ȉЋM|/9t+E9EE|}E1hj1EZYEfǀUƀEEE1҉RPtpu9uu|H1+EUẺUЋE,ujPE}܃ t"49ttPt5W 4Y_E0Z}w1u}RPWVy)׉E9Ɖ}ME,}ȋ})1ҋu}׉u}uĉ}ȋx|9E}}EU+EUẺUЋEujPE}܃ t"4t9tP4W 4XZ0}9ugucE,9EE}Ohj/Y_uEc3}},fǀUƀ0Ë0}00UMыE`E]}v& }v}b}X]puu;u}ʉUHX M]EEjREpRMUEEE1ҋ]9]ЋuEEM1ۉMĉ]ȉ$tuNEEE1҉UH1ډƉuuRP")׉}9ǃ}U1UĉEȋEċUȉEUEU1ҋM]M]9ȉ} +EUẺUЋEp0\EX}T>uuuE}܃ t3UŒED4Ut9tP82W }UD4_XE\FhjjP+ 1}?t;_uE@EuՋE1EE1ҊG9Bt<utE0E}tbExt99BEXEtكt&t!9B1ɉME}tX̋E돃E9\=,ujSE6}܃ 49P0WL 4XZЍe[^_]UWVSL]E EEEuC,t)uC0EMċUw-:PX{,BC0EMċUHu1uĹ 1jjjj1RP1ҋ};}}EURPjEPS,tEUEĉUȋEUẺUEؤ3jVSUE uaduVh)&suuuus)&C,u*E̋U19}'SjRPuus)&C, X({,tˋC,tPC,e[^_]UWVSdE}Ĺ u^0]H331@=D9u€t 1ۉ]1}t ߃tu‹};} uE@uǃt"9t}h?]QEEM1H1EUȉƉSQRPI)׉u9}1UĉE11҉uts;E @˃tuZ}`tMt;E ti@EMt˃tt9E tA@E}uы0Bp}t EQ$E}U1ɉMEċUȉEU1u9E8ƒt<E`EUEUЉEUMEu49MEEE}tIMtƒt6<t2,AE1҉UI1M]‹E9‹EU}0n]уtt@uh"h@8&hT:u09EE}}h}[UUűEЉEuEEE,EE] E9sEjQEpuMUy}$E$]]1ɉM1҉]ĉUȋE19u֋M}ẺUЋEuuWME]E EE t];u ǀ]܅t'EDt9tP*SG DXZEt uDEt ]TE9u/Eu;hjjP E̋UЉEU1҉}ttBuh"h08&hl8EM]M]։u1}9΋}})щ hB$D E}uEgEe[^_]UWVS]uh $h8&hk hB$D Es0h9tSME M9u㋶0u͋EtP^C,t PY`11d)FZus(X]e[^_](UWVS}G,t PXjhPjwÃt7WjR4$YXtRVSVz(SZWXe[^_]UWVS\E0h^_E0h"jP]S8 jPSSj So Ǎ@^>w̋E0h"jP]S8 jPSSj S; ƍ@[=wʡ@3EHDEU}~ E1ɉMRWuu<SVRP+މؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ@304}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]@3480hz$ht}WuVEPS$xuuuhz$hqWVEPS>tuuuSЃS,e[^_]Ujj b? jS j P+US$ P> $5"PSh$h,9 j0 U=(,u (,3fPftPZ9(,UWVEE왉U1E}ujEPj e^_]U0E E1EԉE؉E܉EEEPEPuA ƒ xEÍL$qUWVSQ@@u5jh3 333333XZjP 3333+33_X39}933s73󥋅331=3uhljjE(t!j$jjV =3u`hA"PK 3Y[tPh]#hPF3 x3319߭y\0%ݝ݅ H0%߭ٽf f٭۝٭y1d~dVh#)P=P2 Nj3~-3t PL; Z)Å~:ùdh5")Sh;&Ph#)P=P.2 ǃ119ʉst @u4;&SQh#)P=P1 +33+ 3y @BX0%ڽ߭ 3319ظw ȉ߭x0%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4;&%11d PVSh#)PP*0 339lj33)ލ 9lj݅99Ћ}h#VQ_/ à +33߭߭ٽf f٭۝٭?~~h#rtPh("VQ. Ãh$VQ. à <ЙRPh#)PPm. Ãuh?")PPC. à 3fPftSVP eY[^_]aUSB jB X]UWVSPu ]Ett v9s_B 71;uuߋuE9s$;ut:GFFPhy$jW- ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=P-DWtDOt uxuA 1!tjjEP3  FCE덉뉉؍e[^_]UWVSujuZYt&Vu PW9uBA 7؍e[^_]UVSu huà @tuuSSM؍e[^]U|EPu ZYtM EUQ1UWVSEE 0Vj S DžuVjSq ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U <v }D&7Ep V[( YƒwCljt)1E@EȉC,ub Ex txj(Zu h>&M3XYǃ,f@S(P1.1;,s$k(рyus1(D@.u e[^_]UWVSSƉM׋ttU9t7{ t1 ufujuP迡 t[뼃 S Vhr$~2 e[^_]UVSÃHt1HL~tU HXPF 1LXPt1PT~t PYP 1TZ`t1`d~t `XP 1dXt/tV1I,X 1҉Yt/tVH,X` 1Xt/tVH,X' 1Xht/ltVH,lYh 1hZe[^]UVSTjjjVmD@PjVj48@t@сt t t48SVQkXZe[^]US]E ftPh=&h8$/ jPC t(@t 0 h=&/YE u1҉U E].(ShjPe#@uE =&E^$]I/]US]E ftPh=&h8$7/ j|P t@@/ v|y */ 7`x |ZxYZt>1҉Shj"@u;E =&E^$]x.h=&n.XE E]']UVSĀptQPhhxVj@u hh>&.XV Sh$- e[^]USË4%uXhə$S諔XZ{PtS0Ytp%tSLt$Ju"PS`XZ]UWVSÉ׉΃t t%љ$t1PSۮS]jS|Auٙ$t"PSXZe[^_]UWVSÉ֋8 Ph$,1ɺhXZu$VS诓Sjj$1ɉK 4%ujL%XZe[^_]UWVSUM8tt^@@tR{ tGu}  t1҉CXZ[^_]USÃlt1u?hvPplPh$+RPXZlu]Ãx tkUSË%u6S_% Y u=uSmZ S.YuSX]US]S͖Yuj#XZIpQpcvPh$ +j#Shjdj"]UVS]E ftPh|=&h8$* |)RxP uh|=&k*X;|t xD8t|x苐hX, H 1tf `,yhX,j v Y^X,PX, Shj@uDE |=&E^$e[^])j'XZu Ee[^])"e[^]UVSjhDg$ZYuhDg$hj")[^"VPQZY@u Vh$(ZYSXe[^]UWVSPu~ % tVXtpE&%Et%`u VYE%@u$t+`u#V,Zu}V,Xt%e[^_]UWVSE48ځ` u %t8tf% tW*Yt ߉%@ tWl+Zt 翉%` t떁1u ځ u@\e[^_]US];(%P6(jj~jju4]UVSS]4@tp%@uft0t0VY%t1҃w=&R Vh%$&SvSZ%tw4=&Vh)$W&[^8%thC$e&jN Shj4u^%@tTS,-1ɉMjEP,k@u h>&"&Z,ǃ,Xe[^]UVS]h{!"&48с^t:t0t~ u h$V莌YXvj\XZe[^] @48]e[^]6UWVSD]u Ctt,PCQPhj@EP藖@uh>&E%EYE{ VEPW3buVWhZ$$ {EtSj@VCxPj VWhl$$3'`U D@RWP_Cx3_UXZe[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3^UM   t*;xMu;0tQh$#11҉[Y^{ tHEU  Ѓ t3 Z@uhT>&#Xe[^_]UWV։ϋD@WVXZe^_]UWVS]%t S &_u Sh$"Y[ % ڋFEj EPju{ }PWhŚ$"M1҉1;,sYk(jQMȗ Mt5j EPjQ?PMAPuhњ$#" MQ~G럋 S3Z@uC Ph$*"Y_ t{ uS\2%ZtSdX{ tSQ_t>{ u8u %҃RS虡ZY@uC Ph$!Y_t { uSZt]e[^_]e[^_]UWVS(]} uS$ESẺ{Ls$S$ ({ }u }s uJS貣Yt?Vh$ SSdSǤj3ooE "$]e[^_]酇Vh4$f h$So11҉ 9C$u/S#Z@% 8E|>&e[^_]G jjSn"SH#@uv 8t h|>& _1EE A]e[^_]2"}{ tC uPhE$Phf$Y^{PtRStCQEЍ}ԉƉщUS苢CtZU9uPEPuՎ t{ t911҉{ t411ɉh"S3SGES6]e[^_]e[^_]US]C Pt$ZYts$sLP ]]n UWVS];1{Ly)tC$tjjS 14%tutEC$u?tS!Y@u h8>&xZjjAS @u h8>&]X]e[^_]US]C][]3UWVS ׉΋U K 9}!E4UQM YZMUtB;u t9{ ;u u{ t|EUh{$SvjjM%tuuS %tS貞ZSKSX+9t'C jjM$S [e[^_]UWVSS] 84%@tjE1҃ t6HjEP,߼ @h=&hT$_tm>h<$h$h$@t+XRDAtxUh$h$h$ Uh$h$h$ 1Uh$h$h$p 11hț$hћ$h$Kt [hٛ$h$h$<J@ulh$?Y_jjjc KPh$3<3u534%u dW3XZe[^_]USS]E uPh=&h8$ jEP, uh=&j4YuZ8t$h=&h,$vj,,ȼǃ, _w$jPh=&hF$j6U8tu hl$mYuSRXZ]US]E U{ u)C щ‰ { t][]~[]UWVS ]]} utSEtXZu  w{ tC Ph$$^_CStP }tQSSh[1pEPjEPu Euh >&YASuxXZu ~ WEtKYXt3{ tC Ph$XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh$11ɉtY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu ؍e[^_]UWVS]DžPPhh@uh >&h˜$)1XZhڜ$%Y^1hPmF1׃ u Vh$XZu 87t 8 tt Vh$^_\XPS+ǃuh >&r[ttlHp VW ZYu VjS ϋFVt=PVF PtZYt%Vhjj 7u7W1FtPV2VP~ t11ɉ3VhzWtPtStPS| e[^_]US]E ftPh=&h8$a SӡZ@uD 87u ]]m 8 tc 8VtY 8tE=&]]UWVSD}U uMtNˉUMPV ZYUtOMv_ 7 }E =&EoE"e[^_]G(1f9u2W>G(1f9uW>uxG(f9t& tʉUQPG Ph1$UfW(W>8uHUPVG*PC  Utn uG>j u G>T tGjt G*ˉe[^_]UWVS,}E EЋEE܋EE؋h$S ^ZuEE $+h$S ZYu,EЋ@0S ^@E] EЉEe[^_]h$S ZYEh̝$S [^u EЃHo1E9}E4B Y\FS3EZE1ҋE9}?E؋ UQM  Ɖ$MQu )KEƍ@E UB 뺋E@uh՝$uI1p,E 1E111EEM̍EPh@B&h$uuTMtvkt@(NtT4tW6uE븃UuM@몃ptxtnu딃M뎁M녁MyoEcp,E%@4@E܉E1E11ut0tX~ tMڍN U9U~!E4UQM ZYtUBM9]uuVju EvjEPEp  uot0tR~ uvڍN U9U~!E4UQMN ZYtUBM9]uuVuQu @u414E@ty UE%  9]u%}uUMhjQt8EE̅x ލW u9u~E4RUn ZYt FUEЉUԋEU E Uԃ}t}t}u}tM 1҉EЋUԉ/tP9]u>t9[E4tY[tEX]9][tSu؋M܉^XZ9e[^_]UWVS] U1{>tNf}fC(ffGfJuj| ȋuFZK>s*S>+Ee[^_]UWVSu} lh$hPVqà t1=whleh$hh$ < 8th$h]# XZhh[u h$?&r huPY1l>u?G Phƥ$( tXZ{>u[C Ph+$ XZ1hDPWhohnRPhnRc =nwHƄn ƄoPRhh$V׆@u-h$?&h$~ YXhtjWhà phth$/ Xϋpe[^_]á3tU3P3U3]UE@]UWVS]u }uhR$h?&hG}t}uh$h?&hHh`$ tu "t 9ptIC ujYuTHtAJHt6BXCpf@up MH1҉PfxCM1 K뽉Cȍe[^_]UEM uhR$h?&hh`$! u 5 t 9Jt BH@MUWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVS$Ǎ]SjEPGPShEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uhR$h?&huh$h?&hh`$ }ʚ;vh$h?&h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;v [^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuhR$h|?&h|h`$ B 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuhR$hp?&hh`$U U PH@LUEuhR$hd?&hh`$& @L11UEuhR$hP?&hh`$ U P0UP4UP8UP<1UWVS(]}1Eܓ1E@uhR$hv   DFu EPj趦 @u11EEEE1;s4sjEPC04 @tF1e[^_]USjPj[ZtÍ@PjZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tg>U t9FuV9u@uEFtB.NtH C1҉KNt R蝧KXVXs@1s@sDCMYC t6HtJKHPڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]gUWVS]uChR$h0?&hh`$I 3t,3H33C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t0zLu%1t]UWVS\u~>u Vv 7EEEE1]MuF EMQUE UJHOuԊEEjPS PF Phզ$F>PSV}(u V*N>׉e[^_]USEtS1jS[ ]UE t E]r@ ]USEtSS[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWS s jWV wmj:V_ ZYDžt?EPjhjjj jGP3 C8 }tK UC8jVCPJ P-  DJu <:tFu}Wjhjjj EPV C0E t/it.u#Wjhjjj j@P C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP ZYt[u{5 1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPjURWPVsu ju`(C*WtE4%@u1t(SsZ@uh~$AS SwC@SvfCDCCHSu @t CPCHC pS_uCL1s@CX_XnƅRe[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[! ؃4[^_] US]SvqZ@u:jhj @tjhj @؋]UVS t=΁u$B Ƅ Ӄt ӁtӃuӃ uӁu [^]UWVSljQ ZuhA&LÉEhf"EP ZYtfPԇ XuhA&S2[_LUj@PV UuhA&SUR q7SXe[^_]UWVSSƉϋ]jh$RU UuA}H} L @ð`jh$RJ u>MP} Tð0M@} DKS0CPp}7uMU E$e[^_]UWVS EӅt΀9uE1҉1j/Q蛯 Y_DžuuV _ZumVh$2@EEPjj jjj juS }tuh$2Y[:t SP[ZuuVs ZYt/1tE0Xe[^_]UWVSÉUQMU YM<9"u"OAIQMjϫXZMt3t 9us 7QS蘫Y[1҉U}u9tEtCE9KEp9ush͔"SB ZYudžEPjjjjjjSk }Sh=$ZJEPjhjjjjS0 F }Sh\$8%EPEPEPEPQEPEPEPMԉډ 8%CEPEPEPEPQEPEPEPMԉډ jSuuuuuQt Shx$fjSuuuuuQujSuuuuuxQ볁111otq;tlj/Sդ Y_M̅tU@j/P贤 _ZDžUuًE#ًE/*O1t1ۉEEEUEPjjjjjjS }}Sh$ )‰U썄jYu h$R9  T uh$oj,Sn _ZDžtxu Shը$V9u:K j@Yu hP" t%Ɔ EPjhjjjjSε E, }t h$_ )‰UčEPS _ZHUu- 7L U䉔) jWY ]̈ T <4t{4u  ;6t{6u @C빅EPjjjjjjS蟡 }!Sh#$ ~LHL+j,S* _Zt S P U$UwYUSh?$RP{ 1ɉWкY}Eu Ƈh5h$$SA ^Zu ƇhhM$S$ ZYu Ƈhh`#S Y^u ƇhSj\E^ZPlӶEZYuh B&^lSPpY[{u Ɔ 1kh#"Sw _Zu Ɔ Nh%SZ ZYu Ɔ  1hQ$S= Y_thV$S, _Zu Ɔ Sh^$pt$ jٺ@[u hu$1 EEEU | m^O@8%'EPEPEPEPQEPEPEPMԉډ jSuuuuuJjSuuuuuJjSu8%EPEPEPEPQEPEPEPMԉډ jSuuuuuJLjSuuuuuI*jSuuuuuIjSu,^j=S] ZYu h~$@Ej h$S up}u11҃uM#EEEUIj h$S u}u:1ۉjh$Sf u0}u 1ɉM1jh٩$S" t@jhҩ$S t,jhȩ$S tjhũ$S }u'jP%XZWEEąuh$OE@MEM̍UE@u E "M1ҍE@tE WB#XEPRU,2EPU̍BP2EPU̍B8P 2WURP%$1ɉjh$S }u'jP$Y[BM1ҍE@EW{"Z61ɉMURPEb1URE̍PRR1EPE̍P8RB1WEPPH$$1ɉjh$S tjh$S uB}EPjjjjDjjuޙ }`uh$j h"$S }uߋEj/u苙 _ZDžtSuj Hu_Suj HuOƆEPjhjjjjGP( }t uh/$uhP$11Ƀ}^ٍUE`j/S踘 Y[uEjP\ JM JM ٍUEsj/S7 _ZuEj P  J M J M \ETPT'E߉EEUEEEU  %EEEU Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ Ɓ DžtG1ҍEj@P   JM ^Åu  8%t EPEPEPEPQEPEPEPMԉډ jSƐVuuuuA" 8She$ q $eSk $Y[ h B&> 4%tu h$fF@u Sh$  s d X @I : + uh$V EEẺUЋ4%t%E̋UЉ1tt h$E̋UЀPt @_t1j/S _ZDžtGڍEY@uSh$ 1,E̊EE19M k(Pu*t,Uf9Pu#U8uU8PuU8Pu U8P A밁  K  @ED1HEL PETXE\EċE18E1҉uZ }tEHM Eą h$ EH$MH(Mąuh$}tdƅu Sh;$r EPjjjjjjSL }t ShN$C FÅtMh_$k1uLƅtFj:S ZYt8URjhjjjj@PؑE 1}̃}t'hn$j=S _ZE1ɉMt@Eh#SZYu)u h$p0h0$S詯Y_1utčph$SyYZu( sPu h$UphN#S@YZu(:u h$ph!SYZu(u h׫$phݴ$SήYZu πEh$S貮YZu @)h "S薮YZu  h$SzYZu h!"S^YZt-h$SMYZu h$S1YZuh$SYZuh$SYZuyhǴ$SYZu`hδ$SͭYZu Ghִ$S购YZu@.h&"S蛭YZu h $SYZu h$ScYZu h $SGYZu @h$S+YZu @h$SYZu h$SYZumh$SڬYZuTh$SYZu;h'$S訬YZu"hy"S菬YZ t Sh$7}tuSh$XZ1E s!t@uh$Xs }u h6$XuShQ$urBthQ#S߫ZYtSd Xu 1E}u.j,EċE@PR% uBh B&#V>G1EMċ 9sM9 t>{t8@,9tt(MMċJ]ĉ k,1CC C$C(S_YE{ECs Cǃ}t u1 ZEủ)1 E}t5E- }t }EEHhr$`" SX^ud}Sh$@dMA2Džt @hW$S ZYUĉMȅt"hQ$S ZYthe$S ZYuEċU ẺUE%E̋EȉEЋE̋UЉhݬ$S ZYu\u h$30uQWj> HRhȬ$PQWj Hu؉߅ h$W, Y[th$W _Z@   jٺ[u h$ nbV@JEPjjjjjjS藉 }Sh$tzEPjjjjjjS_ }Sh$QtEEPjjjjjjS* }Sh,$PYuhD$XZjE@P(詹 i(,P,k4EfFFE̅tHEEFEFEFF}u!1}F1uFj/WR Y[Åt/uWj HtJWhP$1}_X/uWj{ HtWhP$}̉XZuf~jCEPjjxjjjjS辇F }CSh/$FY[-e[^_]UWVSEu} EEEE1ۉE싀@B&tM܉UVP ZYUMtCnuFE샸DB&uu u EW"DEEEE} LB&EEe[^_]E8%uu Ex$e[^_]e[^_]UWVS]}1p,} t]%E苃%`E?EPh@B&Ruu跐tAjj5l6PًU E=ƒu$E8E%$t$뢺} t*%Ƌ䟉 u }쉳UaUЍe[^_]UWVSQEE] 1 t 8t R褟ZP蛟X1t 8t RyXPpXEtu7jVu| F;$0@%8tjjV迦 txTuxTjP僻DtVr,DX@ڞHXLtVE,LH讞P_TtV,TP肞XY\tV,\XV(KXZ]e[^_]:e[^_]UWVS0uhdj赙ZYuhB&X9Áǀǀǀǀǀ@ `hI&PN 48Y_tt %t 43 03up03@43jjj? tPd 03 43Xjjj tPcd 03 43!D_ 03 43ЃhF+P P =v1 1ɉ} !8%j,j@_Zu h,B&!Y ǃDj,jʗH_Zu h,B&Y ǃLj,j螗P_Zu h,B&Y ǃThhK&W =vh,B&hc$XZPPZYh"P費 Y_t u-PP1҉xW腴 ZD9t t ux\tH@ߋ@D1@DHLPT1HLPTXh\l1X\hP0VA9u0h,B&hoE" ut=w@ƄS0V!91 1} 11PP}YZh"P趹 ZYt u t:R襲 YD9t֊ t uʀx\tH@߅tC%䟉1h#R YZ} uj`@PdG u>ju Pq d`T Zuh,B&_G`h8$謵 ZYu;}uP腵 Y_$h"[ YZuA}uP4 _ZutDž}tuh$ ZYtOPPًU mDžY1ɉLu}tSV XZ1+u؍e[^_]UE E9r9]UU19U t]UWVSǃEE1fUfQMbZUu8؋Msۍ;ƸE9EsOƋE)Ɖr=89s "@G19r)SEЉ‹E9s )։1e[^_]UWVSSU uJTuh$hI&h~TuhU$hI&hh'$l YLGL9t)cCu)U QM<W<ZY8ËMU t u7F|B|u t  tAH+GHu9r9e[^_]UVSjjV聜 à tSV՜ S ۍe[^]UWVS8}1}عEX}ى‰+E pE؉U EPW_ZuUBtt U Btu VSZYe[^_]UE UU E]rUS]hI&PØ hI&ØS貘 ]US]S$ Y1t S Z]UWVSuh@$h@I&hh'$譮 Ɖ׉j<|QS" CPqtS8jh'$蕫 jjS* ǃ t:jWS ƃ }tG9Et G99EuWSX W* e[^_]US]t"jjSʗ tu S@T06 ]US] UHSu ZY9tS X1ۉ؋]UE PTuh,$h\I&hh'$蟪 2PuUWVSSEuh?$h,I&h;h'$k ӉϋBTx t*tSu YXu-4STZt׍CPF^t1sCT9FTuwFt ;CtulSV* ZYu_FttCttC8PF8P ZYt>CPFPZYu+֋CT@$uFx9CxuK$ٺ"%tS$Fts5cٺ"%tS$vSj7Y[@uX 8uw롨tCtt&Sj6_Z@to1 8t h\$زYVj6_Z@u! 8thk$趲Sj6 Sj6ZY@u 8thz$舲X1Vu裕 Vu ؍e[^_]UWVSP}tDjjS ƃ t)jVS E 9~TuVSL V uӍe[^_]UVS E uh@$hHI&hPTuh,$hHI&hh'$ 2uh$hHI&h߃}uFƈPV蔑 XZt1SV轔 uh$j uV2 ىSne[^]UWVS8uhI&]S hI&EP hI&}W u WV[8$th4I&h$_X14SVZYujEPjEPe[^_]SVZYt1xjjSw à jSEP^ ECT x t8hS_tC8PsTt<ZY@u h$AXS;U t0C9t ;E SEP Y_ CT8ESP XZC|twG|tڍEjuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWu譒 W <Et(SP\ ZYt`HT9KTu 8PC8PY_ 1ɉt8SEP\ SEP^ 9ta h4I&SXZ]PV(;_@u2 8Vt ẖ$ٮ[jjW蓑 à jSW} EC S9;U tSW跑 SEPu u~CTt 48%u=t=ٺ${Sj2ZY@u] 8tS 8t h I&XSY]';E ASV SW 9t h4I&赭SXZjjuVk à uUWVSSljӉMЙ1Ʌxtؙ)ѸFE)عy11X[^_]UEuh$hJ&j;h$< Ptt > /1UEuh$htJ&jQh$ Ptt /1UUuh$h`J&j}h$谢 Jttt8趬 /1)z 1zuz uzu 1zUEuh$hPJ&hh$@ Pttt-H / xjhJ&P 1UUuh$h@J&hh$ۡ B<t<tt> /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh$hJ&h{uh+$hJ&h|h$5 Fu#<u;FuFPh"#WS藖 @u612WSPFDPhÃVWSPFP Ã؍e[^_]UWVS}] uh3$hJ&huh?$hJ&hh$舠 GS8t)R78s<t<t1&vvRS Q6 e[^_]UWVS(uuh$h4J&h$FE<t<FVU1TF1 G!)JO9t跩 B@t8t}19sF8}Єɹy$At}!u}@]9s 8t1sG /^1ۀ=83uV}ع1E׈E83S}W=WV&thK$h4J&h'h$̞ 83؍e[^_]UVS]C<t<t輨 /g S؉U Y=83t1583S6Z;E thc$h$J&hnh$5 83Ǎe[^]UEU uh$hJ&huh}$hJ&hh$ fPUWVEu uh$hI&huh}$hI&hh$衝 fe^_]US K&tPh$H XZ]UWVSD1}]SZ@j0S1uuuu}WS1;5>&s/>&H>v !  DF1;5>&s/>&H>v  DFWS; 1҉u uSjE0EP%vƃ S2YEt 莦 0e[^_]UVSuEPu V uVj ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWh$Vu 1Íe[^_]UWVSU} u19s$@u9s8uh$hJ&hC؀xth۲$hJ&hh$苛 u1X9s%UjKQP+ t؋UGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`Pt}XZ- `S X4%@t _t^Fh"Py Yu$Ph $S @[< Ph$S @uWh!$S @dlhh$W诜 YZu@htDžphxDjVYZuGDžph+$W^ YZW Z|6h3$W7 ZYuDžphə$W ZYh"W ZYh$W ZYh"$W؛ ZYhr!WÛ ZYh$W讛 ZYuh$W虛 ZYpDžp Džp_t@F Ph@$SY @pJ&tPhM$S2 @84t pNdX"t $RhY$S @VL %t #Juc$Phj$S @ZvHhw$S @BFPPh$Sq @(v$h$SY @VʨPh$S=@~Pt?vtFQPhhtR@ttRh$S @~xu=4%@J1hI&tPŀ tXY#FxPh$S @uRz u RuARToX,QXtPZYX9Tth$S2 ZY@jjtP ƒ ttqXjjP X9u-BTX Ph]#SՏ @XjR뛉Xh$h]#S誏 @Xu^jPSj衦 @Dh$Wx ZYu-dX $"h$W: ZYhə$W% ZYh"W ZYhr!W ZYh$W ZYth"$W՗ Y_twpulelxOpu VZ;puh/hxDpjVpY_" $"Ph˳$S9 @WhԳ$S# @V2uZ%u6u_%u*Ph߳$S @ut:u%uȞ@t>(WtY%uPh$S @ubh$S_Z@Npubll@lq PVh $ST@d $h@pt!pNVh*$S 1huvh@Lt㋍hqPPVh $SN"@urpt)ptptVS,ZYpujlt l@u1d lqPVh*$SS@d*$QNppuA 8tV _yhpHpDVh*$S\!@WpCPh]#S @tXd 0uSBe SY^u hJ&蜛Z#_tFP`P u,hJ&lX_Džp؍e[^_]UVSË2;tPSd e[^]UWVSQ} utu=GL$t "Htr!}tE1@ۅt"a1ۃuZ xut@xt:HHu 1HH}tE-@uCt WhZt!CE}t+$EE@t]jW[^t WYuu"Ep}t3$Eƃuًt 8u1W Zt^}t8EgÃuˉ؍e[^_]UVS]u tPހ~t9ę :jh$Sk uSjS \ZY9rhX,b X1e[^]UWVSEE} u |UƃuhJ&Y[jh$Wݐ uu Ee[^_]E1҉UWPE Ph$EPFƃuuhJ&hoE"a jEPVw @u 脘 8thJ&h"&1ɉM^_EuƒutSP ZY} -];уM I+ѻ}hf"EPV ZY;tjh$SՉ ujh$S辉 uu1;}1u1;} uJulБ [EPjjjjjjS~R }tG,9uSv ZYEPjjjjjjS=R }u9G,nFul9 d!ukX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9!1E؉EErE,@x ' VuQ9uu "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms 蠏 7뎉ߋM_.MIE)M܋E9,}vb M}}9]ttC }Ut;]tC } t}E[^_]UWVS u }EEE]1EE9EEEPs2`K&`K&Csy7Ku-y)‹ P-DAt/rumr^s ‹ P-DA@t? t\tFx+B P-DAt/t U Uu=k܍ t#wȍ 7f\\Ev\0C0C0SEttNCEqt(tsExu EE [^_]UWVSÉ׉U.ƍPSlYZ@Wh]#SP| @}uSj=P _Z@u$p hG"S| @u@ s=Vu hV}^P~n sVu SA> _ s Vu SF=  u V* t.Vu PhV@Vh]#S?sh=#S,ZYsE1D0t<0u FuM )tSP Y_@u|u } 9K;} u@tPh %Sj 译 ^Z@u3tPh"Szz @G루tffPh %t&ffPh"S?z @c t Ph %@tPh"S z t%7荧Ph]#Sy @sWj.VWj tcVh]#Sy @tQ?tG UVShVu$D =tu11ƄVjkCXZtSWU YtVPLCXZ؍e[^]UWVSÉЍ4 1ɉt19r2 -}tJz}1҉A u1[^_]UWVuh$h4U&hօuh8$h4U&hh $z  xuxuP uf@ e^_]UWVS É։ Et A@E}xE)ȉE9|s'UWt[ZYtnt|UzuvRUY^U苃xt lj}t21MExzt1 jRՎXZȍe[^_]UWVSu诃  É֊B<t<<BfBt&U׉DRtĈY^Rt:S>uUWVC*P U[҃VSYm_Zu VSm[^tRXZR YtPt~rVS荌_Zu VSZYtX蝂 /1 莂 ؍e[^_]UWVS(E̋A tӉ΀ytuV xVx}WY@$1FCt}ЉF tCUfCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPEtZ_ZF tU tUԋECTt14~t n ho$EtņCTZYuՃe[^_]UWVS8t~ F1Dž@jB UPPe fDž ˉhPhiUpc UJ>r*hPhipc ,؍e[^_]UVS1ƅ@ CtDžC8P^CPƋƒYu9)Zu)CT@fCXP5_u tt uC| t Cxt(1ɉ,uCT1fDž @fp׉މ;tHH tut󥃅 TupVXZtHHt'CstHHt󥃅  t'CXsXtHH)fSP @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP&X@OHuWiSY1CPWPXZ$jjVSjLPW@uXx 8 넋H؉@D@9DDx9@sx DD9@r׉F u]dERuGu:Xu h(U&gwX?$RuSU ^_u1XZ]]V@UVSË%tJC><vBD&FTttT9t0t&NT9JTuu 转 뻋@À{>v P ShH$>c e[^]UWVSÉ։h,j9ZYt:PǀcScufǀ,1e[^_]UWVS0ÉRi^@u Ph`$XbY[.Gw*hH Phn$)b %th, Pj8XZt@dtVWv<u?(9x u1Wt cScuGhu @F @(GH>A<wO*󤋅% t&x utmtdf@ tStJSj@jPSV9Ѻrf‹fP@TȋG,CD7LJcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$tQ~DcScuHu ~<u|t2<t&)ڃ*f@6Vt4L7Pu"uJƃv9C,m@1;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃f9 ffC tHGY u<)9dCM A 󤋵 \ tC)9C= A󤋵 \tIt @W uD@Wt"@W uv tD)9UC< A 󤋽 \ttRC4%u+@t@Zu)؃fPhPƃ tt)߅tPjVPYY9qQS  C{fCWVY^g0Q COt/t+VM Z@)9 CKt tRG%t4@^u()؃ftC uO t>P)9rNC A 󤋵 \C))=+w/D@ Ph$EXE3 e[^_]UVS~\jhPF\ uF+X 8u!5l,hʷ$WY[ Sh@W&hoE"W 1ShjpK@uh@W&h^$sWXZ1e[^]UWVSE}uh׷$h$W&hh$hM Ӊ΋S IuN EEE싐%tZt Cts mjSu@ u3@C CXJP S@p@P& Z J(H J>r*󤋅uK%t9 t/hQQ@PPPB Ph$8B>u1DhQPB*PP Rh($RhV&.SXe[^_]UWVS$Ɖ1iu1h<$Rf,Xfth$SPGà 1GiPV RhS$ARh$SP6ÃuR 8t8iW VhoE"uR!w hV& Vhi$hR 1`64%@u"j5S,Y^@uƅS$Zu hV&QX뢍lj󤋅e[^_]UWVSS]Sj8^_t]u1ƀ8tCP<$Ztlje[^_]UWVS$ϋEE Eh$RJ ZYu}]ƅPE $#XۋuhV&PYuQVhRSV+<@t-P nPW XZuEV&e[^_]P1j6j4a@uƅw x, "j@,Ph@hW9u>mWPh "'mWPh "SVh$N$v "t&$u)lPWVh$`N(lPWSVh$6N ]e[^_]F*UWVS] PW&tPh" < XZE1E;s31;Et k, 9t@v 6h$; PV脹G,1;uts 3h$; PS^F,܍e[^_]UWVSEvpE E] P1}tEukSPh$u > @tBE^PkPh~$u= @t E9sT;] us< v!LN Juj T ZY@u؍CT9UbN "ujT ZY@te[^_]UWVS]u }~EHt t4PWhV)@uxVh]#S Ut"M QSj T ZY@tǃ7pjPh]#S< @tE)uSjS [^@u/M 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hpuԋ@E܋E E@_tE@o^'EPjyMԋU܋E 5^XtE5",EPhMԋU܋E Y[Eо$EU1҉Uw|MUu fX1E}UċM1uGEEPSsEPCPfEPC8PYSu谖 tEE99w< v lK YЍBEȉD9EMDK "1E )уȉEU@t~TCtE@Tt 1ɉMEPj!MԋU܋E XZt؋Euэ<1E9ECEtu !Xu EEU9t M;At;A u1EEIʸy,%=tс1utȉE@uFtEPVԡEPFPǡEPF8P躡Vu ]E@PEPjMԋU܋E Y^u1҉UU9u XEEPW-EPGP EPG8PWuj ]뤋E؋E%u3E @hu$uЋE Ph¸$PHE؁ Ee[^_]UWVS(}ƅj4uM{Y[@uƅEXuX uExlSePu h$u@ujuMH^Z@t'a1Pu h$u訡@u-S1PePu h $u}@ujuMZY@t,E#pVdPu h$u8@@ ؉PdPu h0$u@ut Ex,u@GhElPhhS>Su hH$u贠$@ut 1;j@E,Ph@hSSu hW$ud$@up;s VeC,X鋇@1ۋ;Ds V_PSh$AF0FH$7~@tFH$F0u*F8F4v$^PSh$PAdwjShֹ$bAF0 V8F0u0E1Em |0%}fE fEm}mE؉F8A9r=E1Em |0%}fE fEm}mE؉F8PSh$@ V4F0u0E1Em D0%}fE fEm}mE؉F4B9V8s=E1Em D0%}fE fEm}mE؉F4PSh5$d@ F0E؃>u,Vdt%F$;BuFhuP]uPShv$?v$]uPShv$?E苀4E%t*FH$h$WЦjE8~HuJFt.Fhu(VJ9Hu~<t>t FH$FH$>u FH$FH$~0uF8F4bWh6v4jE77Whv8jE7(Whv0jE7v8v4Sh$>$E䋀~@uH%u>ViRUShպ$>vvhUR7 @Uu Rh$>Y[^hE䋀t=W[2Zu[E苀8E%t]hC$F>jE,7 >vHW<7juWt(tFdFhӉe[^_]g_e[^_]g_UWVSPuE EtuVjj 6(tl%ub  CiP61V}@ t;{t5{<t/s$ZPF Ph$C=1ɺVjj51s p1C Cs`CCCC 1CCECHt V0Y1ɉKdChuṾXZs1CC C$Zue[^_]^e[^_]W|$wUWVStEUM]EEu\PK?_EPT%$uW&Ht :tRQE Ph$;1ۉ]EPLt @v@}GLih Eu>ZYEE1}m5l0%EPT%$uW&Ht :tSS$RQE Ph;$;MUEE@iEEE@ht 1ɉMExdtj$PuP% t؋E@$EtˋE@EPWS u{4%t Sh$5[^jWS t jP&ZYF MmFuWS uh$hV&h h$+  FdH PF )Ft'N V$vX]e[^_]e[^_]ËJh1ɺBUWVSËN t9At E9F$E;2U RPC Phʼ$4FiP3EUu~@u kUjRS EtjPn%XZESjjv,E%tBFHٙ$hٙ$S48%Y^ u-j,XZShjj+Ee[^_]UWVS(Ë4%Sjj+V BuB EjEPS u2N }vuu܍EPEPWS%BPt3t P)#usPP Sh޼$2SAXe[^_]UVSËu"jP%@uhV&h^$}1^_8u#ujh0j? @tER@Eu Ph1$114EPjE1҉PLp ' E1ɉH HEу tEe[^_] %EP E}GG tz@EjEPuuN cScu t(@u5 }}܉tt+@EE%tQN E1p p_EH p$pEE@@[xul(PVu EtUEHQMg}GYt0w NjME@}GUԉWdOhjE0;~XZ hV&/XE@ cSctP E1p p_EE%Ex0EPEiPE0莩 j Ɖ[ut8E@0E܋EU]܉]1ɉMЉ)ӉMԉ]؋]9]܋MЋ]}/E Ph?$O.Ep E1҉P PP$ )M}O0G4G8E@ uEEe[^_]cScuE% uϋE䋘g;^1CL%t%u0_uE Ph$-ZYƒ%t/s$$KPE Ph\$w-EEe[^_].C  cScs$JPE Phx$ -E1C<wPh*PBP谚 uhx  X\`\u TT1ҋTX#DT9 tj`9r7EHPh PhJ$ \X`#D`9  `T9`rj5dohYZ@u ƅo4\`%th Phѽ$)XZn o`< uBHvWdVh$WdVh$`  uWdVh.$uWdVh>$1CLDžXXX\Dpt;jXdhZYtWdVhP$.XXuDžX`m\@6@t:j6dth-ZY@uWdVh\$WdVh$!dhƃ tPh Phg$e(V; h4%u$hc$hCiPh0謢hhsPjhCPu CP+WdVh$;C@FC$CD1CPh Ph&$ e[^_]UWVSEˋu$v%6=PSE Phr$ e[^_]Í1ɉMw )؉E1MMىuEe[^_]FUWVS ƉUMBEϋttb9tYtO8tJ9xTuEC><wPC*PEP% u%C PF Ph$euMU[뚍e[^_]UWVS8EE] }uPYt99s&}E EE V&EĿ$e[^_]|)WPS胼 nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉgfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMк EUfҋEftux;PE Ph$#(fEfu)T3EPE Xe[^_]UWVS$}E ^\ftPh0W&h8$ cCubh$RS u#>t=G Ph0W&hoE"_WsPRWt^\ue[^_]UWVSE 0xjPuq* uEV&e[^_]ËOwv>:Pw Sh$<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhW&h8$ t @`jVP u hW&YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuVXt,swsos g \SVtttt:uj@苃t$P能ǃ tPeǃY1Ze[^]W|$wUWVS tu}P.YUK>vuu{(Ofu  tu%ue[^_]g_hd ƉE1Em5l0%RR$C Ph#$Sh VjN(e[^_]g_UVS]Sh jVt~ht j3gXZe[^]UWVS E} wLBuB9{d4G PuF PhG$yVR1Cdhٙ$V|V GunC t{@;GusP5PF Phh$%t VXE@hu5jZt9^duFh1Fd뮉e[^_]UVPuu,jy^uEhW& YE1҉@uUWVS]} SE^uhW& %t Et09Pt jPoXZjWSk ƅu&j4Xt^FFF`EF EFE0pE7Q*N }WPh$jQM E0.* X#C$Mt!PWQ Sh$@ Vj豕@u, 8thW&h$ Y[FtVZ1Ft1E@F0Epe[^_]UWVSQ]tdue%u=t-htGdt jPXZj3ZY^wHSr j3vZXZ1GdEw$jVS t'W(9P uW,9Pu PC Ph$! 5w8w0G,PG(PVSu 8t둋AhAdjVSh ƅu Sh$K ]}tEW$9Pt jP(YXwdGhj3YXZ?uwHSq3 e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mutu |RP*EZYhPaXu KUjWuR Ã}Ut} tuMUj4XۋUuEW&e[^_] ECCC 1ɉK BCZ;C t/C 67'VPh$jC PH }t EC1CECcHwnEE] Ee[^_]CtNt;C uCECKtHJSHwuSjà ]e[^_]e[^_]UWVSut=t7;Ct+ PjCPC PSF PtjR$ōe[^_]USEt6t,ttHJHPX]]y]UWU@Euu肏 Y_}UWVSQƉ uXӸX&ljUX&9r 9EsҸX&ljUX&~9M9 uZ[^_]UWVShPLufJ}xv #htAEH@‹EEhЍHdfhdZh$hPh藁Ëh 8 8thX&h$XZh?w8j@Zh_uhX&^Lhǀ@hO @uhShS =wPƄ ƄPPhh$hT@u$hX&h$h1҉Y[hCjydwZXETE`\fu `\\@)ЉD 7RP*RuM UuU]UWSU v{ 11}}u1X&M[_]UWVSUt΀yv  u1y tËAdr@t$tt @$u@hO$uX؋U-ÅtF PSYFP}WWCPYFd@t KthdR' u} WC8P}Y_XC9@VCXPhYZY؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PV"LXZ?1e[^_]UWVSQEp1҃t<t 19sDB]۹yAt}u1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}EEEHfw EHfvP Ef9EEEM) u k@w ¸ w w w ?w xK9~% "}u1EEf}tdf}@~9f}? t1҉EUE) t1$t@E) t1u}11ErEUEa ׋UM U MEREC1[^_]UWVS}E uuGd((*1ۃ t%jPG@Pm ut #wdۉ؍e[^_]UWVSu }WVuw)WVu(pttSHIH9JHs؍e[^_]UVS]CtP[V SjjV]e[^]UWVSuFhPF Ph~$,Vj@u3 81t) 8t 8t 8t hX&.XF@t>jVC@PHl ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjSu'ƒ ujjS0n ]UWVS} uEtMtGu{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVSu 1ۉ]]]EdߋGdEuu;tGu}묋WtSWuJMQ1ɉ uHJt6GuCu;W_IuWYUOuUJOUjW@R06 t)G9Au!%uFEPQXZ8MWG E1҉UE܃YtMuW Xe[^_]UWVS} Et0t[uvtCPEP_ZY@t/C@3#Eu%CD3G#EuCH3G#EuCL3G #Eu붉e[^_]UVSEt0t.ttju CPPjd t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j|ZuhHX&YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZfECCdUSǃt_{ u Pu uƍS@ C t@sdKQPuR@u{ s{ u @t{ u j.EPC G{@u RURY^@s@t~{ 1UĊ  L @uj.EPC@Pj* tJSRPh$j.ChP jC@Pu t @`C`KdK`C`uKd h8X&SXZ1ۉ؍e[^_]UWVS EEE EEU}uM M܋M$MM(M؅uE苀t2RP EY[EujZEԋEt?jWC@P_a u(EC`}}StP뽃}}WSjVWueP|@u 1C$C {4s(EC`1E@CEX}CPt Nju tR'CdEt CdtS` ttSX{@t4E胠4uSuu!uSuu}uLSYMCAe[^_]UUjPR 1t!hRu hT$uItUE1҅t%tHd((uH`ۉ]UVS]u!uu1҃jPS, t8Hu@`tFP^jRPStk1ɉJHB1Hd@ @$ǀ9jPj3w=uh+$SUXZЍe[^]UWVS]C$t1jjSP u苃%uuS^u묉%u^f{(uGC>Pu<{*VhX&WQ] tVhX&W>] u C 3 VEuU1Ejj@VSHƃ@$@ 1ɉMH P@%t<u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV V8FHtV FHE88V 1ZMjG@PRU[ U܋Mt?uRG`t%tEGhPG Phf$VCg sj.FhPRj# 1E@F0EpjV@e[^_]UWVS]} FtHtJN HPZڅt0jjjVtEE Ee[^_]9jjjVVd1SjjX$e[^_]US]-XE]UWVSQEv, E 81ۅEjG@PE@PY tGd(1E@`G`}u!GdtGhPuG Ph$IG` ttGd uCtWZOd }u/GdOdt OtHU JOWX}3u1ۉ؍e[^_]UWVSQu E@EhE@PE Pu[ǀU@4uUr4{(s41ҋECEH$Q+B9sȉC$}O : v: K vu9F sz SEZ11BCZ؍e[^_]UVSÉփhPC Ph$zVSt VPZY htX&Xe[^]US ]SjڋEXZ]UWVS Et_uVjXXZ؅tt8;Cdt,} PjCPPCP@SF PtjR $če[^_]UWVSEttBu[0tFd%=u1҉vt Pu 0Y_6ϋEu@EtE #1B*Et E @ tt^tTCƅtDGPEPh9WRV =EPFP_t @ FUMvj±ZYUt0Mt&@}wFH r*NjM;jC 1CUe[^_]W|$wUWVS %ue[^_]g_ho% ƉE1Em5l0%RR$C Ph$Sh,bVj(e[^_]g_UU t,t9PuƀRhhjjUUу1t3wt-tRhY&hJ$ UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`PEF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS<1ۉ]]]E1u1EEE9CEׄCdKTMЅtYURQP藘 t t0u5CPE Phd$1ɉKd EEt9sEsxF URV4RP% t tlVdtRNhv$t $QPF Ph{$aVja@u 81t 8t hlY&KZ1F$F fdEt9sE6NEtXMPF$Pvu t t1F0PC Ph$ NtHVujuPECPEЋCL }ffMM9Ms KMɉMM̃щu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u%}uƃEă}v1ɺ1]/tuh3eWjEH}t?E Ph$HEESjE0#h3$u<e[^_]UUt&t9PutƀU]\]UWVS}u1-0t9~t6^xtuu S0 u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EEP 1ZYtU9pu 1ɺPGEttu4@t$Plvǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`u @tײy1҉[]UWVS@EPjoE _X1EE 9CEuh$j uV CPVh$u+ @ursXsTVh$u+@tuuVh$u+@tCtPVh$u+@tC`PC`^E'!uE5"f!t 5"Au#M" u5"_A#@u5"5"y,"uRWVQuVh $u+ @&sdVh$u+@ C1C;s WJF,Z拀H1C;Ls WJF,XCPECLE}EfE9Es SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhQZPB PEPu2XG UU)U-sx1t8Fd%u'~ t!GFhPWEPh-$u)@6ċ<e[^_]UVSu Ft%tF9CuuVCxPusݍe[^]UVS]Sjjf1҅t#09XuƀلtKj3%Y^u=t h3$S5XZe[^]UWVS] 31<t0h$xNj 󥊅zp 0h$%11Ҁ+u8B,CdtG{$tA1ɉڋ8u.ڋ8ChP0h$Z1s$ )t1ɉEP8Q )xdu+81҉EP8V2H4818EP8V2p*v>xdu"t0h$ֿ *?)t49$8xdt⋅4t4^u0h($eY[+(뗋4t=4O8xPc4j40 8Y4jj48jj4 Z8@`y *t[j@t/*tJj4>^_@u80hR$耾Y[$*0hb$XZ4e[^_]UWVSp]U Dž 11DžDžDž0ftRhY&h8$趽 jWV^ u hY&|YWSXZe[^_]US]jjS u"C Ph$μSh#cS]É]]xUWVSPu} UUjWC P, Utۀ8$uu%UPCPC Ph$OCjV UuDt&9tH9Kut倸u܃xdtCEe[^_]e[^_]US]Sh#cj7Sh,bj" Sh?`j ]ú[&Jt f9tUWVSEU MftEv0f9s˻ 1&f9u}tMf9)裻 [^_]UWVSEu} tRU w p 'fɋ] ] +39sG "1?fҋu1҉]19tu692uA,t[^_]UWVS8EċEȸ uѸ-URj uQЉƃuEfǀ<论 GfEfwEă Ph$WY[f>ff}fuEfǀ<c 1҉1ЉЃEu.Ef}w p[&Ph$j ]S蓥 1:BUP_XۋUuh[&賹XߋMDڸuf}f9<t >Mčq RVh%$PeS联Ef]f<藹 18f}uVh:$Ƹ}ȃltR'Y[Eċ4%tj貱XZE΍e[^_]UWVSSƋ1;,k(f{u{u4{u.{ t&{u&{ u {u{ue{u{tYCUhPCPVUt1ǀ" Kf1ɉHGEe[^_]UWVShEwP EdEEEE@|tXdÀuXdBEAE1ɉMM}qEf9UrZ9]s#̷ E PhW$職XZ0u<}])Ӎ{}ff}ftftfu f9s#c E Phk$_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSP% UtGF΅uE4%@u+j EPjEPCtPE Ph$f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPsuSVPE Ph$(g1ủuEEPM1ҋEJE[tE2Eƀ>#f}uEȅWeEEEPjuWƃUЍ M))Ufw#迵 E Ph$tZYEܹEȉEUʉU9s'| uuE Ph$qEX|ۍEjPSs uCduCdcd{4u EC$U9S tKdS C E}}uuE Ph $g f}t2}O`MQ9rG`E̅tMqduV9rAdE}E؉E};aV}9GhUGhMjhPu~ǀ"EfEĉ{(u 1ECEEe[^_]UWVSljUMu w@ Ph5$蝳 1҉u1ɋUYtx E1ɉKhKdK`ǃu uVjXZƃ>VuMUZYuC;u}tG PhP$[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]讲 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύK G=DQwWF(1RPQhq$蕱~(WQh$ EPjSuuAtBf}u;8σ G=DQwWF,1RPSh$;~,WSh$諱 e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@$}tQuЋE؃ Ph$u18ujjE؋ EPj躐$Y&8u ǃ8$EPj s@s<Qtf}uʁXsXS`1CdChǃJ8u ǃ8$8u ǃ8 $8u ǃ8$8u ǃ8${`tts|C`t}t8sLCDCLCHCPCFd rFV t#tFhPF Ph$般 1F$upFhPF Pht$葬 Vd s"1F$F VjjF٤-NtHN rVXV蓮YHE؍p C`;u PVh$MuVh$,KdSh tRQPVh$u/)uVh$u RVhD$ujE0XZ}uA}t;WVhպ$hsHsDhWE0& @u Wh$诫_XE؋_|tACdƒ t ujC@Ps? tKd Cd uVh$h8u E0 E؋4u$}؋t%uj謣Y[XZ믍e[^_]g_W|$wUWVS,(h1Džh#fDžBDž<"#K8Qff@98tB9rIpr@uHtHu f$8,nt104tj g0\ZYHu" t\10fDž$H8% t#j@wP?(| @p|1(Hx@1NjDC buy(u4tƅ,18$|Dp<@D&v P PhH$ DP4BnFDFLVHVP1ɉNDNHt hљ$SXZP3c SjjMw0%t11҉SY2~Dt h$SPXZu Sh$M1ZYe[^]US]?S Rh$P* ؋]US]C Ph$XZ؋]US]?S Rh,$PŐ ؋][US]Sh|jƉC PhQ$蟑؋]US]?S Rhj$PJShZje1҉؋]UWVSƋu5h<$苐f,XfthWPR2 8PV RhS$EhWP6 Z4%@"PPR @ {TWjpj u +)CTSXWjKZY@KhtD1+9}F Ph?$Y_DsDjbCD_Zu hTZ&UY#Nj󤋅CH_1҉tjhj|P蠗P6~ sDj1CDCH e[^_]UWVS] E1E;s31;Et k,9 t@v 6h${ PVFG,1;uts 3h$g{ PS F,܍e[^_]UE@|tPd(t1]USEu1X|tuu Sp u؋]UVSEt0t-uvX|tuu S( u1ۉ؍e[^]1UWVS} 7G@4j.DSFPj>4wSh$`)}tE@<"jWu胚< u h([&iG8@Pj48PNj<% tj<01ɉ,0,;(⋍(tx}HlaDP< Ph$<;8BPj48ƅ0tfBu0S@tWC<8uOBQjRPDt8fBu.08r$PDP< Ph%$648$*_Z@uVh@Z&hoE"P 0SShQj jw؍e[^_]fe[^_]UVS]u tvwt>sunu StHuZ%uGjSƬY^u9ϋt# w~tn0ueeu1t1%thDjVYZ@(@,1҉P|P|10fǀ<fǀ?SjhPsjjS襂u"C Ph`$]~ShS詉FSX:Ѝe[^]UEtQw]UM E]UWVS É։M苐t 48UMtSjjPMv u EU S蛀Zt~8 1pp@1x xx$3@u Sh,Z&hoE"h}:SY(h$SXZP3YXt jjV|P蛅t j3XZwLXGDGLWHWP1҉WDWHYt=t8E%Uu=t}uE$uSrZYwLWw4WwPhA$d YX؃t w t u F17tA9MuuUM7Ph %{d XZUM΃`Ѝe[^_]Uh,hE$j] 33t9W|$wUWVS31B31x,% @5f@6 s f3.s f3P s1f3f p3f 335 1s33 ut/33 33 3f31=,Of33ff3f3=3tjVEȣ3Eȣ3ZY,XT3 5X3U1E3]5\3`3jhT355[ƃ x9u h$XVS53h$[b @6Hujh,js 33󥸤33 3u3󥺼335|,=,u؉}mrq,E؉ 33 33E33=ɚ;~ 33-ʚ;3330%we[^_]g_UWVS4ƉU)'h<$@a Y>^ h@$-FfVRVRPWSPhZ$` j.]SFPj诫uj.h!S,[ Sh|$` j.SFPjuj.h!SZ S蝧F^(ZU)ڃ<,wJ<w1tR<CSPSPh$<+h$"<:tI<$!jEPjuafEfPh`$^ uPh$^ xe[^_]UEtuD3@D3 H3@H3]UB6Pjjhh@3jRIu@3!UWVSE93t+9tOhh-$uP! =v3Chh-$u/! =#CC$CC(=L 9mA6qPhf$V $1\jhPPZYtuxtA6Qh$,A65PPWh$l ރ w1Ét7t1z)uz/uuB 0@u1L 9rh$Z~)tD 9rA΋u7~.ƒ  ˆtыTHT<&h$!l T@f8f;3 TfHf38@3x,=3T@ȉ1T@ ʋp)Љpyhl@Bphl+hl݅ ڽp߭܍ 3vٞv؋8353333p,vp,3v 3 @5Ѓt383 Ј@5@6 tjh,jݝ8P PWh$vS 0h%$fS A6݅8tS؍1fDžF 󥍅Ph.$ S [^݅8=3tQQ$h6$R ؃t hD$R ZT\1NjH9s:3@8t!t\SQRhK$R  B뺉 \ <jh3T Ps 8iT@f0f3C3@5s33 ڈ@5@6 P9PWh#Q T@‰ffP ft2ftGfTffRPh$TfPh|$ TfPh$o h$Q ^A6^ TXGTWhj.VSj蟛VT@4]&h$P T@f0fftf_feh$Txh$NP XA6tET@th$h$'P X%818ߋ0fPH9?H)T@uC=wtvh|j#i f9ff0P=v 101P 9 7ȋ8 8ԋTp_A6t3t uh$h%N XT@t hE$N X 3 h$ƕY1H1ۃHu ˃j.RVjKuj.h!RH Ph~$EN XZHuu h#$+N Y Sh/$N XZ eTp\G뉅PT@O9u~TX\H9s&# P-DQt$RPM CYXDž8\P9H0sZPh5"h$bM H9\saTHSH\Zuh|j#!M [.8utST YƄ0\xA61h#L T@Z<t"<t%T@02h%h$L X~^T@0j,K XT@uFSh8$`L [_8uD\9Huj,aK hj$6L _X)syShK$ShZ$j,+K ha$L T@ZY9Ptj,K PT@Phr$K A6P(PWh#K T <x2<w><tG<T@8Ph$P $@\&<uT@<w*$t\&h$Bh$;h$4hƙ#-h#&Ph$,T@t <uh_#h/$^ PhE$J Y[THLhb$J T@Z<t%w uhv$<uh$h$mJ _h$Ph$XJ [^T@8Ph$:J THmh$h$h$h$h-$h$h;$hP$vhf$lh}$Аj.STPj{uj.h!SC Sh$I j.STPjEuj.h!SC Sh$h$AI hf"7I T@f8fZYfw2$\&h$h$h$h$h$h$}9Huh$nh $h$H S1ɋHU t Shߑ#h$$&uj.VSjCh.$VH [h8$FH hf"1e[^_]UPEPhh!6h%6uƒ1uEUWVS} uHu7uuW1ɋUà =%6u u1Ɖ>1e[^_]UPEPhh!6h%6uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ`"߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס&6EС\&6E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU6 $URj$W~6 $WjVm6 $Vj$SY6 ZE] Ee[^_]UVS@ÉjjjQjRP tN9tLtHVP ZY@u:A j@]S0N h?"Sh:$P,=&6t. 1e[^]UWVSSÃ=D&6tO1t l&6<!j@wơl&6!p&6)Y9sRUwD&6Z9Uu)@uÅu,&6!1ɉ1ƅtÉ5,&6(&61e[^_]USX?,&69(&6r,&6É,&6 4t1[]À=&6UVSh5"h5"h5"h_$,h5"h?"hZ!h$,, f!=&6tM"n$=&6te$ZC"=&6tPC"QRPh$Ӌ5,=#=&6tY$W#=&6tLe$iB"=&6tX!\$=&6t%SQRP֋,U㡠&6h5"h?"Ph$Ӌ, Uh5"h?"Ph$Ӌ,Ux&6ih5"h?"Ph$Ӌ, U|&6Ah5"h?"Ph$Ӌ,Up&6h5"h5"Ph$Ӌ, U㡨,h5"h#Ph$h5"h5"h5"h$, e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSS&6&6&6k(0h`&@P^ 1ۉ^,&6~0XY1;&6s6U1h`&GP/ KGU C(XYk(|0&6&69subC[^]á &6uÀ=&6>UWVS9< 0DžDžDžjjPh&6jSu@u &6O &6P&61 @H&6hSh1$ tƄ181ƅGhB$ Xtq uʊt͍B<9;$^&&6R&6F&6:&6.&6"&6,&6B9H,@,&6&6,H,&6J9@,,H,&6J9~}@,u&6l&6c&6Z&6Q&6H&6?&66&6-ƅ hI"RhQ$P,C&6n39 0=&6t hzz# Y,9,},=,‰|&6 &6 &6s5&6&6&6)I &6x&6H t&6tH &6 ,p&6Xl&6 h&6Ɖ5d&65`&6#&6tA `&65`&6)\&6=&6t*1҉j Ph !m h `&hL&6 jnH&6D&6@&6h `&h0&6 11$&6&6}ã &6u&&6 1t&61e[^_]1À=&6u1á$&6u $&6UWVS@É;H&6;@&6jm¡@&6_9u739u0PmY;@&6u;D&6)D&6@&6jVS 19Z;P p&6PPh0&6! =p&6XZVS~ Y_@u:7 j@}W0 h?"Wh:$P,=&6t 95p&6u"tX p&6PPh0&6 XZe[^_]UWVSEЉʋl&6!Ë &6)){ MA L>D=&6tMjRP M95`&6sxu@)lj|| >;d&6Fs"J| u| | DT>| T 9Ss$EExSW ED CSW ;sss{uISC P XZ=&6uE@,t p&6EX,p&6؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC &6‰ى[^_]UWVS¡l&6!9t> &6)su܋tu 9t)D @!u܋D UEPhL&6| @ZYe[^_]UWVSQӋl&6!‹ &6)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋l&6!9_C E؋ &6E)puЋ|&6Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w _&w)_&w^&1;SsS |C@C;Fu ;u1ɉHt SFP0 XZN]H9t9sxt PFP  Y_SV XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPhL&6o PhL&6 =&6t KZ{ SC $&6$&6e[^_]UWVS9p&6tp&69kjjh0&6 ǃ t؋_ jWh0&6 EWh0&6  $&6=$&6;H&6r;@&6rw1ɉ Åuj}먋 h&61ÅuP=D&6@u1jgNjl&6!‰)[9tPgD&6Y9uō3@&6t]EPh0&6 XZt>G 9r7 39s0jWh0&6 EWh0&6. $&6=$&6}뾉؍e[^_]UWVSÉU &6EC1t}9xts@Ƌuzơd&6EF}}1U9sK)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=,H9s?MjB,@Pr( Mu e[^_]C(S,z{,f P{<t[FL-01=,H9s H-29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)E ,HuVQM t uMQ ZU9ufG}uf 1e[^_]UVSË@9r{uC&6C&6KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uC&6C&6[^]èu'B P-fAf'f` ЃðUS1u4u& ZYuCC u1]UUE ft҉Uu&]1]UWVS É1=,H9s33C8C,EL-EH-E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh5$V u 1ɺjh<$V u1ɺmS j@B@Pr R u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3KP-9)BC9S9{uC&6C&6S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uC&6C&6{uC&6C&68Dz@U׉DRO^fE11=,H9}"uQMBZYMt UGjE@$E@PEp  u j}G W$JO$f4PY{uC&6C&6EH9G8:>x]49r{uC&6C&6<]t<-u{uC&6C&6=ȋUC9r{uC&6C&6S9sH9s8=ux]u {C~8-P9x]x-t  -f9=,f9~0{uC &6C&6f9UG1=,H9|f9jE@4E@PEp0 u MA0Q4f8fpBQ4EV~{uC &6C&61E, U%Gu48-u@-U;Cr{uC P8]u &6C&6{ Ex8tC @tEH,E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0tEp i1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF P-f tNt L- t< H-ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uC&6C&6Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC &6C&6{ &6щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6JP-DJt%9~{uC &6C&6PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC &6C&6 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uC&6C&62SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $u&^[m\p{|;{r{uC&6C&6S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)u&6C&6 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uC&6C&6Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx P-Dyu@<,t<{uC C&6&6}{uC &6}~{u9C 0@}t{tE&6C&6+uN+ue&6C&6-&6C&6C &6C&6+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJP-DJt%9~{uC &6C&6PSY9s8}u @48}t#@9r{uC &6C&6 {9s9r։v!?t{u#P9sPP-DPt o1e[^_]UWVS} U0E tEp9) W [jLYt3SUUw$@@EjP|1҉UYZuSX ]lp1tEEU1}EuW5w%DžhI%1911h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9YP-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋP-DJ<_P-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,P-DJu _9wu G9w NDJ_9< u AЋ P-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h$NC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV` uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tPP-1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡP-f}UfMQPf_tIf}tAf}uf})E@P-Buf}_uڻzf}P-EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY P-E@Af}_ fE@Af}_ 8uY8EP-DBuf}_f}u7EP-DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} P-1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9YP-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋP-DJ<_P-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,P-DJu _9wu G9w NDJ_9< u AЋ P-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h$NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVO uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRU J UuEEf u@EuLft:f} upucp(fE}Rf}tTP-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRUjF tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} P-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU,B UuEEf u@EuLft:f} upucp(fE}Rf}tTP-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU> tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} P-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9YP-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋP-DJ<_P-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,P-DJu _9wu G9w NDJ_9< u AЋ P-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h$NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV6 uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=,lt1ۉ]tMEAEW軹 YE}M9M) N,F4EF8EtwF}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$)U6DžDžDžDžDžUE@fE@fMIL$D$ *D$D$$ʒt$ ?D$D$ 4$覒EDžDžDžUE@MIMI Ɖ ȉ } Dž UE$eD$D$Ɖ$衍 D$:4$Fg Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%KwҋSV9s%u9sF?V?4 r9i_oJ,NN9sVu鋽D$ QD$D$$<V9sNu鋽E@D$ ?D$D$$ȏ^V9sNu鋽*N9sVu鋽,NN9sVu,NN9sVu=Ex1i @Uዕt9,NN9sVu,NN9sVu y,NV9sFu鋽Dž6pS,NV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ 6D$D$ $辌ȄLN9sVu鋽AD$AD$AD$D$ 7D$D$ $/lBD$D$hBD$D$ \7멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ 7D$D$ $'dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ p8D$D$ $YN9sVu鋽N9sVu鋽}nȉN9sVu(@D$ ?D$D$ $lN9sVuA D$A D$AD$ 9D$D$${V9sNu7@D$ ?D$D$ ${N9sVuD$ ?D$D$ $N9sVuZD$D$D$D$ D$T$U$Ct"N9sVuEDžDžDžD$D$ D$D$ D$L$U$stN9sVu*})mUE@D$ 0D$D$$_EDžDžDžDž DžUyzUWVStN sU11 rEEEEEEEEEH>U DEED$ED$$P:U}ĉ|$T$E$N ƃtdE$Տ ƃt'D$ED$$91҃ډ蚙 MD$|$E$ y Mo 8D$ED$$9M 8t[^_]< UWVSP Dž/devDž/XtyDžyXXD$T$S:t-ƍD$D$FtH4$2~ 4$;D$D$ D$D$y$O@DžDp90ƅpD$D$<$s9ƅtxgL$D$<$=uD$<$=tg$9nC~ P [^_]c 8u)΃wΉ<$:uD$D$<$8`S9EE ut|$E$[Ut#ED$D$ $AEtED$D$gt ${ 1P [^_] fDžUVS -ED$ED$ E D$ED$E$tK* ƃt?uE$L8E$c8[^]ËEUE$%8[^]þ[^]UVS p ÕLi- ;l D$D$L$y t@l $ ǃl L$7ǃLƃl 1 [^]& 0ǃl L$[7ǃLƃl t 0ǃl L$ 7ǃLƃl 贔 UWVS<T yuD$/4$TU D$@4$5ƃ%D$T$$a5+ 4$j6Ƅ=D$D$D$D$ D$D$ D$$g tVuw: ul<[^_]Àl uMC, Ɖt$ D$ ]D$D$4$~=M ?l 5 UVS uL 3D$/4$S "Lt$l $@ * l D$D$L$v BD$ D$D$L$w !Ѓl D$YD$L$r1[^]YLRD$D$%@4$b3LD$t$l $x v* Ɖt$ D$ ]D$D$4$|=耑 ?)qi$2{tƃL YT 8#t@ 0z4 04$ƃt UE$]fffUWVS ƒE@ E։υEE y ]]U ] }ED$D$ $D$s&ЉM;MM }$UM T$L$ U$D$=&ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSP$ ID$T$|$$|$D$$nD$,H*)R)L$L$|$}<$mteEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8C `}܉E؉UȋP-8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,}L-UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$] 1E܍ f'D$D$EЉ$] t#tWuՉD$EЉ$]誃 u݋FV }؉WF2}S1}؉}+E܍,}̉nD$EЉ$]C tu}܍8cD$EЉ$ K,rD$EЉ$] Hu݋E܍L}ȉ{D$EЉ$]迂 u݋}Љ<$]p~ |?sE܍LD$EЉ$]v uE}u8}DGt.E܍D$EЉ$]4 u1ۋEЉ t.u}.E}Q} auD$EЉ$]襁 usu̅u#D$EЉ$]n uݸUWVS脿 éƋ'<'wwEVN)щȉMEED$$_t_FMȉFD$F$_t:F]؉F>FDF 1[^_]ÿ'E {UWVS蹾 ։D$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PbD$LD$T>c\$XD$Xtt$T=qw 9VD$Lt$Xtt$T=qw 9VtD|$P\$XL$HD$TD$dU ID$Tb\$XL$Hrl\fT$X)Ћ$‹RD$\T$`F3WUD$|t$xt$X$1V\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$`$$`D$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$lg0lPT$|@A$D$\T$`AQ T$TeD$T!c\$XL$XD$|)ЉD$|$)ى$lgiLbtсqw 9V e;$rD$DD$|PT$|X$A$D$\T$`AQ LeD$T\$XL$HƉL$HD$|;$rD$DaD$|l\PT$|X$P$T$dL$hPH LeD$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$lgE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$Kl\^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$Xl\D$|PT$|t$Xp$B$\$dt$hZr D$XLeD$PacD$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$Pi $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PHD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P\VD$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$Pg WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$<]EuFt7>t ] 1uUT$$]A:tFuɿ [^_]UWVS賑 \t: >t M1uU T$$9tFu̿[^_]UWVSL q\pt:l>t M1uU T$$s9tFu̿[^_]UWVS \E $xƋE%EE*UuUT$$I…plU>t M1uUT$$8t1FűuUEEu54$C4E [^_]ËUt }1]uЋu9t!$UM D$UT$4$ E0E렃}tE1҉UWVS譏 Zu Ex}u 4t+D$4$7uE)E@ [^_]Ëp t 1[^_]Ét$HhD$$UWVS# HZE D$E$P>X D$ED$4$NjE8tBX 8"tnxp uOt$ E D$.D$$҉[^_]W 8"u썇v£뱋p t[^_]ÍvҋE D$D$$UVS& KYuF$+2F $ 24$2[^]UWVS YE 1t 8u$Q)E]M $ONjExlD$4$B-MA XEU PM*EED$<$Dž?nED$=<$N HE u M D$<$T5uM+E UR V tMV}9~t!Љ1OMV}9~u oSEK1ɋE gp t&}G$z0<$r01ɉME[^_]É|$HhD$$$@0̉<$60E$+0뷐UWVS8 #Wu2U D$GD$4$ uD$:4$ DžD$?5D$4$hF$I $&D$$ZD$D$|$ D$D$dh4$3$&AD$D$|$ D$D$4$w3G|$$Hƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $8  $D$$K |$$ƅOD$E D$ ED$D$$$MD$E$=PtD$$0V}$g-$Y-}R 8[^_]À>/uEt$D$<$ t'D$<$^'R 8E D$t$E$,9 }8[^_]ËE D$D$E$9 E D$D$D$ ED$D$lh$1BE D$t$E$ gjQ E D$MD$E$j8 Dž1D$ mD$E D$E$|<Dž1`P E D$MD$E$7 10$P t$ gD$E D$E$;<$1hD$E$M;D$/4$ FP E D$T9D$E$F7 DžDžkP E D$O E D$US(} âQEEED$D$ED$ ED$D$E$.x E([]øUS( 6QEE>ED$D$ED$ ED$D$E$.x E([]øUS(襅 PD$ D$$?D$D$D$D$D$ D$D$D$D$ $.x D$([]øUS, QPED$D$ ED$ED$$2x E[]øUSӄ OE$=4U趄 OU\t \]Í\]UWVS耄 åO}|$E D$E$4 9s [^_]M ?|$ t$t9D$$\[^_]UWVS 4O}|$E D$E$M 9s [^_]M ?|$ t$9D$$\[^_]US 蠃 NE$3t []ÉET$$\EUS Z NE D$E$ct []ÉET$$\EUVS 1Nu4$t[^]ÅtEt$T$$\EUWVS軂 Mu} |$4$Z"t[^_]ÅttE|$ t$9T$$\EUVS[ ÀMu t$E$#t[^]ÅtEt$T$$\EUWVS (M}|$E D$E$A7 u[^_]ÉK 0|$ E D$:D$$\[^_]UVS蘁 ýLuE D$4$:t[^]ÉEt$۲T$$\E[^]USA fLED$E D$E$}uET$$\E[]US LED$E D$E$G}uET$$\E[]UWVS$虀 þKD$ D$EUD$T$EUD$ T$E D$D$E$n Ɖ׋D$ u $[^_]zI L$ EUD$T$EUD$T$E D$ ED$,:D$$\$[^_]UWVS$ JD$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]H L$ EUD$T$EUD$T$E D$ ED$|:D$$\$[^_]U @JU!thፀ]Í]ÍQ]Í@]Í]Í^b]ÍT]Íٓ]Í5]ÍT]Ís2]Í5]ÍK]Í]ÍT]Í]Í]Í]Í1]Í5]ÍT]Í5]Í]Í<$1~F [^_]D$$1ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVSTX| GE}>11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<]+E E;EriEE؅eEU9s UEUȃE9sv ED#UȅtEDgET[^_]ËU#EE%ju}ču܋EU$T$?uẼƉE wt ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EyUE9U9v UD#Eȃv UDEȅUDwMaEEEE}ωu΀FE:j=*}_]̋MEU$T$ڋ}i]EE߉]̃{u]bO?_]̋EЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?~w<@p]fEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEf@E%#jxE%#joEUE_]̀}FGG9U}1 CEt'E;Es MĈEEU̍JMu܉E }EEEv_]̀}fGU}1 HE;Es U=E]̃EQpEЋU t1҉EU<@GE̋E"0]̉EUD$EUD$ T$ED$E D$E$p]fffUVSu @uED$ ED$E D$4$ *D$ED$4$U[^]UWVS4ru ×@UEzlj(aED$/<$N t<|$iwD$ED$ ED$ED$4$/4[^_]ËE AAE|$ED$ED$D$ED$ ED$ED$4$u= 8upED$ |$ED$ED$D$ED$ ED$ED$4$|M= 8u 6ELb= 8t ED$|$ED$ED$ ED$ED$4$=  = USs >EU MÀ]]] ]][] USEU M]]]] ]][]fffUWVStNs s>D$L$<$# t$bD$<$ 1 Dt$D$$ ũED$ D$D$$1'rt>: UWVSp <D$ED$$t{NjE88/tbD$/4$ …tL)JBU=wsG|wdD$}|$M$ Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVSo :}UtlƍxD$4$( tD%=`u'6$U tĄ[^_]8 O1Ą[^_]8 1UWVS/o T:}U)tlƍxD$4$聦 tD%= u'AA$U tĄ[^_]7 O1Ą[^_]7 1US(n ò9EEED$D$ED$ ED$D$E$x E([]øUEM tP8u ߉P81]à ]UWVS m 9}tc$ >UT$U T$$nƅt/tV$" uDt$D$<$MƉ [^_]ÍD$$u [^_]U 7m `8U T$UT$M6$]U EtUT$U T$$]ø]US l 7E D$E$`=u$ED$ED$M6$ []øUVS l é7uED$E D$4$x=uED$ED$4$H [^]øUWVSL/l T7E uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$#EPU@E)99}W~E}ủuĉMEU1NjEĉD$ t$EȉD$E$qE9}u֋UȋED$T$E$J<E$e1L[^_]€,6Eԋ U2bL[^_]UVS4j 6uЉt$E $^ED$t$E$y4[^]U j 5U T$UT$M6$D]UWVSoj Ô5uEE}ED$E D$4$Z;t}EE u[^_][^_]UWVS4j 45M68ủt$E$聣E D$t$<$4[^_]UWVSi 4EE}M60E D$ED$4$:t}EE u[^_]?[^_]UWVS4ai Æ4uED$E D$4$U:t%}̉|$E$轢ED$|$4$4[^_]UWVS4i '4M60E D$ED$4$9t%}̉|$E$YED$|$4$w4[^_]UWVSHh 3MU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$!nE9u܋EUȉT$D$ $M8M $1H[^_]€,6}ԋ Uy'H[^_]UVS4g é2uЉt$E $ED$t$E$4[^]U @g i2U T$UT$M6$u]UWVSg 42uEE}ED$E D$4$7t}EE u[^_][^_]UWVS4f 1M68ủt$E$!E D$t$<$4[^_]UWVSff Ë1EE}M60E D$ED$4$L7t}EE u[^_]p[^_]UWVS4f &1uED$E D$4$6t%}̉|$E$]ED$|$4$ 4[^_]UWVS4e 0M60E D$ED$4$6t%}̉|$E$ED$|$4$4[^_]UVS ?e d0EM thP8t P8M6@:t1 [^]ÁP81DD$D$S6@<$GH8붸 [^]UEt @:]ø]UVS d ù/M6t^d,,T$XT$$3M6tE$\1M6$_$M6 [^]Í[$ u뎍/$ $qfffUWVS0c /uzE$z~}UU}} M߉ME؉4$#aƒ  UFD$ D$FD$4$蟉U9UX9UF?MP- DQEmML$D$4$34$W`ƒ4S;} E8E}E;} tu}MMD$ FD$FD$4$fD$ FD$FD$4$fMAE9N~D$FD$4$!3mFM9ED$FD$4$2EE9;} tɀ}TUD$ ED$FD$4$fEHU9ЋUE9F M10[^_];} D$ uTED$FD$4$eED$FD$4$12xD$ D$FD$4$eeFD$FD$4$GeD$ FD$FD$4$&eFD$FD$4$1}tE9} uD$ FD$FD$4$dFD$FD$4$j1D$ ML$D$4$dFE[^_]UWVS0] 1(E}GDEEM698GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$] fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]虁MEE9G~0W,10[^_]Ã]1^E:<$]?}1UZ &M6$]UVSZ %M6p t4$u N8@[^]ø[^]UVSZ ñ%ut4$zu N8@[^]ø[^]US$PZ u%E UD$ D$D$D$T$T$ D$D$E$$[]US$Y %E UD$ D$D$D$T$T$ D$D$E$$[]fffffUWVSY ó$} uUE%tUG$Ul ,6tUF$U/ ,6tBU$U ,6,048<@DHLPEtE@$ ,6  $(EtE@$K ,6TX\`dhlptxE tE @$w ,6|UUUUUUUUE}$tE$@$0X ,6U UUUUU U$U(Uċ,Eȋu(tE(@$9 ,6ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt%  TŰE@|E@hDž$K&' E@,8@1fN9 4>ff~~ tωv$wuE@,8@4F uf~n$O HG 9u͋940f|0yW}$G,@fD00f|0y.GDfJT$G|$uĴ[^_]Ë$#E@,8R|)4xLlx9kf+fdG9R)fL29R4 ʋ fbJr tv$?uE@,RD 9YUR, rfVAtωp$/HN HF 9u͋tp9dl9h0\d$uxy DžxEP$Pty DžtEL$+y DžEԉH$y Dž4$y Džx|Ƌ)΋)ȉlp9`l9E@,H1҉tvf~94>ff~~ t‰ljv$u}O, I4F uf~0r$4O HG 9u͋9 Ƌ9p9pDžAlxE@,8@xM8MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bff~~ t‰׉v$Gu}O, 9I4F uf~k$Ib O HG 9uϋ9 p|9|)ȉ9xE@,@u0F,@‹NHJfB91ЉNDfHD$F|$euXM6}9Gx E@,@1fF9x4dff`FF tƉv$)uE@,@4F vxfFXl)\N HF 9<$u,9|?EH,|f+f49@)fT094‰PЋLf`\Pp tv$uEH,@D gE@,pfFE^*LN HF 9-$utE@,8@1fF9t4PffXFF tƉv$uE@,@4F otfFMh&LN HF 9;$u9|EH,|f+fD9@f+f|094xH8f`Txx tljv$=uEH,@D8 KE@,pfFEЉM,LԉN HF 9Nj$u3M6}9GG800D$E$/f1UWVS|.@ S Uu}} ,6M  M,6 ,6  $( Q,6,048<@DHLP ,,},6TX\`dhlptxE% TT} V,6|UUUUUUUUEE % ||}$€,6M MMMMM M$M(Mċ,UȋU$ UU}(,6]̋]Ћ]ԋ]؋]܋]]䋙]苙]싉MM( M̍M̉L$ T$D$|$t$D$ D$D$E$|[^_]ÍD$E $tUD$$t1D$4$t,t$<$ct}-T|$E$Dt} |D$E $t}$UT$E$$s}(EM̉L$E($syU$9 (U$T$ U T$UT$UT$UT$UT$ U T$UT$M6$w]U$9 U$T$ U T$UT$UT$UT$UT$ U T$UT$M6$]USY9 rEM6t0ÁtZD`N6tuXN6 %BH[]US9 !UE t0ÁtZD`N6tuXN6 %BH[]UWVS8 Eu] %tFDU`N6^HFE~TFU1~_V,@M}@t~D8x ߉xf@9uڋ}9}uD$4$]]1[^_]Ã9}ufXN6 Y[^_]U7 UT$M6$]UVS7 Et=PHӁ`N66u @D [^]ÉցXN6;1uڸ[^]UWVS<,7 QU Etzu<[^_]ËB$ZE@DE̋E@HEfEE@LfEEẺED$E@|$pEx|U B$U BMADBEȃvgDE9tKuU M$8@MąɋU  AxDE9uU <$U %`N61t MAHALQDUEfEfEE}}ȉ|$A|$g|$E$1ҋEH~]E@,<1E@~=U E9p~*W DtL$Eȉ$E9p֋UăE9PD$E$ [<[^_]ËMA|tBfXN6 U $l@EH|U U4 UT$M6$_]UWVS4 ì}M60t=Gt6G$&|$4$D$4$(Z1[^_]ø[^_]UWVS4 ?u} t=Gt6G$P&|$4$D$4$Y1[^_]ø[^_]UVS3 EM tlPHց1`N66u7PDQAP|tA\Rtu1[^]ÉցXN6;3u뭸[^]U"3 KUT$M6$J]2 &ǀt UWVS82 uM6E8`,…2N6E̋2M6E؋2M6EЋ2M6EG M6EG$M6E܋GTM6EȋGXM6EԋG\M6EG`M6GlM6EGmM6EGnE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FlNmEĈVnE4$"FM61ҋ2‰T$$V M6VM64$4$ 8[^_]N6EM6EM6EM6EM6EM6EM6EM6EM6EM6M6EM6EUWVS0 }D$4$HƅEdž3E Fdž2dž2dž2dž2dž2t 3ǃt džh2džl2F`fFddž2dž3F FFFdž3dž3dž3 $?3dž34$6t$<$}o2PJpdž2D$D$D$D$ D$D$4$TFD$D$D$D$ D$D$4$F4$a4$譏D$D$D$D$ D$D$4$謡F tjD$$4$$4$t4$4$6HHM6t 3t4$#4$A[^_]Ë2t$fd2$g29tDžu拆3$4$1[^_]ËRhD맍[$r DžUWVSw- Ü}2t$c2$ig29tƅu拇2$g"<$a3$/3$!M698t<$[^_]<$[^_]UWVS, u +9uǃ8 >ǃ< <ǃ@ ^ǃD vǃL #ǃ :ǃ$ 'ǃ( #ǃ, #ǃ0 #ǃP -ǃH -ǃX _ǃl |ǃ oǃL -ǃT -ǃp <ǃt >ǃx *ǃ| !ǃ f2E@tgt.Ex tAu[^_]ËE싀t(VT$–DT$ D$D$E$ 1 Tp=u[^_]US)+ NM1Tp =u[]UWVS,*  EƍME$+FF(9u݋uD$$8CuxuAAD$$$3T$$ǃL !ǃ8 +ǃt !ǃ< ,ǃ !ǃ@ -ǃ !ǃD .ǃ %ǃL 0ǃ %ǃ  `ǃ %ǃ aǃ ǃ$ fǃ ǃ( gǃ %ǃ, hǃ &ǃ0 iǃ$ %ǃ4 jǃL %ǃ8 kǃt %ǃ< lǃ %ǃ@ mǃ <%ǃD nǃ< %ǃP qǃ #ǃH oǃ #ǃX sǃ %ǃ\ tǃ $%ǃ` uǃ 4%ǃd vǃ, ,%ǃh wǃT %ǃl xǃD ǃ ~ǃ #ǃL pǃd #ǃT rǃ| d"ǃp yǃ e"ǃt zǃ ǃx {ǃ `"ǃ| |ǃ ǃ }E2xU U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$DL$ D$T$$Ep }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$>L $<t $^q $v_ $#M $:; $') $# $# $# $-< $- $_ $|T $oD $p $rud $yc| $zQ ${? $|- $} UUS % I ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0$ EU܉MM672EE4E fEE$ƒ=4M4%y 4 44fǃ EDPf~M䋑f8>@E fWfcftf.MlU܅M6Q)ʉ$1E$ƒE@ @M M4 /UfB 49}} 4% 44;4yf  B6f1҉Ѓ0[^_]ËE44%y 4EDPf y4D$ D$D$$ 4449)‹4L$ T$U؋MȉD$E$4;4U}dž4…f 4xp4fǃ +E$/t3E$=Ec0U$)4fǃ E܅U 0tE@ U؋4 E44B%y 44D$ D$E‰T$E$7y4%y 4 494114M%y 4;4$fǃ Mԋ4D$ T$U؋ED$E$U؋M ~4y 4 49411x 4Wy 4 494B6ff @}AEE܅U$D-E$ƒUE@ @MM MtU-oE@ U؋4  UfB 9 4)fǃ &E܅{M6Q)NUj 4}} 4Hx6 44m4%x4|뿃ߋ 4}} 4%y  44;E@ }fG Ef` ,D$ D$!D$:$Z $dU: [Efǂ ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSX uM6MV8у$33`,EEtM6E(V8t@N<)tE11iE}uDX[^_]ËFv3@M6D$M6$#ǀ3E AX[^_]EE] (.t&KEEED$D$ F@D$EĉD$Ủ$UuQUT$4$ M)v4$$ 33} `,!EED$D$ F@D$EĉD$}̉<$P|$4$& E1EE$E%V88uF @tw 8t!F }fG %E g3t&M6D$M6$M1҉3E@ U UT$M6$]UWVS  u}ED$E D$4$t} u [^_]r [^_]UWVS G luM68E D$ED$<$3tu } [^_] [^_]US E$ []fffffUWVS  Ɖ$B $6…t"ׄtN<$tȃuЃ [^_]ÀF$z Ut p@뮃$<UVS, QƍD$4$ 7D$4$ 4$y vlte110B<1ɀ;Pt0tD~ȃu9mt(B< v-1ɀ;Pu1[^]ø[^]É묀;tD01ɀ ɉ떀>uF[uVmtÃt0ZcWKUWVS0 Uu :uɈ2tU$9LUF@fu2ML$ MD$T$<$S2MEPJ(N$JN 3\<$, JD$D$$ OFTE$ D$D$$NFXV ~$M69M6NTM6 M62P3B0ozpdH12džp2E苂E싂TEtU܉Udžp2ELɉME*EEUwD$Eԉ$UE܋U؉$ԷMԉ $ɷE܅t2džx2EtEJdžx2dž|2UtE.dž|2E؃0[^_]ËHt1@@Dǀ@l@hǀǀǀ<HHpF$B(KE`U܋ED$<$H U|E>U܋ED$<$ Uu p2EU܋ED$<$ Up22@@ ,F@f`L$ D$c=D$<$2E41E$D$E$J u džx2EED$E$ u x2|$E$ x2Et ED$E$ u dž|2EtD$E$ u |2|$E$ r|2c~ LSMt|$E$ u x2dž|2EEdžt2džx2dž|2džp2MzEdžt2džx2dž|2EbtW|$E$[ uDx2dž|2džt2džx2$udž|2EEdžt2džx2dž|2E&U M6D$E$]US EM6H$ M6H M6HT M6HX M6Hl M62 p2 t2 x2 |2 2$QC[]U =MM6tJXM61]ø]fffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS @ ]}ƉDHfx 4 [^_]Ëf=tnfDN4f>tM$]kQPf9uǀFF [^_]ËEFf\Nu]ED$$]-MME$ ]קUMtbf@f@@ f@@f@@]\]X ]]UU9uU];$謳$9],D$ D$D$:$藖 $]<;$S$UWVS W |Ɖ׉M$ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS Eu^9t)fxf8u@$9u׋~1$]n9> $]V4$N[^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS ù}fǃ $Pf9uǀ2ǃ ǃ ǃ i2@tL$x =w4D$T$$# N2D9u[^_]Í<;$g$US q ’E EM6t+2UT$$UPE []ø []U 8UM ~*M6t2t 1]É1]UWVS  M6te3339}}<31 [^_]à D$$0‹t!3333뱸빋33D$BD$$Fm 33]\33o'U  EM6t%2UT$$1ɋUE]ø]U MM6tJTM61]ø]UWVSi Î}<$ٯƃuOG @tI 8u?M63t-M6D$M6$yqǀ3[^_]UWVS  EUM62E EE$3= %y   fǃ LNfu f9q fmffjMUU$ E$mE@ @ME@ M  %y   LNf   yt鋓  9f y [^_]ËE$At3E$8=DEMR [^_]ÃUfB   9| <  9f [^_]Ë %y  ; fǃ Eu-E$E@ @aσufF M6Q)=  Ef` [^_]ÿ,D$ D$ D$`;$苍 $UWVS$h ÍuM6M~V8у$?p33`,M MEtM6BEF8V<F11‹FM63t53@fuT$D$$踠 []1 [] M63ts31 M63tu31p M63tUs3E1]ø< eM63tUu3E1]1U 1M6U31]UVS M6@@fuUT$D$ht@$_ t Efu5  PwtU$Ѓ[^]Ëǀ3[^]UftM6M6UWVS,B g, ( }M6@@fu|$D$ht@$蠖 4UM6fM6M6;Pu9HtL$MԉT$U؉$rNMԋUM6;Pu9HtL$T$$JN43@fuT$$e 3@fuT$D$$k$$&,[^_]EfEfM6;tǂ3U9ǁ3M6M6KEEEEEE  D$}܉|$$ ǃ( **SD$$E $ ǃ, US 5, t[]Í*SD$$ $ ǃ, []US , u[]Ë$ D$$誣 ǃ, []US$z ß( t$[]ÍKEEEEEE  D$ED$$̥ ǃ( $[]US$ $( $[]ÍED$D$$  9Et( $[]D$  D$$E 1UWVS4 çM63;3@fT$$M , ( yM6B$YkD$D$ HQT$PT$@$蚣 S6@|U1DE؉D$D$ $Uԋ@t A:zUԋ}؉|$D$$b|$D$Uԋ@X$@@$u D$ D$D$@$ǀ343@fuT$D$$軙4[^_] S6@|1DM"E܉D$D$$=  9E( M6R뒸$ D$$T ǃ, ( |14[^_]1DMvUԋM؉L$D$8$Uԋ@YD$  D$$q CUWVS, ȬEEEE uԉt$}|$$JEEEED$|$$JD$$ LM63tD$t$$|J,[^_] M63trUS ګM63u-3@fuT$${ []øUS ] ÂM63@fuT$D$$ []US 3M643@fuT$$z []>US E U S6RtI|t71DT$D$$xM6ǀ3@$q 1 []Ëxt1DT$D$$/M6ǀ3@$q 뵸 []UWVS EM62tt_ [^_]S6@tǂ21DT$D$$@$q [^_]S6@@ttǂ2S6@jǂ2U HM62$]ffUS]E  }t J;}R ;~1[]ÃUWVS ި}tG8 uZ@u[^_]ËtG~W,EO(G\p;}@ ;~E9uՋu뭉<$bG8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtTx^F9}WҐxR)9H t7~,}߉ˋF(D$NQT$$U191[^_]É봸USEt"H~X,19t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًUI9u1[^_]øUWVS}] UuG9)9UtYW,G(tX] UG(uU r9|_9}G(r 9 _9}"E E9E |1[^_]D$OL$$bE9oƉ\UED$ PT$D$$]UWVS}G~CW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]t]{tVO~Ww,19tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]UWVSĀ ýR433x,}396F8 ,4};~E<E1uuuuủuƉMD>EED$D$ M3@@D$ED$E$OV,UD>UЉ$~UЋM;4ED$ EF,D$D$3$bED>$~EENjE94~WD>D$E$DE!эP$U蟔 D$UT$ ED$D$4$;EE[^_]F,D$D$E3$EV2MD$ T$FD$4$D$M2$ҸEE[^_]ErUWVS8M rƉU̍R4EԉuЋ4M8<$覓 ƀ?tqE4EEEEE'E$:}M9ErIUU)ր?Et7E܉D$ t$|$E؉$5{Ey8[^_]EEEԋ@tCuҋEԍPMulEEЀ4uŨ8[^_]}E)9ǃEԍPtt$D$ $U U)uMtMȉ׋uԋ6sRtftE‹u)uEmut$D$ $Uà UIuE)muuzEfUWVS,S xEօE93}ʅDP-?@tDG@uM$Ur MɋUM4M׍MMu܉ƉUE$xUt7)ր?t.ED$ t$|$E$yEyĸ,[^_]Ëu܋U)׉|$$x3…tٍNDvu4]Xʉ1,[^_]ø1ɍAA1US &Ew"djD$$=3[]øUS M6t3tUT$$\[]øUS z ßM6t&3tU T$UT$$( []øUS/ TM6t3tUT$$[]øUS M6t&3tU T$UT$$ []øUS ŜM6t3tUT$$\[]øUS\ ÁU M6t*3t ML$ T$UT$$<[]øUVS -M60toƆ43u'3tU$}3${[^]Ë2Ppt%T$$ D$2$[^]øUS t ÙUM6t$3tD$T$$ []øU' PUM6t~;3TR4]1]US M6t3t$U[]øUS ҚM6t"3t$Ut DY[]øUWVS d ÉM60Ɔ43uj33~BE14u_uE;3|Ճ}tO3$y [^_]Ë2Ptt&T$$D$2$ [^_]øU UM6MMM ] US_ ÄM6t3t$Y[]øUWVS EM60E E4ED$ D$MML$$&ttiP$UViDžtUU UED$ UT$ML$<$st&E$U%Ɖ<$q [^_]þUSX }Et3t$gS[]øUWVS Cu3t$"3~#14$p;3|ߋ4$pd3ǃddž3D$0$9l4t`2PtD@@X~:Ɔ3j$G/2@PX3@$41[^_]Ɔ3UWVS (u3t$3~#14$o93ߋ4$o[^_]UWVS]r3Y3KE ~443 u} })u}}11]]9t0z9u}9u]1~39114uu;3|ى[^_]B,B\4u u )lj<)} t7ƉL|G1[^_]ÿUVS 0utNFX32@@T%D$4$ E D$FX$1[^]øUWVS EExD$D$<$pƅt,)‹M tEt|Etuu)1 [^_]ËE tmEtYutREM`N6 u)1MfT$|$E $pE 01f%и [^_]øzUWVS ӓEEuE $oƒw]}E(1M149rEtfEt1[^_]ÉEE $go,} E9tl$@otEHE 103EE1MM9rMEtfEtЪW‹EHE 1uu1U7U9rUEtfEtE%}`N6t]ft  ؉EP1u 9r[^_]ÉE'[EGfmHfmBЪEfmEH>UVSt ƉUE ӁttH@[^]Í €,6ʋ JHJHJ H JHJHJHJHJ H R$P$ [^]UWVS utv4$uVȉ‹9u F0$iF,$iM69pt]9p tJ9pt2t$t$qi4$ii1[^_]@u@ 9pu@9p uUF4$"i>9UtU?$9Uu~X24H90t…#ȋH90utJ$h2UWVS úlj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVS эƉ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u=uAuIu 1[^_]S6@@8tf@ۃf@t4$t4$뭸[^_]USe MU M6t%t X@t @@f%f1[]ø[]U BUM6M u]]]U UM6M u]]UVS E M62Uu0ÁE% úډ1[^]ø[^]USe UM6M u8tHX2H@H@[[8u1[] ʉP@[]U /M6U]QU M6U]UVSɿ M60tFFX2@Ttf@4$4$S6@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]g]UEU Mu]3]USEUu2U Á ӺEڋE1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]_UVS 1utFFX2@Ttf@4$4$S6@@8tf@U 1[^]蝽 ƈS6PT1 t t t@t̀t(t t8t ttLt 1ݼ S6PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS » u4$By D$t$M6$) [^]UVS 腻 êu 4$y D$t$E$ [^]UWVS L quE M6:x1u 9t <uЉD$t$<$ [^_]É4$x UWVS }M60E D$ED$4$׋t<$Hx D$|$4$7 [^_]UWVS 葺 öu}ED$E D$4$肋t<$w D$|$4$ [^_]UWVS< a}uM6E D$ED$$U"t/Ux0u 9t<uƉt$|$$k [^_]ÉU<$Yw ƋUt$|$$C UWVS 裹 Ȅ}uED$E D$E$葊t1x5u 9t <fuƉt$|$E$ [^_]É<$v UVS ) Nu Ex2u 9t<uЉD$t$E$~ [^]É4$pv fffffffUWVSD }EUċEG,4@4E@U }` jE EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$譾uD[^_]à E1D[^_]É$3_&EEFEȅZE@$_EyEGM+M9E O(U @9~F t$fF E@ffO@E % ЩOH ȉFEfFE@EȃvA}${RMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$"fG UMȋE@A%GGfGfwu}G9uOT9 pO(LE @ 9}Gpt$ EĉD$ED$<$9EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$QkMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$a&A!E$O\BE u E;GTuO,u u6uč @4E;GTQG8 |<$w<$ EE uUčJ‰Uĉy19zuĉ)UBHFBLfFMEy19@E0B,4v4BDfFt$B|U$bu 4M+EOT9E M MO(ʋH93OU9U+GHFGLfFfFUO9UGDt$G|$au3  GHhUMʉUȋu6O, 4I49~X}uEFDfG|$F|$aFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 E 8W9)ʍBE G8  M68u E<$\GG8 <$BEuĉ׉EċE MO(@9E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM E<$0EG8 <$}YmUWVS $|8uE0E,EP@,Dt@ 1H470RM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]Qu`E9EuM܉r9M׋GD$ D$t$<$]9uuE7fP 1fU] mUT$M6$j]UWVSE89tZ@EOE)w~>EP,G(UW,΋M4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS( l}GDEM698 GH%EWUOMG,E܍40UunыpG9UfFE9svffEF%M ȉFt$G|$Nu¸([^_]ËOU9~VUEEGGE܋D01E_GD$ ED$ED$<$%<$ 1([^_]EU诟 jM6$]US蕟 ¶jE] L *t&tl AL p 1[]øUWVSu} ^(1Ʌ~&1 ~у9tT,y)у9u[^_]UWVS0 jE,EM6EL l E1M6EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9L ~#tyڅlE)e)UǃL 10[^_]UWVS i}W$G(E~w1U9w(~hD,tO L$y؉D$D0$tuED,yD$UЉD$D0$ tD,E9w(E[^_]EyUWVS9 ^h}G(~"1D0$9D0$=#9w([^_]UWVS huL 1~019t% 9p uDŽl 9uۉ[^_]ffffUWVS 葜 ög]ƉE׉UM$>L]EPt MA +B A(EEuFF]^]^FT4$]j 1ۋNv]uF,MzF.1ɉU܉fGU9VUGfGFD$]AG |$F|$?Ju [^_]ËEED$E@,$]8~xfHf@uEfx~SE@uJUR#h2u`N68}}$J t$JutE1[^_]f~E@t܉M6fy~ӋUBvuGfd묅t}$:J {뎁T$M6$G}$J G_UEPT$ PT$P T$P$11f]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]뭉U델[^_]UWVSx CM6@@MtƠS6J y1DED$D$ƠS6@$6[B@B6#B@t2ED$D$@$ZB@B6#B@~`N6t $hD[^_]uW~udtƠS61DEt1DD$D$BL$jZ`@ƠS61DE*ƠS61DEED$D$@T$ZB@B6#B@&ED$D$@L$Y`@`N6[^_]UWVSv A}ƉӉ$N,4;]u;} t;E"D$E D$ ED$|$$]6[^_]uUWVS&v OAEM6Eԋ3 ]M6]ZJx> XHUE@8@u B8@O B@ ]1Dt$D$S6E@@D$XEԋ@@Ha D$u4$]Hf8E@PhtfEԋsEHȅuvϋEM6 EP,11M~9z_{}~r}41҉9} L$M4$]MuՋE̋SK,B9E}E@@%ƋE}9})EU*Ct}EU9-EEPB%9uUEuE}ċE)DžyE9U)E9EEE}ӉʋuEEȋEMȉEЉ]u]9]1MEȉE܋ZE@,}܋xB,p1҉]M؉M9}L$M4$]QuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9Ex$zETE̋K,E؋mEăpSBE܋]؋}̋7N,"XV9CM$OE@8MEԋP]CD$CE$]CD$C$ESPSPU܉EE$]qM؋E̋E}Љ9}9}r}h}ӋBM E]ȉ]ȋ}MӋBy9nE܋U9~EċEBDM9 tS BDt$B|$]dFfFEBLfF9uE̋sE; \@1ɍ UL$D$ <$]U€w֍V)‰։L$D$<$]P‰EЋE̋@  EȉE]9~]E])؉E؋UĉЋ])؃EEH,E9n]]]E])؋UЋuӉ]1uu܉1M9| u9]9]9]E؅' 9]܋KȋŰrU9Se E䍐 E̋@=vuEEE܋Hىωָ   tftEE =wEဃ)ȋ]܋Kωփ tftE܋]ЉXE̋BD$ D$ED$$]荇EKeWdIt$D$$]C-d]1Dt$D$$CMčGED$D$ E؉D$|$$]L U܉M7D$)ȉD$ ]؉\$EȉD$$] EE@T]1DL$MD$$CU܉zE܋ML$D$E@$BE܉؉}܃}EUddQ]̋R, ]9]uE]E@,E]EE9E|EH,EE}؅EX]@E܋}ȋE)NjE@X0ppuCmM}UčJŰ;JTHGEĉD$UT$$]d1Dt$D$$rAD$D$ D$M܉L$U$t$D$U@@p$)AD$D$ EĉD$D$$U@|$$kct$1|$$@E̋@D$D$}@@0$],ct$D$$@D$D$ D$D$Eĉ$%t$D$@@p$B@D$E܉D$ ED$D$$t uD$1D$ ED$E܉D$E$]11DU؉t$D$E@$]?U؃9uHwHt&S1҉Ut$D$E@H$]-?U9uTD$1ۉ\$ EĉD$E܉D$E$]|$E@$ia1Dt$D$$>E)ED$D$ D$D$E$]RE@|$$`t$D$$U>D$E܉D$ ED$D$E؉$] H] }S D$1D$ EĉD$E܉D$E$]11DU؉t$D$E@H$]=U؃9u 1E@Ut$D$$]o=U9u ppu;t#t}Măű;JXLJEĉD$ED$$]~_1Dt$D$$<D$D$ D$U܉T$M $rt$D$U@@p$<D$D$ ED$D$$(U@]؉\$$]^t$1|$$'<E̋@D$D$}@@0$]^t$D$$;D$D$ D$D$EXučD>ED$D$ D$E܉D$E$]RE@t ]̋ ;qtE؉D$$]]1Dt$D$$5;D$D$ ED$D$EЉ$]E@E؉D$$r]1DT$D$$:D$E܉D$ ED$D$E$]SE1DỦt$D$E@$]U:Ũut$D$E@L$]:uE 3E1Dt$D$E@$]9uL E̋];X iE1DỦt$D$E@L$]k9Ũu)D$D$ ED$E܉D$E$]|$E@9E؋]9Euudfr 1t`u 9}tQpt$$]uE䍐 E܋Hdfw\]䍓 T$U}܋G$OU 1ɋE䍸 E䋀 EE܉EFVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$wD$D$<$"1EUQ M6$]UEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVS>Q cU} w to1t6~RutF$u1[^_]ÉU$jt8U F@RuDžtÉv$uG 멃UEU  HJHfJHfJU @ E]UVSZP utv$Yu[^]UWVS 'P LMq~X1Q,zQ~>1҉EM׋q tMv$uME9xԋEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]} 111 ȉt %1ȃu1Lȉt %1ȃuڋK t4u14Ɓt %1uۋIuҋu9h[^_]1[^_]USN EL t$D$, $zx)P 1[]É$1[]øUWVS0KN pUL P ` E싃\ EǠS6HApEЅM6EE䋳X utayFEԋE%Ey E܋EԋuƋUE99ЅyBU)u܋UE)‰U.E9EEEƋEU)ЉE9gFEԉu܋T u)y ‹u)֋Uu9Guԅ+^M6uu܍t9B~ Eԅ3(D$D$ $/ǃ` EЋ\ EE1ҋX EMM܀}EEM6>\ ;T ЋM)ȉEԋHAEЅzEEE9E| E9A(T$D$EЉ$/@P#\ ǃ` ;T ^J, UN6Uf(T$D$$.P >u Eu@@l8 \ ;T J\ AluL (D$ E$Ww…yP )ЉP pL t}쉻` }艻\ 0[^_]Ë=M6EEU싃X EMM܀})y uyFȉEM6> N6ЋM)ȉEԋHAEЅ \ ;T }xM9M M9ML D$ , $0v)P ǃ` \ ;T t` X E܋E9, E("t$D$$,` ;X ~aP p` @@xuL XD$E$puy)P ` ;X \ (<\ t$D$@$,P \ ;T ` u؀>X u)ʃM6E䍃, Eԍ(Efșƍry )ƋE9@M؉L$D$$J+` X EE0u9~1$ P ]$iXE܉E\ ;T \ M6u܋R,r@(E؍, E0L P P u` R9X E܋EP,\ 4v4F‰EEu@M؉L$D$$ *` P yu9(D$D$EЉ$)ǃ\ ǃ` UNE;H@uRFuLf~-$` D$\ D$F $?VP f=` @$ ` P L tD$ Eԉ$r…yP )ЉP 덋@l(T$D$$(\ \ E9T EЉEԉu($ \]L t'D$ Eԉ$hqy)P $ ǃP L D$ , $ qy)P P E)ȃ9u@(D$D$$'` 9X , E("t$D$$R'` ;X ~b` @@xuɋL t5D$E$-py)P $ Z0$I됉Ƌ\ L t*D$ , $oy)P $ 1ҋX EUWVS sC ØE苃X M6M19|T X ` \ 9T M6EǠS69T 9N6E1DE)$ >Eu ǃ` E98.@@ltˋM t‹UT$D$$%뵉T \ PBh9}dX T$t$$GƅtDE;` t4$U 1DD$D$4$%uU1T \ X ` [^_]ËX N6Eu@@h9ME4M䉋X E;0 GE\ ` ǠS6p >u~xN6U1Dt$D$$=$mtGUt @@tut$D$$$@@lu$ [mu\ ǃ` M6ET 9P))ΉT \ $ 둋T xǃX Ul@  UX UT U ` U\ 11]U0@ Y UX UT U ` U\ E1]UWVS?  %M62M6EM6]19u9uV~sF,E1҉MEF~PCH1U 9F~59uuS9~S 9}͉9FˋU9VMIg[^_]Ë]S~Cs,~DUMڋXCӉu΁9u9uu9utɃ9u>  S6BH8~NHD~GBlthtËuu拐tt 12> [ S6@ xUWVS( > 5 ƉEYS6EBH8ˁ:uM6u@D*= }M6LJd M6Y\A`fAdBt%]1DD$D$ $N EBt8]1DD$D$ $ M6p2!P@EBlhzǁl2ǁh2BxT2@@Tƒth2t h2t h2t h2 t h2 @t h2@t h2t h2EHA\$fǁrǁt"fǁ~ǁfǁǁfǁǁfǁǁfǁǁtmfǁǁtLtfǁǁ~/Rrff@f@@ 9uǁp"ǁt"~&p"p"ff@@9u}苇d %ȋtp"xt"LJl LJh 2M6EM6E E9tE9tE苘d ZHB~UJr,EEU܉}؉ϋ~HQE% ؉9u9uuҋU܋}D$$]_j1([^_]øEM6ȋtǁl2wM6Ћtǁl2Ntttǁl2)UWVS8 EU MfUfMf]M6;7LftvM6949)M6l2tot"уt>]f9p"t"]fp"]fr" 1[^_]Ét"ufp"ufr"fMfvt]fufEftwft8fXfEMfCfE8fufEfEfE}f9r"*t"BfEfE'UVS)7 JEM ]fM6;B`N4f1Dfl2t1[^]ftf/ftTfufft9#ft*fuffuffufffff릸yUWVS$G6 lU} uEEEƉEljEfM6;B\ @ frftufvS6 I ytX2RtE}|$}|$ ut$D$$-;1DT$D$$1$[^_]øUr5 “Efx?M6;B\}1@rU f tUf vEf1]ø]5 :M6ǀtǀxM6 t%d ǂp"ǂt"l u1U勀d %1]UWVS4 }M M6l2t^ftfvǀxM6 t)d fp"fr"ǂt"l ug1[^_]f3fthfufto'ftVfmcfuؾfLBd %1[^_]þ뜻닻n3 M6h2UVS Q3 vM6l2tu? S6Rt*1DD$D$$B6M!A@f@d [^]UWVS2 h tM6} 3x@tOu fM6f9pdt6l2t*M6fpdQ@E % ЉA@[^_]΍N} f_f|SM6UL$2@$71DL$D$$UUULf`L$2@t΍N} ff|M6UL$2@l$ 71DL$D$$bUUULfL$2@h$61DL$D$$UUM6$UM fxGUM6$sUM f0 M6f@dUWVS0 õUM6pFFy ;F|# tH4$[^_]Ét$$UWVS+0 PUu FFy ;F|# tH4${[^_]Ét$$aUWVS/ M6x|$E$,Ɖ<$)[^_]UWVS/ ñ} |$E$Ɖ<$[^_]UWVSQ/ zUM6tJ } xCH9M ;X9}4xp,9"49M uM HP1[^_]Ë#ָ[^_]UWVSEM UtK xEpu9|;p9~4Xx,9"<79Uu7PH1[^_]Ë4&ָ[^_]UWVS Uztzr BEuNjEBw u)]ZڋOM)ʉ x=_]93O9},_w,9~ ! ΋M9u3GWGu [^_]fUWVS@- E}E E EE E @$]ÅxyGEGE؋E @ G]% upEM6E_E))9@L$ED$<$]؃@[^_]û놃 uG1뼸@[^_]ËG,U؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9r)UԋAFAFA F AF9sڋMA E @EȉE E%AfYE HvJM܉]ĉ}}$]}M \_ XG E9u͋]ċ}EԃUt1Mٍr}}ȉ8)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]Q<$vM1 EGy1G1 <$] E9GT G8  <$]T1E D$<$]v1 UԋUЉE  E9:]ȉMĉ:BD|$B|U$]9UBHGfG9}s*w tUv$]duUG 뜉]ȋMĉU* FUT$M6$&]UWVS ) u}ED$E D$4$t} u [^_] [^_]UWVS ) uM68E D$ED$<$tu } [^_] [^_]ffUWVS|=) fE}}M E $]kEQw$]}E1EHMGEȋGEEċE @M qMMMM6M t[E2 $ ]ÅyEEę)EEĉEċt& uE9GTu G8 )EȋuڋwGEM)ȃM9EEċGEȋE ]EMM6MU rUUEM  / m$ ]DžyE]ĉؙ)Mˉ]ME Et MuM} EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9ZU@t)G$fE9r)UGFGFG F GF9sڋEȋUUċu}ỦUUĉU]ȉ]UUuEȋ^,EEEF@ED$ED$ED$ ED$ED$4$]&mmuE]4EȋQT$ UT$D$ $M]LE 8 MQA(TE@ 9}E <U1UĉU uKEEEEE E E$]pyVMmEEMmEąy1EămyEF$]y)EE9EbEWMFE EĉE_$]ymEHU8mEąy1EċF$]y)E<9e}U&FHGGfGfG9}FD|$F|$]xuE$]|[^_]ËyQUEĉAEȉA $]{MyUQE9ATtNEȃE u{}ω4$]Y<$qE1|[^_]E $]xyMEu붋E$] =U " U T$UT$M6$q]UWVS" uEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U )" RD$UT$M6$]UWVS ! u}ED$E D$4$tE} u [^_]h [^_]UWVS! EE}M60E D$ED$4$t}EE u[^_][^_]UWVS 7! \uM68E D$ED$<$#tEu } [^_] [^_]fffUWVS ÉUMP-ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS( EUM؋ufUވM݋U 1ɋU EEԋ}P-Et$$UEx}P$u܀G$TUt}EMU E1‹E Et~MލAf qCmЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wCmDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS ƻUE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ )t$D$$E[^]ûu111[^]U p r D$ ED$E D$E$]U p r D$ )D$D$E$]UWVSm Nj2FEF<\<^t{Ѝ\P-r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%PP- QuJ{E< v^]v.F<P-]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS% JƠS6t| t~9t $sK| EED$D$E $`uI| tG@t  dN6 x @xt [^]É댋E[^]É| @uUWVS(Z UEtBEES6E}<$UT$ D$D$<$T(u蹵N))uU܉e)‹M)uUѸg4 )3D$<$MEtTH tCp$1҉}܉ 9t-~fuUE܉D$$ UuF([^_]1([^_]ËP 3([^_]UWVS(  0UEtBEES6E܋u4$`UT$ D$D$4$'}kLЍB)LuUeЍBM)LuUѸ>Љ)<;lD$4$E܋tRH t>x$1҉u܉ 9t(nuME܉D$$MuՋGy([^_]Ë;p@x([^_]UWVS( UEtBEES6E܋pu4$ UT$ D$D$4$%}-?L) RЍ)Ѝ oGEeE)  IȍE) GE*SRЍ)<; vD$4$E܋;vAQ tJy$E܉u9t(~suED$$+uދF E܃9u؋E܅tЉ)ElD$<$-VUE}<$=UĉT$ D$D$<$Mĸ-?L) @)Ѝ oAE-?LeȋE) @E)AM*SRЍ) vUD$<$Ute}tu}cu }uFEE3$z<EEp$J=v$0>렃}u E$~1҉UffffffUWVSA fE1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUUƍp@Hπw09}맋E D똉UUUWVS~ Ǜ48,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$4ݨ8C,s0K40u4 8$4\8 @0@4$4(8G,_G0Gƅ`%4P- Dž,Dž$Dž(Dža`0:~LJwDɋ4XKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4 W0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4E EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4t8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$40,OPDŽPUw}7D$$詙>D$t$$-‰E$20UtYEE[^_]Í[$WƅSE1ҋEEut$ t8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVSE juNE|F9sXtd|$$ـtH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$K{렋}<FUWVS< ªE@ EE@ 0t$$sM4$vE@E܋uFX1tftE$=u}D$|<$/iHM|$E@ $E$qxDMED$E@$M;UBNju`P0@|$E@ $k$EǍ@ED>D$E@$Uu$KEE<[^_]ËMAOMփEtfEtǤ$E܉$EP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$9Ep@@LEMA@AHADALudfx111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$2E<[^_]px1113u܉4$ ֨u8uDMUU`$iEU r}fm몍T$*E0GU7UWVSc ÈUJEtB9swt$U${Ut]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$"vU]EfUWVSX }uVzF9sHtT|$$zt8~VM f FHNMLF [^_]Ëu1[^_]É<$ruUWVSX ED$,E$} D$|$]s_xD$|4$]cPU4$]= t<$ז= E$]辖= D$$P]xÉE܅F@ t$$<Et E 2t E D$,E$qEN EEEP-E̋EE u<.tjDy@u붋}]D$ED$4$]gËE8g E E܃x f_EĉUED$ EԉD$E썈ӴL$E $@EċUڍwEJЀv)ύ)ȍD$4$ u [^_]ÿUF gE=w  ]1]UWVS  9u4$蔉UT$ D$D$4$9}-?L) RЍ)Ѝ GEeE)  IȍE) GE*S)ύɍ D$4$u [^_]ÿUWVS4* OufF(}ȉ|$$ft4[^_]É<$A1t9ufV(4[^_]UWVS u  fN6fV EdN6 4$@V(EfD$FD$ $Uz=UwDE |)ʉM싆t7T$UD$E$szU9sUJM|M))‹FtIT$UD$u4$5zU9r4[^_]1$dN6[^_]ËUыU|UVS} âutgF$~mF$smF$hmF $]mF$$RmF,$Gm4$?m9 t 1[^]ǃ " @  @tÍAAfffffffUWVS ֓lj$U/D$$ 蜆Et$UT$U$19UuED$$ \1[^_]ÉUED$$ <$3UD$3UD3UWVSd $7EE1EEƍEE> tqE9D$t$U$1Utˋ$2$2UDŽ5Euu ;t1< tHv0FIU$2$1UDŽO&UWVS<3 X$7U11ɍˬt6u6E+<ȁ<[^_]Ãu@W@0ƃ:uVƅ/lFu$b9$b#  Ή$k0D$Y0D$D$ D$D$o4$Cy{qD$@|$/$t:tRP:uVpƅz빉1$L/Ή$[2Ή$*/D$/$ /D$2ω$.D$.\$\\$/F$`ƅD$/4$\/tY1ɉL$T$/T$VT$ L$D$4$腻t$OD$$pL"1҉T$T$ L$D$4$@빉o9vFUWVS L qu}D$:4$QLt!D$T$$t|$E D$4$, [^_]ËU t考 [^_]UVS uD$:4$Kt!D$T$$萂tE D$4$| [^]Uq ’Ewt ]1]ì]UWVSh) NEu $7MU1ҍxUED$ ^D$D$@U$UruUƒE9~ЉEΉ )t$|$ʉUM$*MUӉϋʉU$+uD$+UDW!}|$t$$X*uU+u h[^_]ËEUWVS`轿 EM $7U1ҍpUMED$ dD$D$@U$UtUD$$ D}EED$ML$ED$A(;EUT$$ u@ } f!^ut$L$$'U+uW`[^_]|U$5*ED$&*UED轇tUWVS`[ ÀEU$7L$\1ɍpwbtNT$E UD$ T$jD$D$@T$$T$rT$1t>$uT$ U MT$L$$lL$\+u`[^_]øUWVS 莽 óExw|Mt_ƃtAkƍU$(ED$(UED [^_]Ãu$(Ɖ [^_]UWVSp }EU $7uM1ɋ]p3MmQm8@E~Eߺ81xEM}E )|$t$ʉUM$]M&MUЉ΋ʉU$]P'}D$A'UDۄ!\$T$$]j]U+p[^_]ê0f%.t&CD$D$ ]#D$D$@}<$oGj뉉f>~$E~LSC9u1Uf~7g]]US脺 éEPw*Ӑt覃-[]ÃӬu$([]US/ TEPw*ӐtQ-[]ÃӬuU T$$T[]UVS ҹ uD$:4$Ct!D$T$$ztE D$4$ [^]軂- [^]UVS Z uD$:4$bCt!D$T$$!ztE D$D$4$# [^]ËE D$D$4$ [^]US Ը EMPw*Ӑt- []ÃӬuL$U T$$# []USq ÖUBwÐt1[]Ãìu$R[]UVS ) NuD$:4$1Bt!D$T$$xtE D$4$ [^]- [^]fffffffUWVS詷 Ƃ}E1E xt=1}t ƒu@u[^_]UWVSĀ. K}E|$7xƋE, 1@ E0 E|1E]EH Eƒx  EB A ǁE9uʋE%uL P -\ EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËU 1ۍLU @t?Et鸓$I )9uu1믋}@ E1ۍE0 EEEu1}}}8tDAuEƃ@E}t,ى%I$))9D E9u }u _]uE^@]1҃DD [ u̓E9uE, a:!@t$EDu۸@u܋} Ƈ E}8L8 0u}, ] ]E M }~Et M  ЋU 1ҋMDŽ  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹Et 1itEUEEt @FEǀ, ]UWVSX{ œ|uE EM$7ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE, EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHEL EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3! 3" ]3# 1EEԋ$ ]3% ]3& ]3' 3( 3) 3* ]3+ 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼$ u3% E1ljE3 3& 3 3' 3 3( 3! 3) 3" 3* 3# E3+ }m1]E%MɁ ȉEE%MɁ ȉE1E1 EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËME 4a UWVSPD mxE̋uM M$7EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍t}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍wdEEEEEyD$ D$$<$]?9tD$ )D$|$E؉$>f}2ae}sha1f}1 }argo}argo}argo}n2d}M̈ _ȍ  ME,E Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍ MEM̍,M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍ MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍ $,EfM ȃ?9,K?9,K ?9,K8,EfM ȃ?9,K?9,K ?9,K8,CEf?9,K ?9,K 8,CC EEԉD$4$I2}n2i]VUWVS9 bsE$7EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë]UWVS, rE؋U$7ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]UWVSDݦ rU uU$7‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$N @D$$ D @D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$葷D$$u(D$$HMP489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$ALtD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1UWVS螢 ǻmEu $7‹E1D$D$H $dDžDž4$8$u εt$4$GfƉ$d_DžD$$f8vu[x=uUT$$ D$$e DžDžDž DžDž*|$4$Je3ptjtmt2$D1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$$auDž!t$$aDžID$$cƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$wbt*D$ iwD$D$p$R$A 4$@[|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$D$D$4$D$D$|4$D$D$p$$%D$D$,$UUUVS= bguv$*‰)Ѓ[^]øh`UWVS4  gÉED$ut$u 4$\u3D$ ED$$cEE8$E $]蓯h`)‰UE E h`9tt$u+E E܋E$]XNjED$ut$u t$u܉t$ D$D$b K E$OJ t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃D$D$b}<$OU^D$O O ȉD$$9EPU9uD$]J J  J ȉD$$EPU@D$D$4$E4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS) >`9ɍ  dH USH f`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂK $2?ƂK aHK ƄK $,T$ ŵT$D$$A7D4${J`D$HD$T$14U+u{[^_]Íxƅ??tOlEȉDRH,UWVS 5Wu(} $7E14$lI$?$u 1H$9u勅)ȉx  @4$+$D$(|$4$@D$̵D$4$&T$|$4$ }<$$D$(L$<$T$T$<$$D$(L$<$|$0, $$lj~T$,D$4$[Dž0Dž4Dž8Dž<$,D$4$t&D$uڋ(D$4$~uڋfǃLL $1ƃNL $ D$D$OL $ :D$xεD$ B$t$,$1s$D$(D$<$U~ ɋ D$,D$<$~|$,$B<$}ʉ)Ѹ%I$))Љ)‰ :D$,D$<$} ɋuo$D$(D$<$]}9$D$(D$<$<} D$D$<$} $D$(D$<$|p D$D$<$| ?LL ,L D$06 < ȉD$$,L ,L D$17 = ȉD$$=,L ,L D$28 > ȉD$$,L ,L D$39 ? ȉD$$,L ,L D$4: 5 ȉD$$w,L ,L D$;T$$M,L P,L @D$D$,$6E+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž DžUWVSh PMMUu$7ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$ D$@|$<$+E D$D$<$|$$蕅<$D$@t$<$D$t$<$ʃ|$4$SE+[^_]Éu4$MUT$L$4$lt$4$Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\T}fUWVSa ÆLutJD$ED$4$HNjE9t.8u)lJ8"tE 81[^_]Ãu1CJUVS LEU ]~Íу? H9u[^]UVS輀 KEU ]~ÍLу? H9u[^]ffffffUWVS8a ÆKƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U JEt t&t1]ËM t6ٵ]ËE t]ËE tе]Í}]Í]Í]UWVSJ oJu} 4$9uw[^_][^_]UWVSd 'Ju}$}(E($qEEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$"UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$!jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSz ëEu4$xu1҉[^][^]UVSNz sEu4$@u[^][^]UVSz 8Eu4$u[^]}[^]UWVSy D}u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSXVy {DM $6ƉEE$ljE4$ƉEE EEEED$ML$}<$1t.1EM $M $4$EX[^_]ËuE$6EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSw C}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSsw ØB}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSv "B}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úUv ²AE##+ፂ]Í_c]Í=]Í >]Í]Íj]Í]Í]Í]Í<]Í<]Í =]ÍR]ÍD=]Íh=]Í=]Í=]Í]Í']Í=]ÍR]Íd]Íu]Í]Í]Ͷ]Íն]Í]Í]Í]Í5]ÍC]Íp<]Í]Íȷ]Íط]Í]UWVS 7u \@EwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$02tffffUS t ?U T$D$U$胬 []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVSgs Ì>u Ee…t5҅u.UREu ]]̲ttE\$4$HE@@t] u [^_]4$ [^_]UWVSr =׉$7‹E1D$@4$?G0D$D$4$@GD$D$4$@G,D$D$4$@G(D$D$4$i@G8D$D$4$F@D$D$4$ @G D$D$4$?GtO L$D$4$?GD GD$D$4$?GtOL$D$4$?GD$D$4$y?GtOL$D$4$_?GDuoG$D$D$4$6?G tW$T$D$4$?D$@D$4$CE+uG[^_]ËGD$G$GsG D$G$G Uo ';UM ̲tt M U]N]UWVS4o :MU $7ËE1Z? 4z 2z101x9u싵9uߋD$ t$AD$$E̲ɋtxD$$̲ҋtFD$4$2Z ̲tt\$4$2Z @@t!\$4$ЋE+u&4[^_]É4$؍UWVS$m 8E]M Usy AEU u}O1ۍG1)A[]EuW])؃H1e1)E<t}1Ӊt$D$ $\$]"$[^_]ÍF)؍8]D1ۋEe1)MKUuȃH1e1)둍D9L9UWVS0l 7}wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$j;~rϋM؉tw뫋E܃;Gsw10[^_]øUSEoox P X:PHUPX4P$H P,JH09P(P4P@@у+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS :G _u} FEFED$E$O?$ug$ED$EUT$<$u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSXiE Î}EE$7UE1D$E$wƋẺ$-E+} f$OME Eĉ4$U9PMMȃ/MU)ƒ$v=yM}BEŰB8D$UĉT$ D$D$u҉uȉ4$&4$‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$4$g9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$4$‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$4$U‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fEUMR)уtu]UVSU ṽщcw[^]ffffUWVSs? ǐ |$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$`T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSLc2 ÈuE $7U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFTlUWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS. lj(UE u$7, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(UWVS\, ML$} $7D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$!D$0aC_كƸӸ<^\$0D!D$0 ك\$0"D$0yvzك\$0l!D$0GOhك\$0:"D$0jك\$0ٞ ؃"D$0l-ك\$0[!D$0<&\$0}!D$0X~!D$0 "D$0 !D$06 "D$0!D$0f m!D$0HO!D$0* 1!D$0 6!D$06@ !D$0I!D$0 "D$0q!D$0v, }!D$0Xa_"D$0:bA!D$0#!D$0|!D$0g!D$0N"D$0!D$0!D$0h6o!D$0JQ!D$0,3!D$0!D$0!D$0,!D$0m!D$0"D$0x !D$0Za!D$0$,D$ D$D$$谐4,D$ D$D$($~l,D$ D$D$V$L,t$D$$Ht$ D$D$~$ o,D$ D$D$$׏!D$0,D$ D$D$$葏5,D$ D$D$$_,D$ D$D$I$-,D$ D$D$$,D$ D$D$m$Ɏ],t$D$$Gt$ D$D$~$膎,D$ D$D$7$T,D$ D$D$$",D$ D$D$$,D$ D$D$$辍,t$D$$Ft$ D$D$~${,t$D$$Et$ D$D$~$8,D$ D$D$n$ffffD$1ffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS ]E81}8CC twS(s$tbD$D$$ЉƅtpC@8@4?E D$$tEt$S($S$CE[^]K$C C(1uиɸUED$ E D$D$E$]UVSEM tYX tRP$tKPtD;u@B-4?w3t)x6(r@1 w#EB?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍,}WPGX WTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍U܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍`>U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍>U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍U܉BE@Q?}/]ԉU-}E̍EPD@B?} EEUԉu@}E̍]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99Eֻ̍U܉BE@Q?EЉEE}U̍ M܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍,Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n};]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̺̍]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS }u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ Eԋuu$7E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVS ӛE}Mx11 rtE xfDU9uEExfG0UofxZUWVS4 }̉ÉEЋ@,E܋{t-Ek@^S,s']?'É}Dwl_`GpEG8D0OXWH1#GTGHWDBUO4!W@fJUf2_xUWdG`t;s)W,9v ;_`TGhG8D0ZZZf9GlGtEGtX18[^_]GhFGlmEGt}GtE=E tUawl_`GpE_xGdG`G\Wl)…G8D$ T$D$<$]pWGlG\,$EDEf+MQpp4PAۋuff=W]€?'f EOxGt)ȉEGtQWxwl]܉M؉UuԉGl9Er2_8\ OXwH1#OTOH_D Kw4!Ƌ_@fsfmuwxu]܋M؋uGhG`D1Gl9]W\)ЅW8D$ D$T$<$]UGlG\@GtE‰G`t+Gp=G`ff]11XOhteW8GlDZZZfGhGlƒwg} tlW\)ЅW8D$ D$T$<$]TGlG\e@8[^_]ú} uW\)ЅxRW8D$ D$T$<$]OTGlG\ x8[^_]ø8[^_]1W1UWVSPʸ E}>'EċGtEE?'E},_lG8DOXWH1#GTGHWDBw4!ދO@fqft)ыG,-92G`JHf+_pr<rMffۋE?'f E؋Eԋw`Gt)EGtOl_8]_X]_T]9r gΉwlG`]3GHT3M1‹E!‰WHM9MGlW\)ЅW8D$ D$T$<$]LRGlG\H=1P[^_]ËG8ZZfGtEGtGlGl9@}yGt=] X_lffۋEYG`^_`GDEЋG@E̋G4EȋGHQu]MWlMuL1ȋu!GHuЍFu!֋M̉]fq]fmuw`uuMGlB1ZGlƒwg} tlW\)ЅW8D$ D$T$<$]rPGlG\.@P[^_]ú} uW\)ЅxKW8D$ D$T$<$]PGlG\xP[^_]øP[^_]11SUWVS(蓴 EEP @,z}9sEECE܉E} v19}EED$ D$D$E$]LLEP@]و\EP@|EP@шLEP@ӈ|EEuCEMEEP*K9Epl+p\E<v)щE9sMEM9E} }9suJ ^\^8‰ωރtftuC )CCF\)Eu0S }E{ ){{CEMEE܋})EE)@l}9sUu6VE u;F\uv,}9s}O*} })ʁQ}O\)ȉ9399_} 1D$ t$EH8L$$]JEp\E([^_]ËE 9}1} ERY}<})9sz}\MI,9|j)ϋu~\)ȉFlv8u4xtftEw uEH,@lu6V};s9,{}G8‰ىuFl؉Flv,)9hʋ}@EE܋})EE@,u~89Edž3)ƃq0"E@,uFl‹uF\} Mus=9v9sƃ} bE19멺}O\)ȉ9ۉӅM&uVlv'E}Eƀ?'G`GlO8MtMLU:QMZZZfotGl9_tS_t=E qG`GlO8M;9MhE)L$CD$E@0$]MA0V7D$ D$D$E$]U.} HEEP~@B)ȉD$uNL$E@0$]2MA0V<)ȉD$uNL$E@0$]MA0F@,L:Q1:Q(U썔UЉ}]]׋UI:Y:Y:Y:Y:Y:Y:9~:Yt}]ԉUU)сO`9_`ٍAZZZMff G`)GtGlG`9xG\Wl)…G8D$ T$D$<$]]/GlG\@E<EuFD$FD$E@0$]MA0VK1FEǀ} `MA\qlu)…A8D$ T$D$u4$]`.FlF\pEPE$],5'uFDVLfDPTT$D$$]ANt[FlF\dž>ɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVS /\} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}LDDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$>dž   9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 裎 YEuE EM}EEEEE U$o81f8]vEFF ^$}uEEG} }UD$D$F($V ÅUF0@*P@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]A|A13u3 eEF$EF F( [^_]øCE`+,@F4$}U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@ CL{DMqD-{uvuju^CMQ+QS $ | 0 E[^_]älfb.t&ft.t&`fV&ft&fu5AfY{8f3f+0f(-f%*$ E1E%N wRUWVS84 ]REȋM }׃}TuĉU 2A3؃u߉߉UθEEEE]ȍỦuEʋ1E؋u3ruԋM3JMЋ}3z }}3z}܃<EEEEE܋EU U҉3tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9D$U:^NjFD$U$tE 8# [^_]1 [^_]UWVS =Z b%}GtUD$U]ƋGD$U$訑t+4$P=yarauE 0,# [^_]É4$r1 [^_]UWVS Y $}GtUD$UW]ƋGD$U$+t+4$Ӥ=tciduE 0" [^_]É4$1 [^_]UWVSCY h$ED$E D$E$tSEt4}D<$\ƋED$<$蘐tE01[^_]!"[^_] "[^_]UVSX #ut$E D$E$Bt.yaraUFƅu [^]!0[^]!0[^]UVSAX f#ut$E D$E$t.tcidUƅu [^]8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS jO ÏE$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS O ,E$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS N EU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS CN hE$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS M E$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS {M àE$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS M =E$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS L EU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS SL xE$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS K E$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS K ñE$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS (K ME$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS J EU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVSdJ ÉE D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS J ,E$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS I E$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVSRI wE D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS H ED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS H äED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVSH BE D$E$gƉ$P=gntst 1[^_]É4$$P$UdDžtڋUT$D$4$$t U:[^_]É<$UVSG øE D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS 6G [E$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS F E$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS F åut*t$E D$E$%flj4$ [^_]1 [^_]UVS0F UE D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS E E$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVS{E àE $jxt%ƉD$E$蟊lj4$[^_]1[^_]US(E ME D$E$ˆUT$$/[]USD E D$E$艈UT$$F0[]USD E D$E$PUT$$0[]US}D âE D$E$UT$$0[]USDD iE D$E$އUT$$0[]US D 0E D$E$襇UT$$0[]USC E D$E$lUT$$%1[]USC þE D$E$3UT$$p1[]US`C ÅE D$E$UT$$1[]US'C LE D$E$UT$$1[]USB E D$E$舆UT$$1[]USB E D$E$OUT$$1[]US|B á E D$E$UT$$ 2[]USCB h E D$E$݅UT$$ 2[]US B / E D$E$褅UT$$2[]USA E D$E$kUT$$2[]USA ý E D$E$2UT$$2[]US_A Ä E D$E$UT$$$2[]US&A K E D$E$UT$$12[]US@  E D$E$臄UT$$22[]UWVS @ E$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVSO@ t E $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS ?  E$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVS? õ E $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS 4? Y E$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVS> E $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS w> Ü E$D$&t,ƉD$E D$E$膂lj4$ӆ [^_]1 [^_]UWVS> : E $D$&t%ƉD$E$3lj4$x[^_]1[^_]UWVS = EU$T$,&t,ƉD$E D$E$Ɂlj4$ [^_]1 [^_]UWVSX= }E U$T$%t%ƉD$E$vlj4$軅[^_]1[^_]UWVS < "E$D$o%t,ƉD$E D$E$ lj4$Y [^_]1 [^_]UWVS< E $D$ %t%ƉD$E$蹁lj4$[^_]1[^_]UWVS @< eE$D$$t,ƉD$E D$E$Nlj4$蛄 [^_]1 [^_]UWVS; E $D$N$t%ƉD$E$lj4$?[^_]1[^_]UWVS ; æE$D$#t,ƉD$E D$E$lj4$܃ [^_]1 [^_]UWVS; CE $D$#t%ƉD$E$;lj4$考[^_]1[^_]UWVS : E$D$4#t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVS`: ÅE $D$"t%ƉD$E$~lj4$Â[^_]1[^_]UWVS : *EU$T$w"t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVS9 E U$T$"t%ƉD$E$~lj4$[^_]1[^_]UWVS H9 mE$D$"t,ƉD$E D$E$U}lj4$袁 [^_]1 [^_]UWVS8 E $D$!t%ƉD$E$~lj4$E[^_]1[^_]UWVS 8 ìE$D$A!t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS#8 HE $D$ t%ƉD$E$?}lj4$脀[^_]1[^_]UWVS 7 E$D$ t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSc7 ÈE $D$ t%ƉD$E$|lj4$[^_]1[^_]UWVS 7 ,E$D$t,ƉD$E D$E${lj4$b [^_]1 [^_]UWVS6 E $D$_t%ƉD$E${lj4$[^_]1[^_]UWVS H6 mEU$T$t,ƉD$E D$E$Wzlj4$~ [^_]1 [^_]UWVS5 E U$T$t%ƉD$E${lj4$I~[^_]1[^_]UWVS 5 ðE$D$Ft,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS(5 ME $D$t%ƉD$E$Ezlj4$}[^_]1[^_]UWVS 4 E$D$t,ƉD$E D$E$xlj4$&} [^_]1 [^_]UWVSh4 ÍE $D$"t%ƉD$E$ylj4$|[^_]1[^_]UWVS 4 0E$D$t,ƉD$E D$E$xlj4$e| [^_]1 [^_]UWVS3 E $D$at%ƉD$E$xlj4$|[^_]1[^_]UWVS J3 oE$D$t,ƉD$E D$E$Xwlj4${ [^_]1 [^_]UWVS2 E $D$t%ƉD$E$xlj4$I{[^_]1[^_]UWVS 2 ðEU$T$Gt,ƉD$E D$E$vlj4$z [^_]1 [^_]UWVS)2 NE U$T$t%ƉD$E$Gwlj4$z[^_]1[^_]UVS1 E D$E$iuƉ$}=gntst 1[^]É4$}tU[^]UWVS r1 ×E$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS1 <E $7 t%ƉD$E$D$ XD$D$t>$US) E @tURt$t(?D$ 8D$D$g>$JUWVS ) =E P tXxD$,t$E$}u 1 [^_]É|$E$ztt$E$j~ [^_]Í,D$E$= [^_]UWVS( êE׉M썃 D$$藜$ ƍ D$4$hpEF~UV t [^_]ÍL E$,t$L $(9t+$-pE$Et)4$[^_]ËE$ޘEt1닋F$ʉ<$1oUWVS ' èu} D$|$4${u 1 [^_]ËED$4$yt|$4$| [^_]UVS!' F$ ƅt' D$4$(oFF F[^]UWVS& u$ >… D$$UnUBB BU4$EE$Ut]NjMs"EtfEtBEB Ѓ[^_]׍D$ D$D$/>$$n1UVS% ut4$Z[^]"D$ D$D$}>$UWVS}% âEtw} |$ ED$D$$ƅxEH $M…t1|$ ED$ML$$UU1x[^_]1[^_]ÍD$ tD$D$U>$U$ UT$iw$]UVS$ þut4$[^]D$ D$D$}>$jUWVS 8$ ]utb 9uXFt@~ G$蝿…t>FtAD$$UU [^_]H4$l [^_]1 [^_]ÍAAUWVS # utJ 9u@~ G$…t,Ft/D$$U9U [^_]1 [^_]ÍAAU<# ]Et 9t1]Ë@ ]U# 5Et 9uP@tt ]1҉]ÍAA]US" Et 9t1[]ËU tH Q9Ur@tD$E $V[]ÍAAUn" Et 9t1]Ë@]UWVS7" \}t; 9u1G $袽ƅtGt"D$4$[^_]1[^_]ÍAAU! Et 9u @t]1]ÍAA]UWVS! ýut 9t 1[^_]ËU tM 9uFtA F EP$UܼDžtŋE HɋUtOFt@L$D$ ?D$T$<$F~}~ t$sAA븍AAUWVS ut 9t 1[^_]ËE FtE $(F EH $M…tFMtI} |$D$ ?D$L$$UFUV}~ t$MoAA믍D$ D$D$;>$US Et 9t1[]ËM tM 9uL$$)mUS Et 9t1[]Ë@tU T$$1[]ÍAAUSQ vEt 9t1[]Ë@tU T$$[]ÍAAUS "EU tG 9u=t99 u5Rt@tT$$[]ÍAA@uፃAAٸfUS øEt. 9u$@tU T$$'[]ÍAAfUWVS C hu~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$pDžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ ƅt' D$4$eFF FE 0 [^_]É<$ID$,D$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]US D$ $L $蠍[]USi ÎL $z[]UWVS4A fM EpAQAtpD$ T$L$D$ uԉ4$D$|$E$ipt2t$E$5mt|$E$^q4[^_]Í 14[^_]ÉD$ T$kMD$D$ uԉ4$yP?D$ D$D$?$bUVS1 VE 0t$ M $;4$%1[^]US D$L $ƋLD$ M $1[]UWVS lj։MML$ED$G$VEU9ErfEG[^_]}8"u1UWVS$ Ilj։MTML$ED$G$V!ЃtNEG[^_] 8"u1UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS@ eƍD$ $XL <$7t$ M E$t $E4a<$ UЃ[^_]ÉE<$$ RUt֍lD$ $M`MAFAFA<$證t$E$hMt+$E`<$脉M $mUЃ[^_]ÉL$ME$hM9uE<$HUЃ[^_]ÍüD$ D$D$M?$UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS utl9u4$^[^]1[^]UE@]UWVS §Et l9t1[^_]@t9H@1һ9ˉr|9[^_]ËP@Ӂw?Ӂ19ωr-9[^_]ø@[ QU Et l9t11]ËP@]U ªEt l9t11]ËP@]U\ }Et l9t11]ËP@]U/ PEt l9t11]ËP@]UVS Et l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVSy šEt l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS Et l9t1[]ËHX@uȉwދE []ËHP9ȸsUS ²Et l9t1[]ËHX@uȉwދE []ËHP9ȸsU+ LEt l9t1]ËHP@txE P]US Et l9t1[]ËHX@uȉwދE []ËHP9ȸsUVS} žEt l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS Et l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUSx ™Et l9t1[]ËHX@uȉwދE []ËHP9ȸsU 3Et l9t1]ËHP@txE P]U Et l9t1]ËPH9иrE ]U ¬Et l9t1]ËPH9иrE f]UE fEt l9t1]ËHPwE ]U  ,Et l9t1]ËHPwE ]U Et l9t1]ËHP@uxE P]U °Et l9t1]ËHPwE ]UU vEt l9t1]ËPH9иrE ]U 1Et l9t1]ËPH9иrE f]U Et l9t1]ËHPwE ]U ±Et l9t1]ËHP@uxE P]USF kEt l9t1[]ËM tM 9uL$$[U (Et l9t1]@tHxUxU M3P3H ]U Et l9t1]@tHxUxU M3P3H ]USn Et l9t1[]ËHX@u xExȉ3E 3U []US AEt l9t1[]ËHX@u xExȉ3E 3U []UWVS ]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$D$$~tU [^_]ù RAu_Uu>fUWVSP <$eH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$B_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS<A f4$}cB BBB$BBB(B8O)Bf^.t{BADžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upB(SxauZxluTxsuNxeuHxBJB(zxru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%~VlgBB(~Vуzc<$N1USEJv[]ÉuUS  E ;Et1 []ÉD$ED$E$= []UWVS ]u}E E $ ‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]r<u?/ F(<>tt uHvf~ t{ lqG u\.x$E]ͼD$ ` D$D$?$ t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS0 EEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE$p(r EpD$t$$t}(u GtXtA1(u~u EpENjE$[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVS>$hLlp$肗thD$D$E$zfp0xD$p$蓖$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$`Ƌt0<$fplD$T$4$KkE D$4$NjtPD$T$p4$kpT$4$=2t$觞Ĭ[^_]ËlЉhdD$D$p|$D$ D$D$$_Ƌt0<$ehD$T$p4$ajD$D$D$D$ D$lD$p$F_ptdtAT$4$+1t$蕝1p$dt$r1UD$E$]fffUE 9E]UWVS5ƅtBD$$褘Et E$@gDžMu% $ߜ1\$@FDžtED$<$@D$G$?kEG,w0G4G8G<[^_]USPuM $ai[]US*O,D$ D$D$@@$BUWVS5uFt09u&x<$cƉ<$c[^_]Íp@D$ L D$D$@@$ʯUWVSýƄt1fƅtptC[^_]ÉUx<$Uc1ɋU5ƅtpt<$4c[^_]ÍpAD$ D$D$@@$/US$E xt"D$ D$E$C[]Í:D$ D$D$ @@$ȮUSýUB4tB4R,…t8$ 8[]ÍRD$ L D$D$@@$dD$ L D$D$@@$:UWVS4-UM@8t 14[^_]ÉƉ׍@E$aMt9pE}<$6Ex4$C7E$a4[^_]Íu1<$\0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$ D$4$3~D$4$<4$<U܋T$4$P tEO49H1*Eq<$@[D$4$>Ɖ0[^_]Ë}4$(<E$5m=D$4$v9n}эP?D$ t D$D$@@$}E$l5n 4$;EԉD$4$J=pD$ t D$D$@@$苦UVSZE 0t$8M $dF,v }><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> ޽D$ D$D$eA$虔=2/D$ D$D$,A$KUWVS >$p,D$$UUBB BE u Ѓ [^_]ËE $DpUtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS Inu} tEt=$ot%,T$$EAE@px [^_]11UWVSuE u@1$LoDžt,D$<$GwE G [^_]ËE $otDǃ} s E uE u뛤ƐfE tM E tE o1UWVS %Ju} tEt=$nt%,T$$EE@px [^_]11UVSutG,9u=Fu!F D$F$tH[^]É4$[^]1Uc„Et ,9t1]Ë@ ]U;\Et,9u@]1]UWV2Et ,9t1^_]ËU tP 9Urptt} suuɤfuufUWVSmÒEtH,9u>P pt0t{$Ult!NjUs*ut[^_]Åu!1[^_]ftt鍃pBD$ D$D$A$BD$ D$D$A$ǏUEt,9u@]1]USoÔEt ,9t1[]ËM tM 9uL$$US (MEt ,9t1 []ËM9H uU tL$M L$@$ []UWVS u>t=~(u7Ft=D$ T$VT$$t F$ [^_]ËFD$U$11tՋ}O $MjEtFVT$U$MUK9}D$D$4$I$kjƅ,D$4$FEF~ E 0%D$ED$F $ljEt\UF$F 9:" D$ D$D$A$VE$@r [^_]W8"uE$r$iƅtEE$q1 1UEt l9t1]ËM tM 9u9]UVSélt$TM $ƃ\M t$HM $~ƃPM 1[^]US1VE xtD$E$#[]ÍUVSuJgD$L$ AtTM 4$[^]ÍHM UVSėutl9u4$[^]1[^]Uj‹Et l9t1]@]UAbEt l9t1]@]US5Et l9t1[]ËM tM 9uL$$MUVSuFt [^]À~(tD$  D$FD$F$u_D$  D$FD$F$itWJgD$L$v?HM 4$vE 0[^]ÍJgD$L$??TM ǍBD$ p D$D$ C$fffUWVSƅtBD$$UjEt E$@fDžMu% $n1d$@eDžtED$E<$vED$G$<EG,w0G4G8G<[^_]USE$<E $<[]UVSPt@9 u6p 9r<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$BuύP?T$ @T$D$#D$it][^_]UVS=fu]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍P?T$ $T$D$DD$hE >][^]UWVSLut]u {uZ~uvDD$$t4u~ tku btXD$$Yu1[^_]D$<$;t6utwD$$u븋vt%u tD$$u댸[^_]ÍP?T$ T$D$cD$`gD$/$;E >][^_]zUWVS %sUEx } $YCƅ$CCtzFFF E Ft.ED$4$ׄu`$K14$K [^_]Íl<D$4$u뵉4$CK1 [^_]D$ 4$ztFu2D$4$kD$ 4$ESD$4$-;>@D$D$4$-D$ 4$Ex UWVS [ÀqED$E$5t>Ɖ$cE doU4$.JRoU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVS聥æputFwyM MJ]ZMJ [^]$@t|] X]XMH ]X뼍D$ D$D$AE$cEt(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9r uhctBu wue[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(G"D$8D$e[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$5D$L$8D$9\$(9C"D$8D$D$=u4$9)EE8EE1҉MԉU*}D9FEE>tHED$|$U$l)uى<$%}9EuEEE>uMԋE܅Ex‰ENjp,t,t$E8:tED$ED$l$w4Gt60E<-<+<:?eB9FB 9F <;uEy69EBAAxt,tE8:tD$W $3t6WE<-QEx:T:Fw E؉Gw t01EE4[^_]ËMԋUEE$$$EME8<:y)EEw vpSẼuE MЋM؉2t,t(E8:t ED$$2EEЋO1t6EuxEEyU؉:AAxP}:EЋupttE $MЉ)E)uKt,t$E8:tED$ED$$1t6GyuEt,8tE8:tt$D$[1t60t,tE8:tED$,$%1녀z:}9E~} }؉AAxt,tE8:ht$ $0QG Iu xUWVSc/|P uǃ|P |E ;M8-pxP -AAD$-E$ǃP --|$E$^tAx:ǃxP >u|[^_]ÍrP :u>u|t E8:?부xt|AA됋|>uMx:tE|9MAAE8:t}t[|$ D$E:1xP AA|[^_]|$ D$D$,$'E 4뤿:US a-D$ D$E$蝛 []USa,D$E$]]fffffUSsaØ,E${1[]UWVSLaq,Etut4E@D$Ex E@t$9r0E@ 1҃[^_]ÉuU 9E׋EP @D$E@t$9s뿋E@D$M);u ED$1E U9Nj]C E@t$9ANE E D$ 0D$D$$F$=׋EP @D$0E Ud/)eD$ 0D$D$$F$(TUWVS_ó*UB EEEu1u}u}9}EE}B269rz])9ErEË}u sHu(u J J ZR9r [^_]ÉftEË}u rucuk량UGD$4$lƅt[UB)ǍD|$D$$ U0MJB E4Xf넃BUWVS5^Z)u} D$$$…0x@@ \D$D$D$ ?D$D$$UDžt)D$$ [^_]&1&8U$k$a&81t&8US !]F(E D$ED$,X$ []US\(ED$ E D$ED$,X$[]US\'U ED$ 1D$T$E$q[]USn\Ó'D$ D$D$E$6[]US3\X'U D$ 1D$T$E$[]UVS['uD$D$ D$D$4$[t [^]1[^]US[&ED$ D$ E D$E$|[]UWVSe[Ê&uE D$4$~7F0u D$4$[^_]tF0uҿF0UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVS@Ze%E0x$Ctu[^_]1[^_]UWVSZ(%} tE}tGfp f@UPx$MH,UP(UPDUP [^_]þEu"1UWVS Yí$}u$‹EE Bzr EBt|tpE tZE EU UtnMfH f@PM H$x,p(@DP [^_]ÍE뭋M tE E딉U!U$1 [^_]UWVSXì#UB0~4r,txM q J$tE D$ E 0xt$|$$c\[^_]US X%#ED$E D$E$w []USW"ED$ ED$E D$E$Qw[]UVSWû"uf~ tzD$4$AF0tN@9t $wF0ǀǀ FFF t1FD$4$1[^]ËFI  UWVSV"UB0~4r,t} p J$t} Lj $M Q!Ѓ[^_]UWVSqVÖ!uD$4$#nx$P8D$4$,[^_]É4$US V;!ED$E D$E$; []USU !ED$ ED$E D$E$%[]UWVS,U Et8uj}ԉt;ÿ$FFF )t$|$$H,[^_]ÉEԉ$E؍=EEu}jtw끋uUT Ex9ÿ]Ë]Í]UWVSTTuE }}$7}U1҉ tP9utLD$2@D$u4$4$PEu5ME+ЃT[^_]Áuqp4$PEtˉUED$t$E$;U뭋@E 7tSED$G$cut$ ? L$ 1D$D$2u4$ 4$P7/'WffffffUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UE@)@3U u@ @]1]USEU ]xuQwLHtCu?HH LZYZYR Q X SP ҍ1[]øUExuxw E ]ø]UExu@ u<.w]ø]UUM zuB u<.w~ 9| D ]1]UEU xu@ u<.wx 9]ø]UEu E D]1]UWVS PuU }EuEE 8tr@‹Mϋu sptftuM)ȍx)lj;>M)C E [^_]EE [^_]ø‹Mϋu ru!u)wsyPfUWVS]M}4{ 9)1UD!ЉEUE)‹E1UU֋E M )Q)ʉUEUE)C [^_]1[^_]ÍsmUVSU] z)uGB1w<v5J q 9r#L tH8tP9r P9s[^]ú9r9s)8tP9rP B9[^]UVSU] z)uGB1w<v5J q 9r#L t^8tP9r P9s[^]ú9r9s00;ut.tP9rP9rغB뮉1UUE ttuB]ø]UWVSJEEEuM<vwwٸu[^_]9rE|0tG)ϋU t9} rˋEtɋUUu_B]ZU [^_]ËE t9} r]tEMDċMnE]D몍BtYZUYM\$D$$]MUʍBjUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVS]U Et9u4څt89stEt+p9r xD89s2E[^_]ÍCōH9rHD9r밃뫋U U:}7)[^_]UWVS}M UEEt7u2t99st1B9rr9s+E[^_]ÍWĸ9r:]t뫃M1u)UWVS] UЋ}uރstft[^_]uuBfUSFD$D$ED$ ED$E D$E$Ѱ[]fffffUWVSP~FãƉ$7E1ƅD$D$D$D$ D$T$4$t1U+P[^_]Í1ɉ  rFDžDžD$ T$/D$<$utjƅD$D$D$D$ t$GD$G$ut$$tu<$F $3UWVSTDƉ$7E1ƃP ƅD$D$D$D$ P D$T$4$D$D$D$D$ L$|$4$;DžDžDžDžDžVDžDžDžT$ D$/D$$tjƅD$D$D$D$ t$GD$G$ut$$thuGtLD$ D$GD$$$#1U+u)T[^_]Ë묋$ԢUWVSB EE uE$7E1D$D$ D$D$$`PBD$ D$D$$Kt6D$ D$D$$Z賟$)D$${D$$w_$D$-$C+$譬$蟬f$N$jt$RD$D$$mU+Ā[^_]Í% @$8 }D$<$u D$$DD$/$Pt4D$TD$T$8PD$D$|$D$ VD$T$$D$D$$u$@D$D$u$u$t$D$\$u$<@$8u ]D$/$&D$|$ +T$D$$D$D$|$D$VD$ D$T$$RD$D$|$D$VD$ 볋D$D$/$d D$D$7tэD$S$tzD$e$s$UWVS:=_El$7E1rf|tffDžpD$D$$DžxkfDžrpD$<$x*rflE+u6Ĕ[^_]l<$ llUWVSP<uEhU$7E1pl } t2} K/E+Ę[^_]ƅpt BtE qD$D$E $ΜDžxfDžrlD$<$xIrfhoƅptBxB |BEBEm|l<$軦glU D$E D$E$]UWVS:ƉtE|E xE$7E1袛DžDžDžDžT$D$$ΣSDžDžDž,D$FD$${DžD$D$<$FD$FD$<$c<$#80.t&8=~4$0{Dž)_8#tf$ovD$D$$rE+Ĝ[^_]Ã(G$K똋F?ƅD$D$D$D$ |$FD$F$u|$$nvƅD$D$D$D$ |$FD$F$?u!|$D$$vD$0D$<$D$0D$<$A$1D$ @D$D$,$8D$FD$$DžD$$D$ ?D$D$4$\4$6D$t$<$轟Ƌ$ 9fDžfDžD$D$$赠D$L$$蒡Ƌ$b0<<4$'D$t$<$贞|4$D$t$<$蓞x4$D$t$<$rD$D$<$蘟 D$D$$脞D$D$D$D$ D$D$ $u(4$L=4$L=G$D$AAD$<$芝Dž{$j$褟<$蜟!D$t$$ tD$t$<$:tƋt$/뉍HG$5j$htD$iw$j뛍hG$F$iUWVSl3?uEEEEEEEE$7E1E fD$ #D$D$ UЉ$UlEEEEEEM MEEML$ D$UT$$ukEPt%D$T$T $UUEML$ML$M $M'ƋE$&E+u1l[^_]É$D$D${$בUD$ED$ED$ED$ ED$E D$E$h]UWVSl~1ãuEEEEEEEE$7E1E fD$ #D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$'E@t"D$D$U $UU3UD$$ tM 9Ht?ED$ED$E$MEcƋE$bE+uhl[^_]ÍF$D$ ED$ED$E$ME 8뭉$D$D${$܏UD$ED$ED$ED$ ED$E D$E$ ]UWVS/ǥlEdE TEPEX$7@E1D$pD$DžHDžLphP-`L-\dD$ D$D$h$lD$ h4$l贸9p< `\?.< t.cЍLDSt< A< u< t< t< u< t< tuh9>uPp<+<-hq<@oHLDD$ D$LD$r$lb؉DžH<+ti<-,t$X$lPH:f41@U+}[^_]ÉFg<@qs<@PHLDL$ D$D$r$lnDžH hUTd \4$l uDF)<@t$X$l DD$ XD$D$4$l裬tthLqUTqUT؉DD$ XD$D$4$lADžHDžL1cUTLUTLƅpl艊UWVSm*ÒE,E(E<$7E1ǃP U@D$D$ D$DD$<$@D$@ D$4$)D$SD$4$58z4@@ $S@P T$$h@@$ D$4$n0t$D$4$#a0|%=P $68$4$E+O[^_]þōD$B$…tG(D$~UWVSD"GUE $7E1$~D$$1<$D$D$ D$D$4$,)Dž!8+x$+uD$D$D$ D$D$$",YD$D$$$<$4$1U+ukD[^_]ËD$L$<$D$$됉4$<|(Q,W UWVS$7E܋}u $7E؉ËE1tX|$}<$]a1 F TFuF }؋E+u!$[^_]$!]ƅuՋ]{UWVSxfËuE $7E1$D$D$@4$ąǍD$t$$D$t$<$H҉ 0<$O0u0D$$uU+ux[^_]1zUWVSpfËUUEE$7M1ɍu4$M L$UT$4$#ED$4$U+up[^_]zUSE D$E$[]USE D$E$[]UVSD$D$0W 4$D$ t$ED$$2[^]UEȅyt ]%]]UWVS(>E؋}u $7EԉËE1tX|$}܉<$]1 F TFuF(}ԋE+u!([^_]$)]ƅuՋ]xUWVSmÒEE EEu}$7U1ҍ $mD$@$豂 \19ȋ})׉ 9}PD$T$$~3D$T$ $19|v9w}0$輂h0t 14S0$蒂>0D$ $U+uw[^_]D$ D$L$$w$!1몍D$$etыptvdvUD$D$D$D$ E D$E$]UWVSt4UUEE$7M1ɍu4$<M L$UT$4$^ED$4$U+ut[^_]uffffffUWVS‰4E $7 M1ɋ]HMPUp uux}}puuċx}}ȋpuűp uuЋx$|}ԋp(xu؋x,t}܋p0pup4\ux8X}@E]Xω]ߋu1!1߉EyZϋMTω1׋u!u1EyZlju}l1u1u1Ɖ׉]1!1׉u]yZ߉uMu}1|1u1ljMϋ]1!1ωuyZ׋Ul}1x1u1lj1Nj]!ߋ]1߉uyZM]h1ދt1ދ]1މÉƉM1!1Ɖ]M yZΉ]d1ދp1ދ]1މËu11]nƉlh`1NjE1Nj]1lj׋l11ωE]n߉d}1NjE1NjE1ljl11En׉h`|1NjE1Nju1ljϋh11߉ulnljl}x1u1u1ljh11׉unϋlh|t1u1u1lj1׋l1׉|nllxp1u1u1ljhl11ωxn߉Љt}1u1u1ljl11׉thn׉p}1u1|1ljωd11߉plnlj}u1u1x1ljd11׉lnωU}u1U1׋t1׉‰ߋu11ljhd2n}U1׋U1׋p1lj}11ωdn߉M}U1׋M1ϋl1ωNjU11`Un׉}M1ϋ|1ϋh1lj}11߉\nlj]}M1ϋx1ߋd1߉ÉM11׉XM nωU}]1ߋt1׋`1lj}]11ljT2n‹}]1ߋp1Nj\1lj}U11ωP]n߉M}U1׋l1NjX1ljMϋE11LEn׉uE1Ƌh1ƋT1Ɖu11މHnƉ]|1d1P1ÉމM11ӉDMnىMx1ً`1ًL1M щˋM!ˉ! ً];ܼى|t1\1H1M !׉! M}MܼMωuxp1X1D1Ɖuu !! }ܼ։׋tl1ڋT1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋph1ȋP1ȋM1E ؉!! ȉEEMܼEuld1L1u1MM !! u>ܼΉ׋h`1H1u1‰U ֋U!։! uܼӉƋd\1؋D1؋]1E !! ؉EE]ܼEÉM`X1ً]1ً]1MM !! ً];ܼˉى\T1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋXP1É؋]1؋]1E !! ؉|E]ܼ|É|TL1ً]1ً]1M| !! ً];ܼˉىxPH1ڋ]1ڋ]1‰׉‹x ډӋ|!Ӊt‹x!ڋt ډt7ܼӉډLD1؋]1؋]1؉Ɖ Ëx!É! ؉p|ܼÉ΋H]1ً]1ً]1| ։l!! ً|x;ܼˉىD]1ڋ]1ڋt1‰x Ӊh!! ڋxlܼӉƋE]1؋]1؋p1E !! ؉lEhܼlÉlM]1ً]1ً|1Ml !! ً];ܼˉ]}1}1x1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhlh}u1t1u1Ɖ11߉ublUu1p1u1‰֋h11ʉub‰Uu1|1u1‰։ډd11lhbщMu1x1u1΋d11ubˉhEu1]1؋]1Éh11Љ]d3bƉ֋U]1ڋ]1ڋl1‰Ӌh11ʉ];bdUt1ڋM1ʋM1‰щd11‰MhbӉEEp1ȋM1ȋM1hd؋M11hM1bt|1ȋM1ȋM1E11ЉtbӋpx1ʋM1ʋM1‰щh11p]bډ|M1ʋl1ʋM1‰ыh11‰|9b׉}xM1ȋM1ȋt111؉xh9bȉߋE]1؋]1؋p1ËE11Љh3bƉu]1ދ]1ދ|1Ɖ}11Ήd};bM}]1ߋ]1ߋx1lj11lj]M b߉ ;E]1؋]1؋h1ËE11]bЉЉEEl1؋t1Ћd1Љ‰1M1ȉUM bȋMUUEU1Ћp1ЋU1bʉU1ЋU1E1؋|1؋]1bʋE11E]1؋x1؋]1<bʋ]É11؉؋]83uF,lj~@ F 0A4$7M+u [^_]É_UE#Eg@@ܺ@ vT2@@@]UWVS UJEˉZs Zȃ?H]Ã?@)É]< u EEuzEJL$$UPE);MU֋} T$4$&ڃ@;Ur)]] E< u sHtft [^_]äfEwu^uDMEMuPuX] uD0Ezfmu KMfUWVS$Eu] $7ENjE1U1Ƀωу| uىUD$}䍇D$$C%=Ut, D$|$$C%=u݋UD$T$$t!1уuuE+u$[^_]Ë]\UWVS(E؋}u $7EԉËE1tX|$}܉<$]o1  F TFuF(}ԋE+u!([^_]$)]ʗƅuՋ]5\UWVS>EE EEu}$7U1ҍ $sD$@$]f \19ȋ})׉ 9}PD$T$$e~3D$T$ $319|vZ)0$hf0t 140$>f0D$ $U+uw[^_]D$ D$L$$#$e1몍D$$tыptvZUD$D$D$D$ E D$E$]UWVStUUEE$7M1ɍu4$BM L$UT$4$ED$4$U+ut[^_]cYffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVuMMMEM <wE)Ѓ9uEEED$D$|$ ED$D$4$j؃,[^_]ء8 uEƀUGffffUWVS^Ã} $7E1D$D$HtHE$܆t=ED$D$<$s;Es1U+[^_]ø"㍅D$E$rtt@D$E$ru[ED$D$<$;EsED$|$ H%D$`d$T$1U蘠.t&DP7UWVS ?\D$LW \$E$Ɖ؅u [^_]É?01UWVShL[ ut$$L[ @B1E}E1uNjU:ME1uEHt$$PxxL[ @B1Ƌ}E1NjExME1EH D$E$"u(L[ ]ٸ@B1E1؃h[^_]øh[^_]$';&L[ UWVSD$5D$E$RuE0,@t&tD$E$萄u܉[^_]D$D$E$Rt 1[^_]ËEpD$CD$4$XRE@<-u?EPP-DPtEPD$ ED$$UMU9p9g^My+th)ƍF߃1BD$jD$4$QE@t<+ !M?!U@E?w0,t u]Ë u@u1]UEP>w 0,]1]UWVS(͞u}܉|$D$4$9xINE uG>wl/7EظE! EED$|$4$([^_]Ã>w2/7EظE EF9UWVSu4D$ toD$D$[ <$Yy)l[ @-t@l[ [^_]ÍU T$ t$)‰T$$Ά뵍iwD$D$[ <$fffffUVSX=v^ot.&vnuucts Ƀ E u p}+t}}-t}=uP[^]Ã+t-uuPU #UP[^]ÃXtguu-tH@+؉M @ @+؃밉M 뫃P묃PUWVSEu gt,C-X.t&u!E I@t pguԉ%+t[^_]ÀouuPӃt>Mt }#x!t }#x!t }#x!rt #X t #X ރI#H ΃?lP!փ&EjUWVS\?u>;EEEE}|$EԉD$$c9$i$E iD$|$$49E٘D$D$Ẻ$ׄ赘MẺE0EUP-DPuHщMEE1EEUM]L$\$ $T$]!9tu׉EUM]ىeщٸ9и| E ;ED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]D$E D$E$q9} P[^_]ÍEEEE EEAAE*uf~*u1f~*@DFP9\XD$lD$ PD$|$\$phd…hfDžHdf8,D$D9hD$$`d`l@ @$TP `T`l@ @DTt4p8`$TЅlS t%XYLYL! x . h9pHfKfu9p}H@u5l4d76|%= P\hS89sfC/fXD$lD$4$pd}hfDžPDž@DžHdf8tld[u|%=@tp1ҋf?f[uZp!!f90f[ʃfu‹ffP uO f?ʃFW Ӏ_ Y9t fx*f*ʉك |$|$<$jU+*D[^_]ÍJfzuf[Qy f2f]u답f[!u pf@!Wf]tI׉΍Nf%ff-uGf]HfF-Nf%fF_Wf]uH Af]O9]D$D$ D$D$$w-|nP f 99sWfPfu9t.P9fx*P9fx*ʉW 9= |T$ D$)L$pP$*2I$E…@D$D$ D$D$$,@u\1W-f[!ʉfH98MRUWVS Ӊ9x)ڍωރ׉HPftPΉ1ff}t[Fftf[tYf{uFfu勝M E1 [^_]ÅtJF뜍~Ff]fu{rZf]tFr^9r1=f[uSf]zfً9@S{f{f,uu91ҋLf fuM A}1xDf5f}4vd!qQf]tyىC)D‹΃s tfFu@ύSً{ fsJfPUWVS oƉ׉MB tA PQ wif>{tBEEft>f{uED$E$ZuۋE[^_]f~}uf~uM[^_]lUWVSU}DžDžDžDžE uGE E G EGG؍uE uM}fH9z مtz\uJtE@̓fH9tiJufE tc[^_]É\@[^_]G4}뫋}UWVS;mEPtF@cl}M |u$7t‹E1t E]ƅsM\L$$;uIEL|sxED$D$<$O|1EEċEEȋEE̋EEЋEEԋEE؋EE܋EEEEEEEEe0fEEĉD$D$$ WIƅrt<$]D$|$F$+ ||EEdDžhƅxE`ElUEEAdD$D$`$ tu{h<r:sDžlxhE$ u`h0lLED1EID$@t$EE EƅsuPcE$uic0yD$D$F$/J$}5Dž E|ƅxDžll$Xb1E`DžhECD$D$F$E!EEE1ƅsu3ƅxqFTbp~EL$X<$9…EhxhXM >l/hHhωxD$xD$F$usދhEDžhEYaY1lrs2lƅxrhu"E ?ƅxDžlƒhE`D$T$F$E<Džl|DžlmDžl^Asƅx1l31lEƅx1lEUD$D$D$ ED$E D$E$[]UVS虖þac tGUE tE 8 [^_]D$ ED$4$<xT}untHuG<&w0t$$^D$$^t$$^c WuAA@9|w뵍8}9,@뽍q~ЉED$ $^EEUD$ $]MEbffffUWVS83\$7E11҉g rc M h D$ D$D$$\h T$$D$\|$4$BH08t߉g 8#mD$\|$4$Ht8t㉃g D$\|$4$Gt8t㉃g D$\|$4$G8t߉g ǃh ǃh D$\|$4$Gt>8t$h D$\|$4$fGt8t$Цh D$g D$4$?*D$\D$$Fƅ8tщ4$pLuċܳtܳ >t|$$fPuቻg ?xuxu U+8[^_]ÍD$\|$4$@F.8t߉g 8#kD$\|$4$Ft8t㉃g D$\|$4$E8t߉g 8xuxxu x g 8sxwxg D$\|$4$EtM8t$h D$\|$4$WEt"8t$h g ueh D$D$D$YQǃg B#T1mǃg ǃg ɈT$$NuUVS詌W h tutKg [^]ǃh D$4$E h ut$۲$1[^]UWVS.SWuǃh h t-$W\t$g $MtEu1>D$<$D h uщ|$۲$W1g [^_]UWVS萋õVuǃh h t-$[t$g $MtE/u1>D$<$TD h uщ|$۲$1g [^_]UVSVǃh h t$[[^]ÍD$4$C h u҉t$۲$81US聊æU h t$9ǃ h []fffffUWVS@AfU]ԉUĉM؋uUP-EσUFET]DCtEL- ?*VЍL]DS<*EL-u<*tЍ\]]DStڋEЀ*Ҁ[\U؃] ȃ]^]^]tu܋uD^]u?ɍv*F[\U؃]]u\9tV@[^_]Ëu].t}4$d+T9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vi 9u(Ƅi [^_]Éր>/t>9hi ǃstftƄi [^_]ÉڍbffffUWVSm&8E$*}|LP-DBL-fkfbfg@5D$ ED$E$8EUE8E9t8u|58"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs 5[^_]þUSk6D$ E$[]fffUWVSqkÖ6}tz?tu<$(D9u p9ti8/t9t`sc~/t9u)=vm ׃rtftƄm Ѓ[^_]ø9h€8/t Ƹ봸bUSuĉ}Ep4uEЅ`MqUMEDJ@tDZ@uMEЅ$u6MEP $ƉEEMM߈]]u}Ѝ~}E@}GEЅ>MUЅM E؍E@-D$ ED$T$<$ƉEMEU$c1ɉpƉEE M]ȅt)ExQ)؍)MEH}eMEoMMЅGEP$1ɉƉEM =MEU$nƉEE}GEЅMMU$5xƉEMwu?%}ЅMEU$ ,ƉEE}GEtYMUЅKEP$ ƉEEx @uMEЅM E؍uЅETMEЅE؍vM$=1ɋU[ƉEEMEP$1ɉ.ƉEE gMU$ƉEM踓$I )؍))ыEHEMPЀ E MEEЅMU$c1ɉoƉEEȅmEHQ)ȍEE}GMEP$;1MEP$ EEЃ} uG' MEP$1ɉƉEEUMuDBuMU$c1ɉwƉEMEMpMElU$'1ɉ5ƉEE-l}G}eMvMEMEЅ7E؍4}%]ЅE ,}tz]ԋEpE@El‹}̉)ЍH$I )Ѝ))ыUčD)֍D)}G؃Eԃك}}}Gw}Dy@&V؃DY@u] utU܋DB@UЃ@)FUDBb3v%ME)EERUЃAD$1$E؍ډ[t"UB M)i]D$1<$Ed,ډM]K U 7cULE@-D$ ED$E D$E$b]UWVSDK Eu q 9P<MP  M܋HP UPUPUElS *GT$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$9D[^_]Í*MP M*MIH??? F??? F?? ?F ?:??F:?? F????fF 늍H9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ (HD$|$4$9WT1D[^_]UIq D$E$]US8IEЉD$E D$E$tUT$$8[]US4IñEЉD$E$ytU T$$m4[]USOItE$tq T$$4[]fUVS<I7U E$7M1tHMȋHM̋HMЋH MԋHM؋HM܋HMHMH MH$M@(EMEȃt'tTt7U+uR<[^]ÉD$D$t,E$ىD$D$t,E$D$D$t,E$8UVSu] 1t  9t)ʉ[^]UWVSGEtx $MnxMMEpEt';Uu"|$t$F$ʭV9UtމuE tH9uMtFE]ȃ[^_]EUWVS WGtuU Mt;A t+ ÃutF\$D$$ [^_]ffffUWVSFD$E$0EfU [YD$}|$E$(ƃbE $EL\270t6Eu1[^_]ÉL$M$UUM $+ tE $EMʉNjusStftM|=Eu stf`Zu@u'ӨuPu[똋E|fExUffUVS E/E UtuD$E$ [^]ÉT$D$E$&ƅu E [^]ÃTt 01  1UWVSDîE 0E,}$74‹E1}~D$D$E$bS9hDžDžD$$δD$h8$蛵hǀPǀTǀX84$8Dž@fDžDUfFHDžLTDž\dDž`DžX|$ ,D$0D$4$'fDžx 4$u%4E+u,[^_]  ǢUB UT$ U T$@-D$E$]US yBÞ ED$E D$E$C []USHBm ED$ ED$E D$E$NB[]ffffffUWVSB& u}}t}D$4$4$F0tN@9t $F0ǀǀ FFV Ш\}UED$ED$4$U …tKME 19t}ufV M N~t<F߉~,U}<$yE U1ʀFE`!7 D$4$E[^_]ÉUF$U\}1EfV FVCVFD$4$@E[^_]É~nMU<$E UMt1@f9t%U $ME MUt σ `UVS? uD$4$~V(4$F u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$D$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$D$D$D$4$UVS> uD$4$WV(4$|F D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$EUw0E[^]ËVPNTUMutt+FEUTD$4$D$4$wUWVSs=ØE8ep >EFt$EV tQFtB1ɉωMT:0$!V T:($V D: $M;NV r$F,t$F4t -$F8t$4$[^_]UVS<ê4$薭Lr D$E$R=4$y[^]UVS@<e4$QLr $9=4$;[^]UWVS<&<$Lr D$$AƉ<$[^_]UWVS ;uED$@$*_ED$E $_…t?t$U$3Ut'zu Ńtt$$ uUEHutU$zEUЃ [^_]UVS;+ 4$r D$E$l^4$[^]UVS: 4$ҫr $^4$輫[^]UWVS:ç <$蓫r D$$^Ɖ<$t[^_]fffUWVS -:VUP-E܍uu<0 )E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruuTM؋ut}u9tvwn<.uQy<0#BÃ߀XtXtbEf)Ǎ|&uԄIEDX@; [^_]BuԍE9t1 1UWVS 8ù聚D$D$,<$$E tED$E D$<$[D$$ E$US8BTUT$ U T$D$E$qdffUWVS7}Et5[^_]à M MlE} #>E11} ;cgEEE}u#Ћu0}91dtt<u|7u9tȋ}*E TP-U P-DPttE 7] Ј} #} U P-DPTu Vɨ=E bE 0<KE] DЋuQ} -} ^E nE TP-3E 0EEu } \JEt } %EEt } &=Et } =]E EE} ?gU  Ћu9E TP-7E 0] E } = ]E E 0<E] DЋuuE } ;U P-DP"EDBE ]=P-u DpuE /E 0uE E EEEE\EoE zE iE XE G}d}uf˓EcmduE 0 E P]L-WEL-W ti1WL AUWVS,1} EEEP]tsMM؍MM܉UE< )؉EED$ E؉D$ED$E܉$wAhMEE@uEYYυtl+E,[^_]É{MAt>U9t-ECR uEyt E됉UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$^]UWVSE0jur />3)Ѝ)Ѝ:~ 9w$&r umP"U$Ѓr DU4$Ѕt?w$WD$ D$$UUЃ[^_]É4$Duw$Wt$ D$D$ $UE Ut1҉Ѓ[^_]Ër t;U$(NjU4$DCЃ[^_]ËPǃr 뫋U tuW3ǃr Dr ^D$$=?r Jǃr 1+1UWVSJ.our ))Љ):~ 9w$&r um`"U$Ѓr TU4$Ѕt?w$WD$ D$$UUЃ[^_]É4$Tuw$Wt$ D$D$ $UE Ut1҉Ѓ[^_]Ër t;U$(NjU4$TCЃ[^_]Ë`ǃr 뫋U tuW3ǃr Tr ^D$$Cr Iǃr 1+1UWVSN,s}E$Džr fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$}MAF$U 1[^_]Ër VD$ ED$$E$H@F$맋r uP$Ѓr $(ƉuE$H@Or aPt $Ѓr @~Pu㋳r uED$$=MƉr lǃr ǃr IUWVSO*t}E$Džr gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$}MAF$U 1[^_]Ër VD$ ED$$E$X@F$맋r u`$Ѓr $(ƉuE$X@Or a`t $Ѓr @~`u㋳r uED$$MƉr kǃr ǃr IUWVSO(tUELtЋr t'Ǎt$ 9uǃr ǃr r t'Ǎt$9uǃr ǃr ǃr EPE LEHED1[^_]øUWVSd'ÉUE\tЋr t'Ǎt$59uǃr ǃr r t'Ǎt$9uǃr ǃr ǃr E`E \EXET1[^_]øffffUWVSj&pUE DžXE/tBD$E $p8%E $uv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p])%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $pMDž`&$`pcD=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5p=?t9E tX$p1nىf t~uf.륃8/utщ$pE tE XfE pHE /t/tp p?p>1UWVSb!Ç}E ttrD$<$c xX[^_]Et$<$}DžMtAt$$# ymt 58"tƉ<$1[^_]1fffffUWVS }<$)r $r ǃr 7tyP-E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ër t$ǃr ǃr  yEUVSE] :tu1҉[^] 8ut$8tù@tσ}:t$ u}:t;MuPx@t[^]Ät:u‰[^]U 5Ud]UWVS}u 8u u|t1:t,t(9s:t|tu[^_]1UWVSlǴ] $7‹E1}! Mu$r t\$4$,$蜹Dž  DžUD$ D$D$4$DD$D$ D$D$@4$$D$D$@$E<DžDžƉ1ҋ9slpȀ ':Dž\1҃ t t DžO9ϋ9rD$D$E$چ@؉؍pȀ Mx@<#D$$ߍAdbDžSD$=D$<$… <:<uz)ED$T$E$qƋtg<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $vT$t$<$`$>y@E<$Dž:ύO9))|$$)ljx1kO1tCȋ)Љ)Ћ))ӉL$$vÉNjÉC:{DžtE$у)P9rg8E+l[^_]D$ D$D$E$DžD$<$hxr $ Džqt$$"DdcƋ40<$%0Džu*$ͺE$ËE$ jnƉ<$p$D$ \$|$4$V tBt(Pu2Dž4$VDž$EH $-DžL$T$${4$Vf18Dž<$,tE$艀/ <$ 4$Vċ$u/$褸 {tE$UUD$ED$$M E]US#Hr t$\ǃr ǃr ǃr ǃr 1[]UWVS,EE $7E1Džr r P-r tr D$r $j6D0Dq@:#r ux|\u ǃr ׍:\tWut$r $5lDҀ|\tǃr ǃr r $AƋr $^ǃr r Pr @L$$r dǃr ǃr ǃr f:wu<:tAt<|uD$t$$ƍ@E+/,[^_]Ër $uhr $*ǃr +r r 0D$r $r Kr t$贿ǃr ǃr ǃr ǃr ǃr Zǃr ǃr ǃr -$?ǃr oUWVSu} r t$ǃr ǃr ǃr ǃr } u[^_]UWVS fË]D$=E D$E$$d轪Dž<:}dUN<\Έmt>}<:tk_]J<^uF<:mu‹]U)ӉߍCdD$$]\,ljEEd<:uU_F<:PЀvH2Mɋ]FE1U]ND9ut 0vU] :U]؋})ptD$<$]mEtcE] [^_]ËU }1볾ʋE$]s뵋] <$]QUWVS( M]D$=E D$E$e$dƅ<:d <:t?Ytru)Cd]D$4$]`Mtƺd<:uȉƍX)ˍ{t7Ή\$4$]"u 4$]j@ȉ)ˍ{uɋE[^_]1밿4$](ы]B UVS D$#E D$E$6tv80tP 1F<w1F9~ƒ1F< w9E1 [^]ÍF<wF@ cME E$7NjE19<$D$/<$AADžDž֋D$D$$u8w<|::u E+e[^_]ÍȖ$ƅDžDž"<:t u9) D=OD$ |$t$4$ Ƅ=/Ѝ|>ctftƄ/LHDžDž)S$J9>:7 81Ƀ4uA )čD$]pxr󥋵t$D$$sD$ D$$lq|$t$$XqD$D$$:qudur9h19hrBvBDžfzngU T}\27D$E D$E$]UWVS#H}U $7E1EtqMyu )čD$UPtMP}y:u}\27T$D$<$qU+ue[^_]øffffUSsØD$&$Lw D$ 4$kH w []UWVSH!Fu} }ԋEE$7EЉE1\.D$l$zw u}MfMUT$U܉T$ D$ UT$$buM vU܋9Eo} u w t%9w t1uЋE+H[^_]Á} u w uD$D$ $UE؅tEċE؉$YKfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$UDžuED$UȃT$Ẻ$;EsE؉$X % ЉD$L$8<$褔L$8l9t$LbYD$<`T$cE$ ML$ M L$ML$@$R8u E[^]É60E[^]UVS@-$ ML$ M L$ML$@$R8u E[^]ÉМ0E[^]UWVStÙa5D$D$,<$Et8ED$ED$<$|$ D$D$=$^E $~D$D$$螋E$QUSD$ ED$E D$E$;[]fffffffUWVS8}ÉEċ}u t$E$0Eȅuu}EEEE̍Eԉ t1 E U]M!ىˋuM! u t뷋]u!M܉!щME܋UM t1҉EԉU؉ƋM̅t_Mx+Mw&E,"EԍHwq{E@N4$]HvtEԃ0<Eȅu tEtJM\Eԉ0҉Q0A0q AEЃEЃ8[^_]E@uU\UƀtUMƍBEЉ4$]outU@^GE@uQ4$]puuT tOFvGE Fv5 *-UЉrBEBEP-DptGEЉ7EЃ8[^_]ËEԍPEP-PUȅE\@sEU\B0E0<UE\@aEE\@nEpE\@vEUE\@fE:E\@rEE\@bEE\@tEE@0@ 0E^?iE\pEUWVSý}U EEuEE tu$UsUtT t! tT$U#$x,Ut== $GG W[^_]ÍB߃]wʃ=uËEEuEEU }[^_]SUWVS}u EEEEEE4$'ruI.h v.%P$GG  O[^_]ÍN߸?tċEEEEEEu }[^_]_uUWVS%JʋEE$7ËE1}}P EuD$$_l( D$<$'l) vDžE %@  1)tru䋅D$ v D$T$<$qx9 ru1ɸ)u)lj9usu$蹈D$$jp 1󫋅t# 9uE t *p#H uE t '#H uE t E t E t E t "E @u \E E [Lb wT$ L$ M L$KL$$ׅu͋ǒ$m$qm$cm$UmE+Ĕ[^_]Džu%f贌 (fqX1U11҉#UVS#EE$7EE EEEMED$ UT$UT$$1{xEU+u [^]1"UWVSƨEE$7EEEEEMU ED$ }|$}|$$xEU+u [^_]1"UVS,u t44$D$ UT$UT$$1ҍE[^]1UVSڌut54$1U D$ ML$ML$$ED[^]1UD$ ED$ED$E$M 1ҍE ]UU D$ ED$ED$E$ME]UU E D$ ED$ED$E$ME]UVSEE$7EE EEEMED$ AAT$UT$$1BxEU+u [^]1e UWVSLqEE$7EEEEEMU ED$ AA|$}|$$xEU+u [^_]1UVSϿu t74$K}D$ AAT$UT$$1ҍE\[^]1UVSzßut84$|U D$ AAL$ML$$E[^]1UWVS#H}u t74$|D$ AAT$UT$$1҉[^_]1UþD$ AAD$ED$E$M 1ҍE`]U胾U D$ AAD$ED$E$ME]UBkU ML$ AAD$ED$E$ME]US *EEEEED$E$(E []UWVS$追DžE = t߆IƍD$D$ t$|$$ tyDž 9AD$E$~uƋI} t9rcJ8 uv9t<$`$XDž谅9t4$c`Ё$[^_]ÉUE D$E$K]fffUWVS&ƃ ‰ ‰ ‰ ‰ z|$F$\tF~1[^_]øUWVS虻þ9H rn~t PRuF$D$ D$L$M<$=^ڋM΃tyE:BGuETB[^_]ÉUy(MRED$|$F$SpM.Uu ~ MLЃ[^_]ÉUWVS蹺ޅljօxlxD$$UtE3G4U3W0 u|3G}/Ef@H!V(EċHDhUWVS$WzE} bD$,$]Nƅ EF$~(E }1҉u׉$]{l9sǃuuV(F$}AA}܉Eq@DEE1}EC]E  $M]kÅMV(F$ÅP@DECCTCF(fufCHEwCMEX]E e}}UtEv NjV(F$MtKxf@H F(E$[^_]Ë}]v$]GQuE$]5QF$]'Q4$]Q1뤃&]]v1s}D$D$@]9h$YF6N(-E$]P%V(F$M71EUWVSEjw}tH@JHDy$1PVDxpup$PVDy4$Pwtv$OuGt$OG$OG(t&<$O1[^_]Ë@$$(dG$ ƃtG$뻉ttEG$<$fOEttUUWVS,Qv}7QG(EVLfFLNHtlfv$NVDFLf97tȍD$ $D$D$$iQffu@tUV8N<3O3W tEFJ Gt uƉv$TNuuGfFHuE[^_]ËOMt+tKG(uΉv$ NuuGEGu0G)tE뛨uNjGEGGMIQ(rI|/u/uV,UT$VTT$$v7E[^_]Ã1ɉCfFHpu$3M~DWMA(AD]uFJF$G(u$F$$VMy fAHG(uG$F,F(NTD$ML$G$D$/M $At;9EP$Ue@MD$UT$E$HMN,GFFF8Ve[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$9D$L$8D$9\$(=h"D$8D$<$> d01d0c0ƋG$$ G$$>.&c0UWVSxÝe}D$`<$t.ƋM t[^_]c84$pc81[^_]UD$E$]UVSeu|D$4$4tOE%=@u5D$D$4$t#1҉lĈ[^]b1Ĉ[^]fffffUWVS8aÆd]E@ EEܩtE}ԃt MEԨEeEЉ}1E1Ew?E܍ 0MMT$UE$]9U})ljEuUD$ D$D$E $]]GMAQt$|$E $t~")Ɓwe]a8}}؅:UEB ERU9ia1ҋEHE1$ƋX t tE9sup)9~Љƅ$]F3…EM9st1]D$ D$|$$U U2t|zuEԃEU܉ǀ t=~tQG UJ L$$]XG uËEtG~uU܉$]:EEE@ EEUPUE)‹EPE@U UԉP $] 18[^_]ËUЅAE$]:D$ D$D$E $&Em@뫉}UE܉BB$]1UB tqE@@eBE $]D$@E$E EUP ]_uu1]^uUWVS聕æ`}G $9wt6$s9uG[^_]US;``E D$E $V[]UVS8+`ut& == =$ED$E܉D$E؉D$ T$E D$E$=t3w $Ef>@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]ffff̀rS[^=[UWVS E<؉EUt`ME9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu [^_]UE]UWVST7^EU }+ &E EẺ׉U }G$]b.EȅU Eȍ 8MЃƃЃ)UӋMщMԋUT$U$M‹EUȍD]Љ]\$EED$]$U1ɅMM9MXEEUȉUEEE؉E܉}ĉuEM4u}ԉ9du E9s#ED$ED$4$U9Etщu؃9M؋]U+uED$T$U4$U}9NjUt +EMC6ˉUE‹E9r]U}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ċu]9.EEE}}čGU9 Eщ}U܉EA‹M)ʋ}č M9~ȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅?U!ED$\$<$UU9~]E9rՋE9M̅qU܋E 9r}G9C)EE܋M܋E}89uM܉E}9}M9M M]E̅{U܋E}Ћ029r}GU9IЃ)E܋}EԉE9JEԉEG׋E9EEĉ$]21T[^_]ËED$E$MEEЉEȉEċEE뱉ˋ}M 9sWEƉ}Q+ME }uڋEE‰]M؉EE HZ9Eu]M9r}M3E}ljMU]XJM9uˉM]9sMˋMUzUuދM9U]ۍuM9ƋED$t$<$UM9Ӊً]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Yu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}ZM]U9UU̅U܋E}ԋ029rUB}9G)WUE9}܋u9rUB9)]E؉ËuEߤ9uu]]U+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE'}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UlEЉE}ċuEMЉvE؋MuuEU)ЉE؉ڋE]XJ9u]uE}9EŃ}tu|$}ȉ|$$]} SU讉TUT$D$ ED$E D$E$c]UWVS mTEuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]$t"N^HXVP MF [^_]ÃUWVSTud6uu[^_]=F$$4$*NjF$$[^_]UWVS脈éS}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$6GWG1D$<$tG9F [^_]fffUWVSSuQ8F}9FiF FD$ D$D$$d6FVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_]KP1}9P81F u1UWVS؆Q}d6t2G$$D$<$ƋG$$[^_]D$<$Ɖ[^_]UWVS gÌQOEOd60E@$$SD$E$,ƅ@ ‹} >HE@$$OtlEM 1 [^_]D$E$ƅt[P } uuuFNuN}8눋E@$$WoNuJdN}8E YMNIf뱤&fvftN [^_]E xDE xfffffff̀rS[ÄO=[ḃ̀rS[dO=[UWVS$!FOEEE EDM8D$D$ED$ ED$D$E$,t 1$[^_]ÉL8 uL8US蝃NEy \'9~)ML$D-D$E $31[]ÉD$ D$ED$E $A1[]UVS(MNEy \';}.D$@D-D$,w 4$R3[^]ÉD$ D$D$@,w 4$@[^]UWVS訂MEU MtFL-;4ut/M9t(\_rtwf9t)[^_]1[^_]fffK̀rS[TM=[UVS:MulimNA90%[^]Ëtph9rltp[^]9r싋lUWVS蝁ǺL}l^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓tp419|[^_]Ë]싃tpu޾ UVS耀åKL4$ulU4$t[^]ËE4$][^]UWVS #HKlEL4$(l@}C}wSǃǃǃE lhE MH1} 4$E [^_]Ã}?vB}<6lp)ȉЉAUE PlщU쉋hEUpU)Љ?}҃?}}}Ƀခr4$EUWVSy~ÞIlEẺEыE)ȉE䍃LE$ZɋUl@%$EHlt)̋Eʉp1thE$E[^_]Ëlp)ȉGfUWVSo}ÔHL<$7Ɖ<$q[^_]US 6}[HED$E D$E$ []US}*HE$g[]fffffffUWVS|GƍE]UWVShr>$7E1D$<$E?&L$$L$9~L$ T$D$<$ U+u h[^_]7ffffff+̀ffffj̀rS[$==[ÒrS[==[UWVSq<}u t$<$pu 1[^_]D$FD$<$tۍFD$<$9tȍF D$<$&tD$D$D$ FD$t$<$ zUWVSq4<]}E 0|$E$ti?9}rfeUD$$]_ƋE 0u+]썃%D$$)1;E8ut@1ۉ}ut|$E$}9]uU:t-[^_]ÃtuE8utuEE $]E E벅{UWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVSoð:u $7E1Vt(8.E+VЁĸ[^_]ÍF\DžTDžX)DždhV\f9DžllD$`D$ TD$XL$U$ …UD$dD$ TD$XL$E$…hD$t$E$m‹\f8\q7P\p9\hD$t$E$g\7P\{F\DžTDžXDžhhD$pt$E$Rgq\D$ hD$D$4$L\D$`D$ TD$XD$E$>\ Dh̀rS[7=[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS ^kÃ6u}F9r+)F|$E D$F $Q~  [^_]1 [^_]UWVS k-6u}F9r+)F|$F D$E $~  [^_]1 [^_]USj5EU ]t,HPP UP[]ÍlfUWVSqjÖ5}u t$<$t t&t 1[^_]Ãt$<$À[^_]ÍFD$<$}t̃t$<$l}[^_]UWVSi5}u t$<$ku 1[^_]D$ FD$FD$<$ntԍF D$<$,tF t6u$FD$<$|tt$<$|듸[^_]ËFE }F[^_]UWVS6i[4}u t$<$u[^_]D$ FD$t$<$赀[^_]US h4D$E D$E$ []UWVSh3}u t$<${u 1[^_]ÍFD$<$ t~uD$D$ F D$t$<$tUWVS5hZ3}u FFt 1[^_]Ét$<$d{tFD$<$~~tӍFD$<$>{tF D$<$+{tt$<${USg2UE JttH[]ËJuL[]ËJ t't@H[]RP[]JHRP[]ÃwJ% JHR P[] | q f[@HFfffffffìrS[1=[v̀rS[ô1=[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^UWVSEu MtXMX89t=JuMtBu {U tr9uu 1ۉ[^_]ÉCu1[^_]1fffffUWVS(^eÃ0Ɖ$7NjE1D$ |$T$$er<$"@9EZUT$|$$<Fu1U+([^_]E @NteulN u`L$$j '$!HN tD$ #D$D$ $4t9urD΃sztft%D D$ #D$D$ $ _u-ujFfUWVSb .ƉЉU $7M1Ʌt=~t3E+ȁĈ[^_]ù۹Dž9Ffx&tvEtoEfD$ #D$D$<$<$v9EXED$|$$&Vu5F~uN uF=tu ~tMEEcED$ t$|$$a4$9ExED$t$$F1@FȉC:9<W<DžE3UL$ L$D$$8<$9EED$|$$d$ a+D$D$D$D$ D$؍l&DD$<$Stk0$`{ED$E$F <tt oEu̓t,ED$ D$|$$_t14ED$E$B1襾UWVS<^ñ)uU EEMEE܋EE؋E E$7E8}1wc~w]F%vIE܅t }؅tFu f~V~Ή}U+<[^_]ËE}+8EԉEE؉EE܉E MM<[^_]vE܅t U؅Et1댋E܅t E؅FfVT$D$ *D$L$M܋E$DžM9FF ftV ffuu҉T$D$ D$ȉM)D$4$rMx 9=EtEȃiviD$t$E$ 1T D8D$ #D$L$M܋E$M܅x9E4FD$ &뻋EYQEE@DEԋ}1AAE؍.E܍͸EЋE؉M؉u E8EЉT$D$ E܉D$t$ $M+MH9@)ƃu1q҉Ű}UT1AAE؍.E܍͸EЋE؉M؉u ET8EЉT$D$ E܉D$t$ $M9M)ƃ9}u1MFD$ #D$D$}<$C<$M9L$|$E܉$ MUU܉D$ D$ȉM)D$$M}9nD$T$ *D$L$M܋E$MUWVS@Y%lj΋E$7EG uY$Yto|$$Zt9wuҋtD$G $u1ffh$@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$/kO9Aff9't0G9T$D$G$=t$ |$D$$"[u8u Dž11fB获UVS vWÛ"ut$F $QXE $MUYF t [^]ÉE4$-WE [^]fff̀rS[4"=[UWVSV"}E$]xkUtD֐6t;F txu@9uD$FD$E $Uu 11$d8[^_]1[^_]UWVSTVy!}D$<$GftD$<$[^_]þfffffffUE.߃At..t!.t+vPЃ v-u2-.u…uҸ]ÀvPЃ v_u_1]UWVS UE Hzu;9]苰uυ0qD9sDw]Y}D9~D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}ND9OD<]][D9^DυYDM9YDM}B4^D9_D(뮅f"f 9DupR?UWVS$E@dtfɍ<ʉ}ЍMԉu7APWЅt#xuPR#l;htՉNj@u݋F9]uAEF$[^_]ÍMUSRäPt@uQPtuHuX uHuxu t1[]PtCu[]W/[]@ FtPtC1M]\$ ]\$D$$>t@M똸DD8D4$DDD8,D$|$D<$8ЉD1<$(\w1Lu .8t189 u拽,t t҉11蝞UWVSp>æ Ɖ$7NjE1>$$11 rFFtGGFEN]1ɀ.уu9`d9@ HDPDDžDžDžDž<$p#8=R7\3G u$1ҋ$`{[$e$W1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$$U+Rp[^_]Ë넅tJPd9\.$1ҋD$ D$D$$>u~d@}뎃1@<tE12Dž$1ҋ Yu@ WY81.늋$1ҋ^Y@u2u9,XGHDPDLE%$NX1)UWVS 92EhpPt%={DžthE11҉ rMd11҉`d r`VtA<$vWWt[^_]ËhMEEdUMEE$lu`11 rU؅tkhd<$hE[^_]ËhMEE뀋hMEEd<$hЉd|diX\P}`1}dX  r'OTdDpP5HXLƋX9H`D$ PD$D$L$$hL$P T$ D$HD$l$&3xWE11҉ rlUEE!$\Xvl$ 9T#X\dwc\$U`U؉h<$h(‹dG뎋DA‹@uDFEu11 rE@t`EEEE<$ML$ML$D$ |$D$E$R*twEЅUp[^_]É<$MML$UUT$D$ |$tD$E$)t?E$_p[^_]ËUE/tFE$轾gMEԋAE܋A EAEAEAEAEEUԋE{EЉƋ@uj9UWVS\ "Glj$7E(MD$ D$ D$ $ƅ8#3D$4$D$4$xDž< < D$4$苑xt$$t띋AAA AAAADžD$ D$D$4$~#|$$Lu@D$.$*1U+u\ [^_]Ët܉ljtHt$GxGu܋vGt$蛻<$蓻utlwUWVS4OxEȋE0xU11  rŰ]ȍD$.$9EЋ]̍EЉẺEtCË@uEuEЅt $]EU4[^_]UVSuD$F $8GD$H$蝤t4E+u=[^_]ËHt$ħ4 cUyUT$ U T$@-D$E$@]UED$ ED$E D$E$]UAUT$ U T$@-D$E$]UWVS$u4$buE荓UEEEEED$,xX<$ZE؉D$<$`D$<$b $[^_]UWVSJoEX$7TE1D$D$$+cƍ`$1D$XD$$P4PT$D$i4$e4$t'8mpTU+İ[^_]m\$c\t~։P6tN~ tu틅XD$F$uԋPGX$XcP$v11A$X`UVSuF tF 1[^]ËF0$豤F0F($蟤F(F,F$膤FFN D$I$:FtF 뇍D$^$Dt F ^YUVSuF uu,F [^]ËF$FF F tԋ$F F [^]UVSëuF uetaF0$耣F0F u9D$D$ D$D$$ F0[^]Ë$ef 뷸US] $)1U C []UVSu4$F$բFFF0$輢F0F($誢F(F,[^]UWVSnÓE@0} MML$$vop< t< t-D$4$v?x4$pfM Ay EpE pED$<$HvtbP1tJ< t`< t\E@H9tTE xFE7ED$$utgPuuE @4E [^_]Ã됉U }OD$G$DžUtBExE xzt7@ D$$ 詜ƋEp0E$ 01jUWVS$EuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]ED$UT$E܉$誰MuTMEHE Hb@ ]\D$D$ E$W5]#0E$E@$ߞE@@@0$ÞE@0@($讞E@(@,01$[^_]ÉT$<$]$DžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVSu F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]fffffffUWVSh&]D$D$}Љ|$ D$D$(4$3EЉ$@EąD$D$|$ ljD$D$4$7}9E1E1Exu0P!uftf9XP 9rEMȃVUEЉỦ$]tUAEET$D$ $M]æMMUfEMzu7Ju%uftf;rz }p 9rMM̋Eĉ$]]uFM9qFE1h[^_]@t`X Eua M̍LM9Bu7fE 9_19Wr fuu11ɉ ruu؋JM]΃vEtfEtu|}}̉}و]vtft}kKu̍\]r!󥍳u 9)jE $]ǙEEĉ$]諙fH MEM1f]uutSXރ u]uE1f]] t]uӃ̋M؋}OM܉OGJOr u1ɋ}tރ uE1ۉU‹Et-EtMtkE uЋU}O M 9t"vtZ붻u}̉~ utftuN yu M}OElu}̉~utft֤ӻ]9(bM΃EMu}̉~utftEEEủp1MrEtfEt}}̃Eju]]]Lu'u MmfmKM뿋Eĉ$]衖YUSr×E$z[]USOtED$E $)[]UWVS HE}} 'v?NBCDt]D1 [^_]ÁB u$<iƋEEFGEFWUV O MN$W$=WV(F,}E=V-~U V O(N1t)NEȉF99U9} 9U4E E= =w=w=?w=ED$D$ 11 +D$$D$]OWF4N:V;m]衹4$jP]ۃV(F,}EF-~E F O(NEEfE= =w=w=?w=ED$D$ 11 +D$$D$]NPGV0N8F9/r<11͸11UWVSD$E$YƍxD$4$赉}и9ED$D$t$D$ D$|$$Tt4$YttFD$BD$ E D$|$$t Ĝ[^_]É|$t$%1߉4$YA1ȉ4$~Y1UE@ ]UWVSEEU ;P snH,X<3t;t-?19r09Pr+HE)E1[^_]?SӋ?̋]螶Ӌ]艶UWVS$1VuF$ED$ F(D$ED$E $N~;N:]f4)ЉMЉF$)É]]]f4)MЉF$)É]Ef4E)MЉF$})lj}F-VMуtitT <ωf0ED$ ED$)N8N9^ )߉|$4$K$[^_]Z D$D$$e9ԋD$ D$D$}$rf1P-D>DBu.L$$9ċK$ƆD$D$$蠓:UWVSEĉED$ED$E $>]&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,+\D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[ẺEEfEEEfEEEfEEEfEEE`t2 u&FlUg$U x;uED$|$ ,D$HJD$E$ˑE`t jED$$;E`FED$ D$D$A$cD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,bWu Wz?uED$ T$t$E$E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$?D$ D$D$<$f D$?D$ D$D$$UeU D$?D$ D$D$4$e D$?D$ D$D$$UveUP D$?D$ D$D$4$>eK赛$0~D$,D$E$ Ĉ[^_]ËED$ D$D$f$)]ED$ D$D$b$\ED$ D$D$^$\ED$ D$D$Z$\ED$ D$D$V$\dED$ D$D$R$W\ED$ D$D$N$-\@ED$ D$D$J$\ED$$ IUWVS$uE }$7U1D$L$ t$U‰T$$xVD$t# $U+u#$[^_]$.1%0UED$ D$E D$E$]UWVS}ED$|$ ED$ED$E $x8Ɖ<$7uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$]ÂE$7E1D$|$ D$E D$E$&…tD$<$qE+u Ё$[^_].UWVS}u Gu 4 Gt*D$4$}uUt E[^_]ËEtE[^_]UWVSY~ut\~M u ( ~t9uUt E[^_]Í L$?D$ D$D$<$`EtËE[^_]UWVSu} [Vu + Vt!9>uMt Ev[^_]Í|$?D$ D$D$4$`EtËE[^_]UVS+PuF[\l Bt ;2u[^]Ét$?D$ D$D$ $_v |[^]Ét$D$ D$D$ 4$L_[^]UWVStÙU} tdUZ~U ~t;u[^_]Í T$?D$ D$D$<$^[^_]ÍlUVSuZh Bt ;2u[^]Ét$?D$ D$D$ $N^v [^]Ét$D$ D$D$ 4$ ^[^]UWVS5ZuPYw$ wWvK Bd* v|@vF[^_]Ávf[^_]Á  u[^_]Á v,낃@t9u~jtucOD9.#n 1t$D$ D$(D$<$S\]UWVS=b}XWYD$t$<$Wx [^_]É|$#D$ D$(D$4$[[^_]UWVS}V$ rt;:u[^_]Í |$?D$ D$D$4$*[[^_]UWVSLQv$7E1E <tmD$$D$ D$.D$M‰ $MZMt#PT$UL$<$RU0E+u4L[^_]D$ .M‰L$ME D$$sM'UWVS4ëEEEE$E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMBP-DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVSEM HMHMHMXˁHɁ@ =+-EAAE-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$#EE4$ #EE $"EUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$xJD$u 4$RE$eEt $eEt $eE Ĉ[^_]ú)‰UǩEESEW), u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]ÍE}\$DD$@D$t?1ɀ:.u9u*u|.t A[^_]Éȃ[^_]1[^_]UWVS0ƿME荰EEEE$RhPlPHH8|$ x|$x|$@ D$L$T$ +D$D$4$s~ Eƀ0[^_]UWVS!Fuh Gt-D$4$nu?E tE [^_]Ë?D$D$4$}9}uAP9s:)؃UvM {9Cs1[^_]É4$EGx+[^_]ÉM]{EEMUWVS+(M}EuE(},M }0t$7xU1҉M$tt$$Cƀ?vE4$t^򋅤t)t"<.g]<0M|0.70J1U4T$L$E$?ƅ)‰U4E$kE$T$D$3tD$ D$dD$$C‹ $a{t$ $ K}Mt}w},+M$U$AAD$T$L$nD$ D$dD$<$DB‹$9|P-f @)ȉ~ DžƋD$D$<$W9u׋)$$|}|$ $1ɺ0-kf; F01x JDNu.9uҋ‹)‹ $9Vt)ЋxU+.Ġ+[^_]Á}o}$M$U$e}`E4$9hx.D$$1ɺDž@f; @E4$j벍D$D$$U &yt)}$<$WD$}D$ D$dD$<$>‹4$t$D$E|$D$$U O<$Gg|$L$$D$}t$ D$dD$$=‹ $ GGD$t$ D$dD$$I=‹ $G$D$t$ D$dD$4$<‹$E_wG1'9D$|$ D$dD$$l< $y}$C4$ fN~F$$T$|$L$D$=D$ D$dD$$;‹ $$n9%4$N $D$$|$ D$dD$$;‹ $o4$$GD$|$ D$dD$<$:‹ $ $4$kD$}D$ D$dD$<$V:‹4$t$D$$U >)D$ *@t$L$$ /&G1E)0~0 $09t4$d‹$y}$!<$WIL$T$D$!D$ D$dD$4$8‹$.E$HD$ *@t$L$<$-B$$$#G1E)0~0 $w09"4$b‹$@yY$ƅ-lj$G}u9e$>7M$)񍃍<$WD$}t$ D$dD$<$6‹$4D$t$ D$dD$$w6‹ $GD$t$ D$dD$4$)6‹$}91'9D$|$ D$dD$$5 $yG9u$VƉ9?$wy}+}$}=|$D$$U 6<$G|$L$$U <$)ƒ|э}$ }4|$ t$D$$4$^Ɖ)lj}4GD$D$ D$dD$4$3‹$G9!Dž1Qpƀu1$TnDž |$D$ D$dD$$2‹ $QP9 ~F$B= $UI^|$t$$U %<$G4$L~$D$$D$ D$dD$$1‹ $m<$ݽ~$KD$T$ D$dD$$0‹ $<$efF $SF $ED$|$D$ D$ D$dD$<$!0‹$u}$<$G$購D$t$ D$ D$2D$@4$/‹$4$flj4$G$}lj$,F$"_lj<$|$D$$U kE<$G$QT$D$t$KD$ D$(D$4$-‹$7U$r VUUU)ʉЃ=J$Un}$S4$F$$QD$t$|$ D$ D$2D$@4$,‹<$"<|$D$D$D$$U )1L>9/t؉4$D$D$ D$dD$$+‹ $y6$~@t$D$E$$%4$V‹$C}$.t&#E4D$ t$D$$4$UE$ VUUU)ȃ=Y $U  E$ D$AAD$D$nD$ D$dD$<$C*$|$t$$U p<$G9SF$葶t 4$肶4$wD$?D$4$]4$CTD$D$$U n94>F9Gt1Gt`$D$D$ D$dD$$y(‹ $uPED$dWD$ D$dD$<$ (}$@<w}$iD$}t$ D$dD$$'‹ $ GGD$t$ D$dD$$H'‹ $GD$t$ D$dD$4$&‹$NhGG<A}4|$ t$D$$螔4$RQƉ)lj}49a)=$Uw}$E4D$ t$D$$4$P@t$$K}$<$fWD$}D$ D$dD$4$Q%‹<$<a}$@}t9$ǩ"<}3$G x,/YG GGDž====Dž$1lj9>w>9Gt1Gt`$D$D$ D$dD$$"‹ $-GuP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$ Dž====fDž==e)3|${D$ D$dD$<$‹$9SD1'9D$|$ D$dD$$^ $yD$ @t$L$<$T o G1E)0~0 $+094$VI‹$yD$ @t$E$D$$=q .G1E)0~0 $E_094$H‹$y'D$QD$ D$dD$4$d‹$?9@Dž@DžDDžHDžL@)‰t(19rU4T$ D$t$$}4$+G)ʉU4@9<$G^x|$t$$,4$|ljF$|$D$ D$dD$<$$Nj$rD$ $1ɺ%c$ "<<$茧Nj$M4L$T$<$d‰)M4|$ $1ɺI<$ F`$谦NjB $M4L$T$<$‰)M4|$ $1ɺm<$j$ԥNjB$"Ɖ)lj}4S$}$9hD$ @t$L$$RG1E)0~0 $-094$X=‹$y|79S$}+D$}D$L$nD$ D$d1ɉL$<$‹$"7$ UWVS8~IE  U8u9hE}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]U~0IM8E#lp]UWVS}Iu})R|EtG9E r'Gf|t+E D$<$膚yF([^_]9} r+E[^_]UWVSV}HEEu} lj~P9rCffVP9r1PffV 9r1Xff\V t9s]2F(?1ۉ}D^ fu61ɉLu}9uF$F(F,1[^_]ÉD$ \$ED$<$xUWVSi|GEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$uF,F,^(NMD$]\$ D$ED$$] 7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~GF$gF(F,bCM]C]C(UWVS 4z]EEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$F,F,^(NM]T$D$\$ D$ED$$]蚣;F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,cuAN]]A]MA(ffUWVSwCEM} QyYm M0ȈE<ƒ?ك}Cu썶/ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u;Eu[^_]} Oσ7M)11}U+u\[^_]ø'UWVS q3<EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EEu}: w( ]u#M EÉ$SrE}~=Ut3}P-L-w\DAtu܋E })[^_]ÍM U$WE6M E$DxgEEM E$HEx>EM EÉ$MM|xEM?fffffUWVSo&:u4$,H9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} O7(qUWVSm9E $7E1D$|$E$xFD$T$$zxT$<$U+u [^_]XfffffffUVS2mW8EuUMx#L$ T$t$$y!x9s[^]ÉL$T$$+[^]fffffffUWVS l7utcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#f5UWVS /lT7utcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$"4UWVS k6u t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!s4UVS k<6uD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVSj5u} tAv-u3D$4$$tD$4$`%F1[^_]3USCjh5EU tttu P1[]V3UWVSi5}u t' t:@trt0 wvONuI2[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVS5iZ4}u tPD$<$#tD$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$tmD$t$|4$bD$|8(D$tـ\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$t~'݄$4ݜ$D$P-otj݄$D$t01ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$tn("݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$Mt$ $D$|$$$\$t ݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$tD$`$D$h${D$8$oD$T$c\$P0D$tـ܌$T$`ݜ$D$d\$t;"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـ\$HL$H\$LـPOD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$tà'C$D$\$t0D$4$h$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tD$T|$h|$$$ځ$|$P3'p$\$tD$`$D$h$D$8$D$T$$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$t'4$D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US]EÂEM t.9t*D$ 1D$D$pL$=[]USE&M E%t.9t*D$ 1D$D$pL$[]UEt t]ËE ]1} ]USdDÉUE ~;u;t5D$ 1D$D$pL$<[]ǂ[]Ãwǂ[]USCEU tt 1[] UWVSCÿ$ Etc@@ D$D$4$ u E[^_]q 84$>b 8EE[^_]UWVSB#uF~O9tHNM 1[^_]ÉU ED$|$E$U uFUF맸UWVSxBÝ }t;t-M tWt1$c;wr$Q<$I[^_]UWVSB? EPt7E1U9}t#E4E D$4$u߉[^_]1[^_]UWVSA E@EEE19ut|E}1th|$ D$t$E D$L$T$ LD$D$4$@D$t$$y>AAljUED$ D$E D$E$4UWVS8?$ Eu}$7E1>'T$ t$D$E D$D$|$ LD$D$$Iu(u~E+8[^_].|$D$ D$D$4$D$t$$t1H󥋅D$ iwD$D$$(:AAǃ$S…1A<+w2uىD9u˃u뷃z럃b뇃Jl蔝UED$ D$E D$E$R]USQ=zUM˃w3BtJ[]ËE E @%]3 ؉BtBt븋E E @BtBtUVS8<EtyE5EEEEEUT$u܉t$U؉T$ D$E D$E$T=tD$ E؉D$t$E$؃8[^]Í3UE@%-@~1҉D$$$]؉=?w1҉D$$$]Ã1D$$$]ú1UWVSut%ӃKE tx9uu 1ۉ[^_]CfffffUWVS$I;f}EU܉Mtȃ"uFEML$$](u]-K+EE0YEE E 1009]~Dx99Mع_SЀ vȍSW9]]؅t U܅t}܋u7$[^_]ExEFuu1UGM9\]"LSc7؋M܅u}bxEE܅t}818A V1ҍ=tftH<@ lj)99_ ΃r뀃< t< txD$4$ߤ1Ҁ8 Ht$$t9$7%$< tW< tS< 9szwD$ $H< u땸1$j@ z)׃ (D$$tljKD004$^@9]‹tft‰)‰ DžNtftR :)944$p@9o‹fBf 0mDž1 P$AuTfF()׃ (D$${Tlj$df\UWVS`Y(~EEE$7U1ҋ@E D$ .u‰t$L$E$(}EE4$pML$ML$D$ t$ED$ $6t\E$E@ U+u_`[^_]ÉM $6MB΍EfMUEFƋE$Ru4UWVS('@E8@E苳 }teUE<$oML$ML$D$ |$UT$4$5t,E$E@ ([^_]Ít뙋MUE{ƋE$t([^_]Í $4t DUWVSxugx ua@@ HtHӋ}‰t"ƃ))u)9|[^_]UWVS\%EuE $7NjE1Pt/1Dž9E3wG D$.$P-8tGt3W\_u<.uuy.u}fD$:$肮'tOfu:t .\uـx.H}OAuVGq ExA9t$D$$!q@0@Ɖ $@)9P‰ȉ@ M:E<$t$D$|$LD$D$ .D$LD$$jU+,\[^_]Dž9E1D$ D$D$$F%sfcui=x.Af~D$:$LZ1flUWVS\ ׉E UEE$7E1} t>M1U+ \[^_]r$(觻 9ƉyfQffQ 9>f4ED$D$ T$t$ $;@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$:Dž@ u4$Ѕ{8L8 9v<$9=fG$!=Nj$=Ћ9f}}$} - t$$}D$t$ L$D$$u9Džz@  99uQd 04$Z=$CGvT'tO<$ONjE$N$+P|$t$D$ D$HD$$%e1t9s;)d}dDž1 019tl!9hu狍Ƌf4JutJ9}A9p@ &‰))9V׋{z$8<))9zrtft1iX@t$$9P Y}u,04$tx9_9v8Љ΃tft4$=Љ>9}D$|$ L$D$$n4…s@ 89F9EP04$7=+Ɖ<$P)9| Yt$ D$3D$$%,4$p)9g[T$T$<$A8f~<$Ѕ)"Dž$W{1΋_9S GƋȉfpfJ2r 9t H0f9ًF9랉t$ FD$|$ L$D$$1…@ 9<$P9_SD$|$4$M1@ yyy G7)ʉ (D$ $‰pX<$2\D$|$4$.0111fR9s<0t4$`01*s)׃ (D$$軳ljUWVS$}EM@Bt $[^_]øEB $E-ƅD$ED$ED$ D$ED$4$…xkG D$GD$GD$ D$t$E$ME2EE$4$Et;$[^_]øE9E$ܵ4$G tE$袵G UWVS@y}E$7֋UHJ @BPƋ}ۉ\$D$ D$)D$4$W~HƋ9sED$ ED$ED$E $Elj4$[^_]ËED$ ED$ED$E $EDžt뼋E1UWVSz Ǘt@ËED$ ED$ED$E$ًU E|Ɖ$)[^_]ËE1[^_]UVS0 $Eu t"/10[^]Ã} u{MMUUUUuD$E D$ED$LD$D$ .D$ D$E$SuE0[^]Ã} t`M9tPMZQOQt)ЋU9t|~&učDUM؉E 9uuM؋EEAEAEA EM.u&UȍrUU9rM؋UMn1et$3 $M衊tM:fuM܅tRM؀9t‹uȍFU9rUffMEEEx:uPU؃:IUąmE؉EEȉEuȍEE_E91ffUWVS8։M$7M1HL$HL$HL$D$ $D$D$M $MU9ЋMs!T$L$4$趯U+u8[^_]|16_UWVS?Eu uu|}}$7uU1҃t+tO/1uU+Č[^_]Ë}E+M|EČ[^_]M11rEEM Tu11MUut&tt}t~U9wuڋUuu}t 9|uU}E1E‰xEEB:u}tA}u}XǾL9}}t}u>Pu9:x)‹u9$t$D$|<$o-"uE1E‰xEEE)ЉNjMD$ >VD$|$$Ua9UЃ7}Mt9 U9}P}9sm:u}yEttq}b}UM)ыE UOtU$蠹UPu9r81u:}뚉}f[UWVS`6qD$E$KE@(t}}tlpdh9Ɖ|X1lp9cE@Lؙdh!l!D$ L$t$E@$t!Ѓ\E@@}G0tO@9t$E@0Ef` ߋdl)‰lt1E$E@l9})ЉGD$E$|1TE$yE@ 6D$ D$D$E@$tЉlp!ЃE@ E@)lplpE@0tE@<)׉lplpE UucEEPd$͋dE@fu`xT$$LE UEUԉdh`}wPTlp6E)}+GlpE@0LP}OtșX\GM8E8y}u]9s@zM 9hPEM8HuUЋM؅tJEԉ9rAE9EEt(9%BEԉE:BEuEЉUԉ9sM)M6uD$E$\EE}D$<$\|uu܋}}ԉu}U؋M܉A8uMFEM8M88MuEuuȉMBEBE؉M܋uEB]ωE$EE E ]E4[^_]ËM؅t$E9r9M1EUE<}܍DUԉD$E$觑UVMUωuszEudEuH}8}EEE)9EM7E#E\E\Zuऋ}8}ErufuEtfUыuuZE8EtS8MuTu8MCE9EM܃9uu8ME}}ǃs)EtfEtEUuuauGM뽋MufumuumfmmffffffUVSuF0t$ UT$T$$*tM F0[^]ËE F @u1ķ8Tu躷1fffffffU EE D$E$U]øU Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]U Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]UUM ttt1]ø]ËBM U]BM U@]UUM ttt1]ø]ËBM U]BM U@]U Ut)t?t1E EBML$$P]ËBML$$t͋EM ]U Ut*t@t1E EBML$$P]ËBML$$t̋EM ]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1U Ut2tOt1]ËE 1EBML$$P]ËBML$$t1UM ]U Ut-tCt1t&E EBML$$P]ËBML$$tɋEM ]UWVS $]M Eƃt )֋t4utSD$L$$R totNCu<4U ]@ .SD$L$$Rt?tCu U ]@ [^_] [^_]1 [^_]1 [^_]UWVS1VuE 8t8tZt 1[^_]ËEEFUT$4$PtڋMFUT$4$tUE9Us!ut<$ʋE 됃tQtڅuET$|$4$o>bZ}N<$rE 8tuT$U$NjE 8Ut E덍04D$$UE D$ D$D$E$]UWVSu} EE]EE|$4$ot2Cu Ct9 uUU u[^_]Eu1[^_]UWVSY~uEE 8t uto<$辣EED$4$BtU9UrtOt,t1ET$|$4$>t>[^_]É<$E [^_]ÉЃtt,E뭅u}u<$訉E 1룉UD$$&NjE 8Ut E뱍$4D$$1ZU D$(#E D$E$]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]G=UVSûuED$t$ ED$E D$E$~>.t[^][^]USChED$ED$ ED$E D$E$[]UVS(uE D$E$tE)[^]UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]US+PE D$E$[]US&E D$E$[]USE$r[]USثE$@[]/7U£E Mx6]UEf]UE]UEfU f]UEȋU ]fffUWVS(!6u}E EEGE؋U L5uу"E E1ɍL5EM[<U|$M $eUt~UM)ȍ<FD$ $eUUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$dUEE})C~x9FP-}ȋ?DG~ruE9E9EEEE1ȉU}f]tEEwUD$ED$ED$ ED$E D$E$]UWVS4vE܋EEpu؋EkE@u8uEU1Ã}@9؍sL^uʋE EEEEȋ} EEEċEOuE;EU}ԋ M]È}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuẼ;E]U}ԈU]7UEFFEE]k+E fEp}1EpBfUWVS$˙E$7E1D$D$|$ ED$E D$E$t>ED$D$<$tE+uЁ$[^_]ú.UWVS$E MU$7E1D$ D$|$E$t-T$L$ ED$D$<$U+u $[^_]Éb-US]E M9r 9s9su[][]UWVS>EU} E9slUP0ك@t$tNt<]([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVSWtuE t*X?w#9r6 )ЍXt9Aхu)[^_]ÉK[^_]É4()[^_]UWVSEEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]HuU270:ۅt9u1[^_]Ë]j[^_]Ë]O(1[^_]UWVS  u}E9E |2&6D$D$$HumtF;Gt1 [^_]ø [^_]UWVSǢU2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]ÉG(뗉3$?UWVSEU t_Z1?w%9r8D)ӍV[t9хuލF[^_]Éɒ[^_]É貒(F[^_]øUSMrE D$E$c[]UVS"GuD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS$ƱuE܉U؅t A"}܉MGEML$$]uu]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0$[^_]ErEJ0AE@-UMU ]aUEUUMU ]IUWVS}E 4U,M0$7E1hEED$E$_6D$h8$+7hǀPǀTǀX8HDž@DžDDžL0L$ ,T$4D$8$Ӛ8U+u [^_]$U؏UT$ U T$@-D$E$]UED$ ED$E D$E$~]UNwUT$ U T$@-D$E$G]UWVS =E}u EE@0E@1,tftE@E)Ћ}GUi}‹E0T$UED$4$]VEUt)PEEE] ] 9sd=sFt% É ؉ É ؉ ƃUt$ $]cteEE 0E0UЉσueuLE$]sEu[@]ӋTEfH @ [^_]fBǀm@ @u}}tEt8E [^_]ËE #]JrUWVS}D$<$[|$ ED$E D$E$D$<$[[^_]USöD$ $4[]UVS`Åd6u [^]Í>sD$ $_5 $5ƅu$\ƅtD$ $4FFF US U T$UT$$ []UWVSô|"D$D$,<$yE t8ED$E D$<$|$ D$D$=$,KE$kD$D$$x[^_]ffUSE D$E$n[]US赿ڊE D$E$n[]UVS膿ëƋ$cFt)VtF D$F$ҋF90t$H[^]UWVS/TE։ϋUt%T$ML$$"%[^_]ÉD$4$_ƅtU1UWVSþu} GD$F$fuD$$m[^_]UWVS,xÝ$7U1DžDžDžDžDž$t3D$D$ 9D$D$<$r=~j$  tT$ D$ T$$?1U+,[^_]D$<$gxFT$$PT$T$$Љt6t," vL$ D$T$$ ?;0t$͆Dž$谆DžUWVSvÛ̾l$-xD$B4$E9 E h$/D$4$#u,27dJ  Džp`tXOWt11t΋ t $_tP9uዽt$_Gt$~_pp ; r`t4$T_ǃ ǃ t)1tto; r狅tt$^ǃ ǃ d$ j u;EU h$-l$+1Ĥ[^_]ÍuT$ D$ D$ $<UWVS(@e}u OW$tRGEtD$D$  D$ D$E$j1t([^_]ËCUWVS 赹ڄ}GFL$ D$D$Z${oGE>E썃-E荃E3E$)oEE;GE4G0D$E$nGD0t‹E$nGD0ul$nGD0t~$nGD0_$nGD0J$pn7$ m [^_]ÍAAUWVSAf 1u; v <D$E$#gu΋Ot5GEt1t $[O9uu $[GD$ ED$<$1[^_]$   ECt ϸUWVSl_ÄEEEd6EV P w <$)EEčuD$D$  D$ D$Eĉ$fgPUH7EtE vEM}EU<ЋM  E u D$<$yeuNFRUT$L$U$ЋUBuM}#TuEMU9s}<$(E ul[^_]|*E<$& U (9PuMEA E<$&b}ED$D$  D$ D$E$etMPtFMMЋUUԋML$D$ P T$@D$EЉ$etH @1<$%EtMHM<$%1ɋEt6E4ȅuEE | 1tMEA E<$w%7<$b%EtUPU<$H%EEfff̀rS[$=[UWVS<]܉ƉӉMЋ}}ԋ} UUUŰE$7E؉‹EQ)‰э)ƸQ))4Q))Éxy}tUMЉT$]܍UD$ ẺD$D$ u4$gE9NjMsU 9Fu}uw]؋E+a<[^_]Åtd}tՃwE9E܍] 9Pu뙅~ud}t.ȅxYD$]܍UD$ ẺD$D$ u4$!gE9MUF99u}*룍v}A}}tΉ؉D$]܍UD$ ẺD$D$ E$f띀}؉D$]܍UD$ ẺD$D$ E$_f]pUWVS\y|EMuE EEE]]$7EEEu R9uthUEP@t4<%uE11ɉM]BEJA;Dž|Em2mDž|EnnlwVwgED$ ED$t$$ڋpp_l)Љ$I)ЃJEED$ ED$t$$1ɉڋpD$E6D$ ED$D$ Uډ$UTE]9M 9Pu1D$E$Dfe\$ED$ ED$D$ Eډ$ T-UWVS(EjUh0E] ]ED$ ED$\$E $MUEy9tEh0E+E [^_]Ég"1[^_]U藞i@-D$ED$ED$ ED$E D$E$7]UWVSSxi@,<$4D@-D$ED$ED$ E D$ED$ 7$Ɖ<$[^_]UWVSi@,<$DED$ED$ED$ E D$ED$ 7$hƉ<$[^_]fUWVS聝ƖhuU΋}JЀ wK1ZЀ w( 0ҍ J9~]mfT1[^_]9| u[^_]Ë]DfUWVS-tX+tL1u$1ɉN…M)::t#tЃ[^_]Ã1믃륍B$;1ɉ…t4M)::uB$<1ɉ…tE1҉Ѓ[^_]USJMt50 wsS$m1ttX8/t}C []S $ At%8.u S$!t8.t:1[]S$mzS[]cS$1QUWVSF[fuÉ։M uXi)\P=(\_NQDDD);QEN My *)R)ǃQ))|gfff)DQ)))Љ$I)))GF)4V}Ou} }싌L7)Ӎ\9K@9|)}] [U썒L7Ӎ | )Ѓ9uF}[^_]øQ))ƒt1EUV)F}[^_]ËFPLLD)F}[^_]ÃF)XENYDDD)sB9At DËA+BuA +B uA+Bu A+Bu+UWVS3c|$@ƉD$T$`L$D} L$t@^~ VT$8VT$(V T$$v$t$$D$XD$\}t34 )Ɖt$XT$\))L$t\$0\$4L$X\$\ ʁыT$\))șL$ T$$L$X\$\)iiƸD$P%D$TD$PT$TyD$PT$Td$PD$ yމ\$0t$4\$Xt$\y<\$Xt$\D$x|$P|$TL$X\$\ʁ??ыT$\)уș׉L$0T$4D$XT$\)iʫiЪD$XӋD$XÉȃD$H%D$LD$HT$LyD$HT$Lt$H|$LD$XD$0yt$P|$T߅y D$|L$(*D$8D$8)‰T$XЙӋT$XRT$8)‰ЉT$0y D$0T$0$19>kL$X\$\1ҹ1)ӉL$H\$LD$@,7D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@,7)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@L7D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$KS\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$81ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$QT\$P\$UWVS 袇ǿR}썙]| uu [^_]Ë}|:dNu쉼puMTډ ?-00tċu! [^_]UWVStdFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉pE܋؉ }<$11ƅE؍7F(EỦ9sUWVSPwB\$|ljD$xT$pL$P$7D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|C7D$xD$P{D$D$x$\$|L-[\$|;8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|N(ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|Xf1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVS@ie4\$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$d$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d,7D$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$dtlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$d,7D$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$d,7$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVS])}ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$]=v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjEL9tUD$4$]Uu_ɉ1DžuUWVS\ƿ'NjX U$=EU~|$l $ 5}# 7tpdž _y>u EX [^_]ÅxE P$R É 27tpdž 1뒋WZytىugb1ɍAA7dN}D$|$l $LUVSZ%L4$ uƃ 4$[^]UWVSZ%EuM V~6hFhF1P9u dN9ut [^_]Ë]w#1[^_]UWVS Z=%UM Z~/dFdFP9u09ut[^_]É#[^_]UVSY$L4$<$o4$v[^]UVSmYÒ$L4$N14$?[^]US7Y\$<$[]qUWVSY0$$Rt6ÉǹUu [^_]ÉE$"U1USX#E$[]UED$ D$E D$E$1]UWVS]XÂ#L<$><$, D$ D$ED$ $Ɖ<$[^_]UWVSW#L<$X u<$E D$ D$ED$ $ZƉ<$[^_]USxWÝ"E $11ҋE3t 7P([]USfF 1[^_]UWVSE}D$<$w fD$<$[^_]ffffUWVSEæu 4$9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfϤUS DE9ErD$E D$E$ͪ []蔤f!̀rS[ô=[UWVSqDÖu F0u ǀFFF tBNt;})9F~JnJM 9FtHF t t=[^_]É4$u:N})9F4$bu뤉4$Mt  UWVSCӉʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVS HBm UM9 ?p9s΃ttUU^ ED$t$E$_M: U)UD$D$$E}E01 [^_]ÉUE ED$t$E$M uUEU JHJHJ H JHJHJHRPVU{ 0U$Ei 0`UWVSL A/ ljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw071ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%0X9L$1L$ 9<΃t$  9D$uʋt$L$9t4$1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$IL$L$'~D$|$UUU>D$;D$(` D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(\D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUL D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUU D$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*C PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$cD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUUs D$;D$(D$9D$D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(FD$9D$QD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$f|$UUU D$;D$(L$(T$$D$@D$L|$UUUDD$;D$(hD$9D$sD$D$$L$ D$ AD$oD$D$c|$UUUJ D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU D$;D$(`D$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$L$|$UUU D$;D$(rL$(T$$D$wD$9D$sD$D$$L$D$ AD$rL$@D$D$D$D$3D$OL$(T$$D$L$(T$$D$rL$(T$$D$SL$(T$$D$4fL$(T$$D$.sL$(T$$D$TL$(T$$D$5UUU< ;|$(rL$(T$$ 9|$s|$D$$D$ t$4D$|$UUU D$;D$(rL$(T$$D$@D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$GD$ |$UUUD$;D$(CD$9D$sD$D$$L$D$ AD$D$ |$UUUvD$;D$(RL$(T$$D$!8L$(T$$D$`L$(T$$D$A994$3+L$(T$$D$ L$(T$$D$~D$ v|$UUUD$;D$(rL$(T$$D$JD$9D$sD$D$$L$ D$ AD$D$_|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$QD$|$UUUD$;D$(lD$9D$sD$D$$L$D$ AD$D$Y|$UUU!D$;D$(rL$(T$$D$/u<$vt$1UL$(T$$D$X_|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$>|$UUUSD$;D$(L$(T$$D$zD$|$UUUD$;D$(rL$(T$$D$8D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$0L$D$$9 $L$D$$9$L$D$$9$L$D$$9$D$@tb|$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$~D$ |$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$fL$D$$9$L$D$$9$L$D$$9z$umL$D$$9]$XPVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$5L$(T$$D$ztL$(T$$D$UL$(T$$D$6L$D$$9&$!L$D$$9 $L$D$$9$L$D$$9$L$D$$9$UUUwF;t$(rL$(T$$9t$st$D$$D$ t$L$D$$9G$B:$f|$1늋L$D$$9$ L$D$$9$L$D$$9$L$D$$9$L$D$$9$4$L$D$$9y$tlL$D$$9\$WOL$D$$9?$:2L$D$$9"$L$D$$9$L$D$$9$L$D$$9$L$D$$9$L$D$$9$L$D$$9t$ogL$D$$9W$RJ|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$L$D$$9$L$D$$9$L$D$$9$xL$D$$9h$c[L$D$$9K$F>L$D$$9.$)!UWVSX)$]$U T$D}|$4UT$L$7D$0Nj$TC0u ǀƄ$D$D$$D$,$C Sf DŽ$D$LD$$$$$DŽ$DŽ$\$4$D$PDŽ$$D$HD$(D$tDŽ$$D$@$D$<$8e$%$)tc$1$$ C$$$${$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZwF$91ۍFЍPwFЃ v$ H$FZv$J$Ƅ$$$DŽ$1$$D$xDŽ$D$pD$XD$\D$c$t$$$9}ڋ$T$TI0$$L$du$$)tE$$A$$$9$$tJƄ$0$D$<B$$$ $|$dK$D$x)Dž^$$$T$xPӉ$$$$$t$$)ƅD$T$DŽ$$$$8$b:t$PtD$P$$0$$@ @ft DŽ$t$09t$$\$0$T+G$e[^_]Ë$<$$]DEG f /$fx$$DŽ$DŽ$ D$$$$D$$8$$ǁPǁTǁXy 1AAtft$A f$f$Af$A$A,$AD$$T$$DŽ$DŽ$DŽ$D$LD$ D$4D$D$DD$$$ $P:$@%$fH @>;$)@uDŽ$$$m$$D$$$$ZDŽ$DŽ$$t"$D$c$2.D$d$$Z$$/R,ۼ$D$c$T$$T$$T$ \$d\$D$$$$KDž=$)D$HD$Pt$$<$$D$P=<$"~$$$tƄ$-$D$\=$$߃G|$c-$\$\\$xD$xt$d Ɖ$$L$t)T$\}.|$x$)\$P$DŽ$D$pD$XD$c<$8$FD$c$D$d$al0X$;D$cP$$=$$$y$$)u9 I,ۼ$$D$$D$$D$$D$T$ <$$FDžx;$)D$H$yD$HD$d$uƄ$D$Pt$$2<$$D$P3;<$${$$$D$c$,D$d$$$N$ '7v4\$$ $$$$$1۹ $ $$G.$t _5$DŽ$$X$D$xDŽ$D$pD$XD$\D$cDŽ$&$@.'ʃ⿀ $y$f$S$) $.$$$$$Q$$T$,; 3$ [L$DL$ T$D$$4$$Uo=D$x$y DŽ$$$Ƅ$1$$$$$K$ `'4[R$$$ Ƅ$1ۋ$DŽ$$$}$ $DŽ$DŽ$$$$y$$`32$[$$$$$DŽ$D$x${$$$$$$D$xD$Pt$$謾$0$@$$!$J4$p.$$$$貵‰D$Pw4$$$T,; L$DL$$TD$ $D$$D$$29L$PD$x$$i$$$Ƅ$ y$it$D4$$跽@$4$袽@D$t$8$Ѓ01 4 4Jу0 vꋔ$$$)$K0[$$$ۉ$$Ƅ$+mW7*A9FЉ1҃  4PwFЃ v뉔$3$$ $$$$K$ 5"0[R$$$$$$$S$ "0 [$8x$i$$$O-1҉$$$ƁƄ$x% À߉$$;DŽ$Ƅ$$g $$$$XT$tT$$T$ $T$\$$${$$)lj|$xd$$$9}$$$D$pD$XD$\D$cT$ $$$$D$x$-$+$@$D$x$$$$s$ |$D$$4$$ $)$9~$Ƅ$$D$x1$$;$$$$ʃT$x 4ʍRR$$$$$ DŽ$$w$$$$$$;T$LBJ$$$҉D$LaDŽ$$D$x$Ƅ$D$tu|$c$ D$PL$HȉD$xƋ$)ƋD$\9~ƅ~@$$q$$$$y1t$\)ƅ6L$\$$D$t$ $D$,$$$0@$$$$t$x$)Ƌ$9~ƅ~@$$q$$$$y1$)ƅ*$/$x$$$$Jƒ~I$G$B$vDž11ۋ$$$$8p$$w$XDŽ$$b$$$'$$)ƅ$@,$x$$|$d$Jƒ~E$G$B$vDžuZ11ۋ$$$$p$$t$D$dD$$$$虛DŽ$DŽ$jd$ $x$$$$Jƒ~E$F$B$vDžuZ11ۋ$$$$x$$$$D$$$$胚DŽ$DŽ$gN$D$$$$?DŽ$DŽ$ yDŽ$1ۋ$$DŽ$1ۋ$$$$$8p$$:t?$D$$$$tDŽ$DŽ$DD$T$$y$P$$p$$D$,$$$0@C$$$F|$HGF D$$ 11$$\$H)ޅ1$ \$(ZÉ$$gB$$D$$$$DŽ$DŽ$$|%$$D$8$$Jƒ~E$G$B$vDžub11ۋ$$$$8p$$$$D$8D$$$$DŽ$DŽ$b$D$$$$贖DŽ$DŽ$$$$$$$$Jƒv$G$B$vÅu11ۋ$뵋$D$$$$DŽ$DŽ$t?DŽ$1ۋ$$$D$$$$zDŽ$DŽ$SE$D$$$$6DŽ$DŽ$7$$1۹ $ $$‰%D$p$DŽ$DŽ$$XD$tD$T$ D$pD$\$$$$$$$$X$x$$B$$$u$$ $tB$D$,B$$$$$$D$PL$HȉD$xi$Y$$0@C$$~ yt?$D$$$$DŽ$DŽ$$$D$H$$yPm$ݔ$D$c$T$$T$$T$T$dT$ D$$$k1ǁ$'DŽ$$|$\ t$d9})t$d|$xD$xD$d|$x\8\$x$D$$D$c$ǁ|$p$$! j$X^$3$$$$ $u$$$3D$P8N$`R$$$$|$d$DŽ$D$xDŽ$D$pD$XD$\b< DŽ$$$$$D$$$$[DŽ$DŽ$&$"$x$$$$ك~D:B$Y$uDžuUDŽ$11$$$r$$$D$$$$XDŽ$DŽ$l#$$$0 u䉴$$$t&0t!F0$$C$$$c$R$$$Ƅ$$11DŽ$DŽ$ @  !$[$$$ q$ $$y$Ƅ$-$$$$$1۹ $ $@$ h  $R$$g $DŽ$DŽ$$t$X|$p{l$pL$@@$$$L$t |$x)9~υ~2x$$$L$t y1)@ʋt$XVL$pV$$D$x9$x$$$x$$$$$у~D8@$Q$vDžu[DŽ$11ۋ$$8p$$$SL$t $D$$$$ DŽ$DŽ$fu;DŽ$1ۋ$.u{DŽ$D$t$U$$D$$$$聊DŽ$DŽ$$tIl$tl$X{$$D$$$$$DŽ$DŽ$D$t1ۋ$$DŽ$$L$t ~$$$Z$$$Ƅ$-$=$D$c$%D$p$$F$$$$$$ DŽ$$X$D$tD$d|$\'L$x\$|$$ $$$ʁы$)уș׉L$xT$|$$)ii̍$ȿƉ׋$ljD$h%D$lD$hT$lyD$hT$lT$hD$x1L$x\$|$W0G$$D$pD$d<9 $$9r$PD$cCD$dxtD$d\$xt$|$$DŽ$G$|$\$$$$$蒸$1it?$D$$$$詆DŽ$DŽ$y$$D$(É$$DŽ$$DŽ$1ۋ$$ADŽ$1ۋ$$>$$D$$$$څDŽ$DŽ$1ۋ$L$t $ZDŽ$1ۋ$$m$$x$$$$JƒE$G$B$vÅu11ۋ$뵋$D$$$$DŽDŽ$DŽ$tD$x$$up$t$D$$$$cDŽ$DŽ$.|$ct&RD$c$D$\)-ODŽ$1ۋ$$#$R$$DŽ$DŽ$"$[$$$ $D$$$$EDŽ$DŽ$$1ۋ$$vDŽ$1ۋ$$.$$$8p$$$L$x$DŽ$ DŽ$[$| O$$$$@R$$$R$$$?$ ݔ$$D$$D$$D$$D$ T$$$$[1҉$$$$Z$$2+$ $$3$@3$ +$[$$[1҉$$$$ @* .$[$$$$$D$dD$c$+L$\$ /$Z$4)0ȉуcڋ$C0O$9$\)ډщ$$Nj$$X)Ћ$8D$(t$dD$( L$x$ D$xL$x$y DŽ$\$P$L$d$DŽ$D$pD$XD$\7_DŽ$$$7D$LD$L$`s$Ƅ$1D$L( D$L,\$t,11L$\ 9 )Su߃݋$$D$d$؃$$$1۹ ($D$$$$R}DŽ$DŽ$$D$$$$}DŽ$DŽ$$D$$$$|DŽ$DŽ$!D$HD$d|$c%D$HD$dD$cދ$$|$x$Jƒ^$G$B$vÅ11ۋ$뱍J$x$p$D$$$$.zDŽ$DŽ$^ $$$$aG $[ $$$$ . $[$ $ In $$$$ 3 $R1҉$$$]$u $vnWE $[ $$$$ $R$$$$$$$1۹ 5$D$$$$wDŽ$DŽ$1ۋ$$$$T$,; 󥋌$1$$9$rC$ǍA$D$DD$ $D$D$4$$Pv$L$Ht$\)L$dAD$d4f$D$$$$vDŽ$DŽ$$D$$$$vxƄ$0$! 9D$c$D$HD$d,$0$$T$$D$4,Q$D$L8$D$LJ$$8p$$E$$ D$xD$$$$uDŽ$DŽ$^D$L$D$LD$L$D$LD$L1$$D$LQL$Ly|$Lp\$L\$L$t$\$y DŽ$L$P$DŽ$D$pD$XL$d$O$$-{DŽ$$t$p$$Q$$$xL$\\$tt$X|$p7T$x\$x$y DŽ$L$P$DŽ$D$cL$\\$tt$X|$pT$x묋$$t$L$t$L$$$D$LX$$D$L$$}D$L0X$$D$LD$L8$D$L$$vD$LX$$D$L$$ T$LB$$҉D$LvD$L8$D$L$$ J$L$LL$LD$LD$L{D$L( D$L\$L$st$LAJ$*$$$T$,; D$DD$$TD$ D$$D$$$b$$fH @DŽ$$4\$$;$[RW$$[R |$L$_\$L$$ $X$DŽ$$$$$[RJ$x$(1fDŽ$9ƃ$$$ 1D$c‹$$# DŽ$陾$ DŽ$钾D$L1ۉ$$D$L$$ \$L${|$L~D$L1ۉ$$D$L$$H|$L$$GD$LT$LB1*T$LB$$҉D$LD$L8t$Lt$LD$L8$D$$$$ZnDŽ$DŽ$*$1ۋ$${fg P$x$I$|$LOL$LJ$x$D$(J$x$D$L8hT$L$rt$LT$L $$BD$L$$jt$L$$t$LFD$L$@6$ $f$*\$LKL$LT$LB$$҉D$LpD$L8T$L $$BD$L$$ D$LP$$$$$$T$Lw$$D$P$$$WD$pD$X$ (1k$ $$֋$UB$鏷$D$L+Sf$$ލQ$膨 DŽ$ZL$LL$L_$fH @ٹOȃ0 [14ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSý}ED$E D$EE$$k;E܋<\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$މD$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$ $5Ɖe[^_]ËED$E D$$5Ɖe[^_]ËED$E D$/$5Ɖe[^_]úT$U~ t^E|tEXrUWVS,}m|$D$%U <$\h;m܋<|$D$$%-BuM7U$T$M4ƅNT$DV9‰T$s )HFL$D$$D$VL$ 99sB\$L$9nك9uL$9ȃ9uUB]} ;tL$%ɋE$UE$tE$C9ruN9ue[^_]D$$%-@uMEED$E$D$ $=3Ɖe[^_]ËED$E$D$$ 3Ɖe[^_]ËED$E$D$/$2Ɖe[^_]ú$L$U~t^E|tE\pUWVS`9E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$e¿;፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$<$>U:ue[^_]ø랸뗸1ffffffUWVSx3t&*`=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$D$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أ܋D܃L݃TT$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<Ơ~'\$X,D$(D$4D$hljD$@D$,} <$@/D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$uD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$vD$8"T$DT$$AuD$XT$D$drD$XD$D$tD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$ $-D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$,D$`O}F|$T;|$PwHL$t |$@ Ơ~'D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$oD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$sD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$/$ *D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $nD$XD$ $L$h)*0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$gsD$D|$X|$$ptL$T6|$`94 vP9t|$8L$8=D$`0D$E D$$(D$`|$PwuD$t(.D$0L$@Ơ~'ȃƉDD$XD$t"'T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$q&D$,0L$hT$8T$4$qD$P|$D$X$Bq…@ fT$T$04$pD$DT$0$4iD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$oD$D1t$Xt$$pT$hV9zT$,1t$4FD$hD$X$VhD$h L$8tt$89tD$h4$.hD$hƉ|$8D$8$hF(MZD$PD$D$D$X$hD$XD$D$D$WoD$`p1D$@D$X$gD$8lD$hD$D$X$kD$X86+D$p[T$XBD$i¸ )6D$XD$D$D$nnl$@D$D$ D$D$ hD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$HكPڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8 'D$Xr D$D$D$8$lD$81fu T$hvx0t|$8L$8 t$8F$Jd…Fz tftD$$kDžYD$PD$4HL$PD$h9L$("D$D$ 4$eƅ`D$8D$D$ 9D$8$eD$8,D$D$ <$eDž D$PD$4D$8L$؃\$HD$HT$LD$-@D$D$8أD$|؋t$`D$XD$8EЉD$@A$cD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@Ơ~'ƒD$X T$T$L$T$HL$L?'\$81tD$8 \$8uT$D$8T$0t}D$`D$D$D$t$OD$tD$D$h$V|D$lP1D$DD$d T$`D$t$BND$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$@RD$t}t$tFD$OƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$PD$H#L$hL$$OD$tL$h $3LD$tD$h)t$4t$D$H$zRD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$rJKWx q tftD$$QD$d~D$<؋t$lL$dD$D$h$vQD$hL$tL$$RuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃\$TD$TT$XD$$-@D$(D$<أD$$wi؋D$8XVH؄tJuU tu ؃[^_]11US(MnEHP$/C[]UWVSDnEċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tFE4$J7E$&6ƅ@1랹fUWVSb$}<$=;04$QTD$tDŽ$ݜ$DŽ$E$E$}$-wӋ$l=L$|$}D$p0D$dE@D$DӉыD$|DŽ$/1t$x1 tQЃ$ˉʃ/~J9E~փ؋$LQЉ$} tE }8e[^_]Ãt$Xt$x8|$xD$hD$TD$`eED$HD$xDŽ$D$Ht$T)D$`E@ D$h]cD$Lu|$xD$xƃ~D$XD$hD$ll$hݔ$|$x '؃$5XD$` x|$`7%T$x)ЋL$`95)4$$-\$x$E$EP+ -D$PE$EPZЃ Q$0u&Hȉ$I0tJσ|ZЍH$P΃/ \$HN eFE=D$`D$d D$hD$`uFi GI Nu($mD$$4$M/ DŽ$E$$M t $} D$pt$t0T$$D$E$$%/$$2$e[^_]ËL$|A$ƒߍAX2‰$@X0tT$|t|D$d0D$PED$TD$`D$d D$h D$xD$Pn@$$@["$^^T$xA8tT$x,E$D$HK$~'LDŽ$߬$ݜ$$5 |$xT$`$$D$x)4t$ ~'݄$ ݜ$ m$'@ 1ۋ$ % ?$݄$ݜ$؉$?$G ݄$$ '1ɨt uݔ$؍$D$ $D$$$K;$ $$$֋$)ޅ~1t$ $$p-$$$$ ΋$)Ήt$(MI$9MIL$P9w)΅xt:։$$DŽ$BBt$P$D$DtD$(9D$PD$(D$hD$tD$D$XD$ D$xD$|$D$|$$)D$@|$`D$Tt$H)!ЉD$d|$HyD$HDŽ$D$@ D$,t$@F$$u-D$t P F׋t$,) tft$@$$)-D$x $H Bύr  tft$$)D$X$։T$T$$q0D$|4 T$T2 D$dƋD$HD$T$CL$X))ߋT$P9~)|$Tlj9~9~~)))ƋD$dDЋ$)ȅ[ D$` ~#t$D$|$$3D$|yD$tD$D$x$$4DžTx p w $G D$|D$<$$A4L$Lw D$|D$<$$'كB؋$ T$XD$8\$0D$$ DŽ$D$T$$Ɖt$<\$hu 9$ $D$ $D$D$X$$6…E$2 N $L$TT$ FD$$-T$ T$$$X3$^T$hҋT$ u*K9H L$P9L$($D$TD$h$$(+4$ +$Z $$t$<9؋D$hD$x$$*D$t$*D$|$*<$* $|$xD$hD$TJЃ w.D$hL$`$C$SJЃ vD$`\ZЃ$V/~΃9~).D$HNL$P\$Hy0j˃$0t)ÍCD$hBσ$BЉD$`D$hD$T\$|D$xD$Xt$`FD$XD$h$}D$pP$XoT$|$}D$p͍$$T$ T$LT$D$U$MUZ$$1t$D$$4$$g$$#D$4$$u$DŽ$E@}$1DŽ$E@$}$8(|E@$$D$h$$ӍrD ~N9r1BBDŽ$$t$PD0$DŽ$!$$)Ɖt$h $D$hD$$$-$$t$h)$D$huD$x$$ 'D$t$'D$|$&D$@$&<$&E$9x@ $n$$$&DŽ$DŽ$E@}EPu9us#T$D$E$$ 5Et )n$|$hЋt$Dt0@DŽ$P$O"$1Z$ ȃ0y$jT$T$T4$$$HY9^T$T L$h$$$9D$huT$TD$D$|$$c)D$|tfT$xT$$'D$D$h$$$ $$$$$)‹$~'݄$L$` ݜ$$$L$ L$LL$L$hу5҉T$U$MU1ɍvD$h$A$T$x!D$hT$x)Ћ$ ~'݄$ ‹L$`) $[DŽ$!|$Xm|$ht$P9t$({D$<$$bDžWD$|D$<$m BDŽ$$)$$D$$$$BB}t$P7DŽ$PR$)D$$$D$pD$p~y|$XDŽ$!t$X9$$@0$DŽ$T$xaED$ED$4$$0$$$$$5)I1$j$@D$P$P$DŽ$t$X9$$Cz$Y$`$ډփPD$$9t$DŽ$!$ DŽ$BL$X9$ӨQ|$h$@$DŽ$$T$P9T$(u,DŽ$!xEx;D$D.$)$$t$$$Pfffffff|$L$ -fffUWVS(=uf@E܋u} G9F|ƋG$](EmOMEH_VHMԋ~}؍DE1uU]ЋuuEډډ]fQfE9rދ]ЋMA}9)ȃӋEЉ‹E})}<9s' fJf9rمtE};xt&}GMADE([^_]ú뉉Nj@E$]…t>Gz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVS<=sf>E $7Ex0E }Uxx}؉EԋE@EA…uA…t v0uAE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]c4"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]o3"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0d/}u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSc.EM]E TsCD9sϥ9r)؃L9s&)D$D$ $]G[^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVSb-lF0)ˉލ, u썊a)ˉލ, u썊=A)ˉލ, u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rEu)} ȋ})B9>[^_]ÉB$MUVSAaf,UBJT19r & 9st9sEE$Ɖ[^]ffffUWVS `,d6} w+L M4tetB,$2E$ƋEFEFuFF [^_]úMUEL )ȉE w|,$"t,$|UWVS_*ut"F w"d6u&L 4[^_]É4$[^_] ,$UN?L 4tU$s[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVS<]((} EPUw9|։E}EGU 9O}M$Eԅ)PMD9s2MM)ȃD$D$$U UMGEЍDEEp]D9_9]])<}̉UȉMĉ9stqutދ}EEEM܉]؃Eg1EUӉ1ۉM]FE9r΋EM܋]؋}̋U;9rUȋMą tDtEԉHEԃ<[^_]ECUWVSf[Ë&}u ,  ,y}׉Eut?tDt|$E$EE$EEuE[^_]d6 uBU|$<$UtME$MpU,$ɋUu량[^_]D$>D$<$sDž1Ud6u\M$"…M@q@, U,$UM,$, ҋMu끋d,$1ǃ, u1UWVS$ZY$u EHNj@EPG9~ 9U $1ExUtt$D$<$UEp@]L] ]t~ )؉E1}U܉ʃ>M CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSSþ}tD$E $ƅD$D$E$}Džtt ʃ9t-xD$E$t|E%=t`fp ttu ffp MfH@_P$½P,iP(P Č[^_]1Č[^_]1O1USRRwE UD$T$ D$E$[]UWVSR<uD$4$nx$P8D$4$[^_]É4$mUSQUjxH []É$6[]UVSQêUF0$'F0ǀǀD$4$FFF [^_]ÿF tF$p4$D ffffff̀rS[Ô=[UVSROwuF0u ǀ4$cunP[^]øfffffUSNMQ 1f t[]É $[]UWVS Nu`6FF uafF FF uwFVT$D$F$V$FV fV 1 [^_]ËF0tN@9t $)F0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$e=<1ɋ8tBD$D$ N|$\$4$観 y8t6D$D$ ~D$L$4$\W8t6D$D$ VL$\$4$W8t6D$D$ V\$D$4$Բ?O8t6D$D$ NT$D$4$萲_8t6D$D$ ^D$L$4$LW8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$ȱu7O1$[^_]ËpOe8,UVS F,EU uMtTp4u 1 [^]D$D$4$#+u"udž0UWVSEïƋ4D$D$4$*EtE$HGu͋$'tMtf~ 18t$9⋎t $P4$uu&E[^_] U9 8} ]EUWVSqDǎ]tCƉ$a[^_]þUWVS)DNljUD$@$:ƋUu 1[^_]ËOD$M$…1]~˃Mt|tatOt=t+tt9EGX<tE[^]},[^]^UWVS:#} D$$ƅǀM]8bL$ ED$|$]$ mF8FF F FFFF4, ~D1 󫍾󫍕xT$E$Iq]~^ $iF]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$薦BF0F(LN,NV<~$]9~s~G]WEP IT$4$i0}M1Q\$E$oKT$ ML$|$}<$ÉX TUMQ D$t$$ËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ <$ ;F@7NF(șdž‰<Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$K>pdX]Px H vX5Pp[^_]ÿO$Ҟ4$Lp81Ë,fLT$ ML$|$}<$ 8녋8"8F8FF F FFFF4, ~D1 󫍾f1$F~ j%8118ED$4$dž0881UWVS$E1j uF(x~(V0!UN9F9MUD$N $MUF($N 9} TDTDF F,9sF0 F,|$}|$4$o$[^_]ÉUUE$EEtlE܋UT$ML$E$_ME)UЉL$D$$.M $+EUVU(_US]ED$U $ #C,9C(}#C0[]fffffffUVS / EpFtD$D$$˸F u  [^]UWVS9/^ ETPLx PpXxHPTt=kbPKҐ"DHD$$$4ƅǀHDǀ$$ljFHt dž wSG`lG,G MG ]GGmRGE U%tAtCFt$t$4$1 xD$ ED$E D$E$HE EXuEX=DžX T dždž XTLtt!ȍDLX1PfffXL9aTȋX1D$ L$HD$$踰w 3D$D$$Qfxuu fx D$D$$E t @E@t Ey [^_]Á1DžPDžXǏDžLDžTDžP^ǏKVp t$ ŒPT$¸NT$$1D$$+8D$\T$X$TD$XT$$ѯ…\}@@f@fBB PD$D$T $XD$XL$$D$PT$$xD$"$H XADžX2D$`D$H$肓f` =b1`abcddefghhijkllmnoppqrsttuvw `b1uedu\hX=wCu>t_u1 ȉ lpHO ǏFUWVS$)'N EpFtD$D$$RFUED$E D$4$XDžEtwD$D$ED$D$ D$|$4$蹅!@uFЃ$[^_]ÉED$D$$误UЃ$[^_]D$D$$芯Ѓ$[^_]fUWVSEU M wHpPPHHpPPHH p P P H H pPPpPPpPPH t tZ[^_]ftHҍtP1Q‹ˉZˉZBtZ ˉZ Z ˉZ 9uȃ[^_]ftxҍtPu,r utu΋ʉVʉVu9c7W‹ ɉ ZˉZZttr Ήr r ur Ήr ʉPʉPPʉPP ʉP PʉPPʉP[^_]UWVSEU U P׃X ރ HpPPHHpPPHH p P ˉX ffxPpP[^_]fzHҍtP‹ˉZˉZBtZ ˉZ Z ˉZ 1Q9uȋX x)ʉPʉPPʉPP ʉP PʉPPʉP[^_]fxҍLPM2r utu΋ʉVʉV7W9}q‹ ˉZˉZZttr Ήr r ur Ήr UWVS(T"y EpFtD$D$$}FE  D$D$$٨Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$辪$"u 1([^_]UWVS/!T }wFtD$D$$XFD$<$tr$StcFt$t$t$E4$<$E$[^_]øUS e Ê E9ErD$E D$E$R [])UEtu]11ɍT9r]1]fffffffUVS  UE X?1rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS46 }E@Et M 9H 1uEEEEEEU@}WQ  R 2fuft trfu#tPMy MIыURU܃! M0u Uzu@G GGBPWxG8GsBW]O ME9KOft DAfEtD$D$ E܉D$L$4$ĈVEE@#E UJU ыU M׃}׃}uYM0ɉMuFBEFEEF0E4[^_]ED$$BE6E@ D$$!‹EPpt EME A AEuth}OAMOEG8D$ED$D$ E D$T$E$虄E4[^_]Ë}GMOEG8D$ED$D$ E D$T$E$6!E ]M؉EEPD$D$ |$T$E$舆E@R$USEP M TH}[]UWVS E}9UNFt%O L$D$$]XF$UFA4$]@E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$]0tUSUE @@ @HKYXBP[]fffffffUWVS Qv }ED$E @D$E$ۃt7ƅt|$$t [^_]A84$膄28UWVSD uE $7‹E1[lNt$D$ &D$D$<$#=5DžDžDžDžD$D$$謁<$ƃtI<$D$D$4$tntD$4$蹲tSD$D$$6E+uqD[^_]Í$^8D$D$$ۀ4$ӂ8q?-wfUWVSt6 ]u EE$7EEExGtD$D$$G %}(Et)]uU+t[^_]ËV]ċK9 E.D$D$$]&Gf_ @EQ)‹Eċ@F 9AfMGED$t$<$]vMefLJO fMEG(V]ċK9EM9r\L$MEĉD$<$]xEEEEȉEEċ@EME؉EċF9‹Ms]L$Mt$<$]Qx8EEEEȉEFEMEċ@Eu9‹MG},D$GD$$]cGfEEA!LJD$L$$]qẺD$t$<$]E‰EeEJfMM }.EEFE]C EYf]QfU)Ӄ9f9UsCҋE)҉T$DAD$DQM$]yMAfEAfEFEUfQEf+EfAUfDQȉMMMċQP]XP FD$D$$U]yMċAD$D$UV$xG(Mtu 9Gt1D$L$$]}  1Q$Au9uLJEf  _EED$ L$Mt$<$]M91t$L$$]GYED$ED$ED$EĉD$ t$L$<$]1'vD$L$$]EuFD$D$<$]BAf}LJfLJjӋE9MGED$t$<$]qMO fMt fMfO Mf&Gf;EfGLJt]]pffffUWVS0aÆ }E@(tEEEtG 7AuQ O)Ήt$D$ЉU$vUfWE\GGMQft3ʍTOU‰EMMf9sf9uEMDHWуf+Uft"ҍ PPf9sf9uOfOE@(u 10[^_]èuE?9xuP9Us݃}fGыu9NV;UF(  }EfEED$D$D$D$ D$ED$E$mPD MD$E$+stۋMfA MD$E$stMA6E EuuKGfGG}EfEEEH(}EfEut$E D$E$nG9E49Eu녉}EfEEE D$D$D$D$ D$ED$E$lE}fEED$E D$E$=nGGV1҉T$D$E$ƅ5EfEED$E D$E$mE@(EMA(1D$t$$EuFEfF7}EfEt$E D$E$hm6EH(D$D$E$&ƅtE@fEED$E D$E$mtD1ɉL$t$E$/EH(81҉T$t$E$E@(EUWVS õ }u FuIFu 1 [^_]D$D$$NtYVPD$D$$舔D$D$$t!VPD$D$$P|{UWVS,  ljU,E싗E9BD$BUD$$蒑ƅUtZBPUTFEDuIFfur>t$<$ut$<$谁g,[^_]ÉU܉M D$<$nMUuD$t$$F뻉ME EF )‰T$ȉL$Mȉ$oMfMfNEDFfENMMAftHЍDVEEufMډUUuf9sfMf9uuMڋUԋEDPEFƒ)ft;MAȉuu}}Hf9sf9uu}VfVD$t$$8E8tRED$<$1t#fFfFF 묋ED$<$ ZD$D$$ȑ1=UWVS0aÆ uExGtD$D$$臑G t>tU0[^_]G(tި0[^_]EEEED$E D$<$9ƅEMu@E@  Nf9sit$E D$<$zhu@FD$ ED$E D$<$tD$ED$$}NE@AfFfzfMfUt$E D$<$gJFD$ ED$E D$<$TvFHfu9fFE@4UtEfNpD$GD$$K…<@fGD$ T$UD$<$ƋUBuQD$T$$8fU 10[^_]ÅuD$T$$MUE@fUMD$ED$$譎MUf9D$T$$膎GEԍUUT$D$<$60O9fEW,Uʉ׋9AE؅mD$L$M$E9}Mu25D$L$M$ߍE9}MGD$GD$$M>GNjEA9Etf}ދ98}fxXDy|8f@D$L$$&D$|$$越1mЃ}uf}D$L$$ތD$E؉D$$k\~rD$ED$$蘌D$ED$$z]D$t$$[D$GD$$… v}]D$D$$}t&bD$L$$褋ED$EԉD$4$4'0G,EJ9NMUD$t$$JU싺1M9(/D$T$U<$E9}U8EGD$GD$$肈…sG>ft׉EfMދ?9}fyHUމMDFDED$t$$aD$ED$$ƅ@PMfPMsfUމ1D$t$U$1҉T$ED$U$聇ƅURjщEΉU*;fffff1̀ffff ̀rS[T =[US8 D$D$ D$ED$E$t E[]øUWVS EpM dE$7l֋U1҅tUuMxIEGu@p:^)‰ЉhRp9\rD$/$[t)s1lU+Ĭ[^_]à @`\%$>O`9;π?Xt։D$ h)ЉD$T$`\$d`p9r9>/u`tD$p$5/|%=@`tOVp:uыp)~"?MMXdD$E  D$p$Eh8PXh9<Ƌ\ @`)@u08p9hD$`$.uFEt)D$p$4JtD$p$4.8m`\ffUWVStÙ Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xf[fUVS  4$lD$$D$F $3 [^]UWVS ó }$K$K#1$KD$$D$<$X3t$<$2 [^_]US< $(l[]US, EEVEEED$D$ED$ ED$D$E$St}u E,[]ø,[]USlÑ $}k[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C9x@f;ErfGf;EE̋MAEHEUJ}}?]fC]f9]u]fCẼ@[^_]fEEMf9C1뿋M }Of+EfG1fEuuu.&uUWVSѰ ƉUMED$4$S]ǍED$4$:]ÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]JMUBfFF F D$t$$]m1[^_]ÃtQʋ]C ^)fFfF] H@ L$J UL$ $]IUBeD$B D$$]jtH D$D$$l&KUWVS,hÍ Ɖ׉M܍ED$4$[,UUԉf@UfPWPM؉EH}O M}O }G} f9ED$$节EUE؉EB}GBfBEfBG EB ED$E D$E$M}S‹utftE9UE$QE܋u0E]UЃ,[^_]ÉUԋED$$輁EUME؉EA}GAfAEfAG EA D$T$$hUPD$D$$ju UuEԉFEf@f]܉3u‰Ѓ,[^_]D$ED$$jj1E$1}kfcUWVS  uE]u BEfAȉE{S ts׋}GEfAfA~V tj׉CfAA A D$L$E$]{i1 [^_]ftC|{M 9uMfftF|~]9u]oUWVSp E̋}u]E fEڋE M܃8M\$EډED$EE$U …B)fBMfDJ MQVP]XP AD$D$$Uԋ]1EFD$D$uEF$EuE܉EԋE 8 G,E9EEEEEEEBD$BUD$$]xeEЅUBfEfEڋN C<FE EËUBR)9UЋE:D$ED$E$MUЉrEЉE EF  Q])fQEfTAʉM\$ED$$UЋ]CUЉBE܉EЋMEEEIE 8u4 ML$MЉ $M Su[D$EԉD$$]TfD$t$$>f9UuEЉE'E܉EЋEED$EԉD$$]eD$t$$euEЉED$EԉD$$]eD$t$$eG$p[^_]ËV]XVT$T$$]8B k EAf+EfAUfDQЍ\ UUċPURUЃPUċMD$Eă D$$]AM܉MЋE@MD$@ D$$]HbM|MH D$D$$]wdMEEED$L$$]JduEЉED$EԉD$$]%dD$t$$d1p[^_]ÃB]ڋU܉UfTYʋE@%EԋBAf+EfAfDYVP]f9s/)D$]ЍDSD$DS$]/@]KEfHEF #]ډ]U܉UfDYȉE]CCҍ\S1҉Muu9uMu]EԋCAf+EfA]fDYȉEFFҍ\V1҉M9uM]CFEċB Et{MAurMЋIMu f};]KLً] MUMčQ UML$M $ЉE M9s HˉELEE8E$MЋU c$RUPURPE{]C%D؉E6UB%TEMa u>4$MԋU 1~1E^t$Mԉ $M Qgt&Hg.&v8gfffffUWVS 1V ƉUMED$T$4$RNjE  EED$T$$`EGfEf}MA U9tD$ML$$_MAD$D$$[]…@UfG|$ED$4$A7U9;GfEf}VE붋Hf9OtWuV1 [^_]ËPUD$D$$_UuV [^_]ËE}?98tD$D$$^Eu0ufp1뒋E}?98t.D$T$$B\tfGID$ED$$r^UWVS05 }EpFtD$D$$6^F w8t<Jut(F(G Z@Gv՝Ѓ0[^_]F(ǀF,}`H8J@ TPTU䋖:fJD$D$$H]D$ED$$ZuGF,TP\@ P| fBD$D$$\D$|$$RZuME}}8FtM$IwF FMF(~fNF(D$D$ED$D$ E D$ED$4$1!@EFЃ0[^_]ËE @EEE$U D…ME)tPEEVE$ƒMtEVUfVD$D$$k[D$FD$$Xk V(Nf\VxD$D$$ZtRD$|$$sXHEfM}}D$D$$ZU1뾉ED$ED$$[ZUyV(ENfM}}EfE1ɍ}}V(uNPf9Fǀ<xD$D$$YDD$|$$eW1EfEN,MMOD$D$$zYD$GD$$WzOf9}uD$D$$+Y8:fJTH|D$D$$XD$|$$}VH@ tEfMN,MUOD$D$$XD$GD$$VOPf9ukM9u:fJTH|D$D$$ XD$|$$U1Ʌ 8@ t%UVSä uFt$rF FF(U VUfVF([^]UWVS,*O }G,EԉGED$t$$T…G@fEEfEU܉GfEfft?fE<Ufy ED$E D$ $M.MUt(fuU܉B EftcU܉}B ueE苇20fHEDBtD$T$$UVB E1뭉ȃ,[^_]ËEMȃ,[^_]É  u$f}t3Af9EuAM]EEfG M뛋BtƉMD$D$$ZSEM]@fEED$E D$<$>-EMD$ L$M$YUEUGW E9uԋMu7?D$L$M$UE9uԋMEFD$FD$$RFfEftfm10ufpEpЉ&D$D$$REfEED$E D$<$,EMD$L$M$)TEUGW E9uԋMuUKFƋEA9ECD$L$M$SE9uԋMFD$FD$$5QuэGE  uKBfEeED$$LSMfE7ED$$-S>fE31mЃ}tYDqt0f@D$L$$RD$t$$iP1uD$L$$Rfu10ufp[u‹Uutqt1D$L$$CRD$t$$OJ@fE苇0fPUBuD$L$$Qfff̀rS[Ô =[ÌrS[t =[Ḉ̀rS[T =[̀rS[4 =[ḹ̀rS[ =[ TUWVSEU Mwv9tt*<9t!Xr8t)[^_]1[^_]ÐUWSUtmg jBgBrn(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVS蕽Dz \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PP,A}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVS } } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSGl{ } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVS華ôz EDžDž<|<sDz DE5NE=' ==D$D$D$D$ D$t$$%D$D$D$ 0D$T$4$AWtp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$$?o&w̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$U D$D$ 04$T$@ z1vpDžDžDžD$D$D$ 0D$D$$NUyPD$D$D$ 0D$T$4$T0[^]ødj낺FsGdD$D$D$D$ D$t$S$"`&C0D$$0D$$ah ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$q$^ /D$D$D$D$ D$t$b$ D$D$D$D$ D$t$F$D$D$D$D$ D$t$2$qBB DžDž DžD$D$D$ 0D$D$$Pt0 ><S,BD$D$D$D$ D$t$$`1D$D$D$D$ D$t$$up3fED$D$EЉD$ D$D$xF$Ku}u tTE E E t UWVS m X<$t V6u1Fk$Et+F|t V6u<$E [^_]Ett V6uD$<$KE [^_]US$Inl t$[]EEED$D$ED$ D$D$E$It $[]UWVSˠk E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$:F]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $?tljGUL$$?tMVJ}OUWVSj uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS qh E}E pE0EEE90EuNEU9sщL$MFD$E$]0D$t$$K&M)Mt2MVD$T$$]#ƅu [^_]1 [^_]ÉUt$E$]`=Et͋]E0U=UWVS(yÞg E }}8}xEEE3UHD$D$E$}%U)MMuE؉D$E$ƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$$1([^_]ø([^_]UWVSW|f }E pD$D$$("tW@ u^JM"D$ED$$!t&M)΋PUD$<$U9ur1[^_]ø[^_]D$D$$$ѐ̀rS[e =[̀rS[äe =[US cÈe EU D$T$D$ED$ED$ ED$E D$E$a []fffffS[.e =[.&f̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVS@ed tMƋuA~8t:F4@9s3`V8F4@9r$ =F8[^_]ÉUWVSȘc E}}u$7ENjE1txF8t1ɋ}E+wȁĘ[^_]ËF4E@E$]3F88]E F4F0E|U1E} OxD$`|D$}|$ F8D$L$$]@UF8)UV4V0]|D$ D$`T$ $~4V81}׍ @rPu B8~8BX]9uE~t$];F8]R9Ëtt]`8 t5UF8M]_8F8$:_8F8M$] 2F8tgD$`|T$|$ D$xD$E$?uUN8]n_t?]U_{]UWVS<a EE M$7‹E1%;E = 9ƅDƅdD$$ BƅC8DžD > BD$4$)D$ |$t$$Ƅ=D]D$D$$`IƉ׉t]g 8X9;-D$BD$d$ D$D$$  {tD$D$$Ct I\"U+ <[^_]Á}@ Džh1Dždd <$-D$`D$D$ t$D$$:~ 9WǸ։|D$ D$`T$ $9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$@tYR etD$dD$ $s@tUt=6tftt\1Džp8H41`9t9F@FD$$Pu9;dt9FD$FD$$F D$ t$D$> tD$t$ $>9eu d3D$BD$d$5D$D$$@p8/tD$D$$=tVBDž.D$BD$d4$g89:y``9_$0}d$?J4$09U8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$I|tD$DD$$<tT?I‹uB8`9r勅9s$4`9u닅$/'$wHgtStD$D$ $:D$G$`%Nj@8@P1f^$]GFU$=G=D$G,tLtD$D$ $9+_t΋$FUWVST <$E D$ ED$ED$E$MU EƉ<$[^_]US 胈èS EU BJ  D$T$$ []UVS /TS utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UwED$\$<$UED$\$E$UpED$|$E$UU؋M܉]ZGu]E؋}7ED$ED$ ED$1uD$E)ȉ$LMED$ED$ ED$E1uD$E$}MƋE]XQu]E)ًU)+U9sʅWE)Ӌ0wPu3U܋>xNuML$\$<$UXML$\$}<$U<5ML$ED$4$U ut$ED$<$UuUT$ML$E$UUT$ED$E$UxIEEYU܉u 0sHuuML$ED$E$UxEEED$|$E$UNu7};U}H UT$̮D$ ED$E D$E$]fffUVS r}×H EU M9Mr/9r 4 9r$9fu49rL$T$$ [^]fffffUWVS$}6H lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$rM1 ЋMu`EUD$ T$L$FD$$ ;u<tVT$VT$$$Ѐf1$[^_]EUWVS*|KG Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$gÅt@C؃[^_]Éډiu1V룃T UWVS[{ÀF u xD$4$1E%=D$($Džts@@@9uE ED$D$ EЋUԉ$T$EČ[^_]C1Č[^_]UEU U U$]UVSiz~E ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D ,D$ D$%D$|M$ U D$E D$E$]UWVSnyÓD E HMxPpt)rP@t3B E$L1[^_]ÃMt P@u͋MAUWVS,xD }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$1 ЋME܋UD$ T$ED$AMD$$9‹Mt+AMT$D$$&MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i=@1o$@1~BEH M?O1WUE PMt ʈP1]UVSvåA ut PtH J H $pu4$b1[^]UWVS:vWA uu #[tCtډu[^_]Ë$[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS Xum@ U Et7Mt.ZYutD$D$ $$E [^]UWVS t@ } uw vtօu 1 [^_]ËEEUUU܍EEED$E$HED$E$Ku#ED$E$CE܃ [^_]ËE+E1u=TEfH @jUWVS$t7? E܋E XE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1$[^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]GnE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]GUq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]k)EE9xsNMʋE9sBȋutftUE}8$]w)}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$]]+SSUSCslj;C ЉϋutftE)P)UKUE$]m1ɋU-Q]؋usStft]E)C=EE\D1.fvBvBAf9vEBf:X9f1vE3f+]]7]J7 UWVS }G tPwtI)7tI1Gu-)t'\$t$G$W,fO @ [^_]ËGDu1 [^_]ËG봋WU [^_]UWVSmmÒ8 utLD$4$F t$4$ED$4$$[^_]c6 ƀ,4$$2Flj4$[^_]ffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVS1lV7 u`6t\F t4VtCF uuIFF1[^_]FF؉Ft^u$VfF u4$볐1붋V0 t~@9t $V0F FV멸{ffUVS_kÄ6 uFft]|T$$+xGE%1= ‹MUtJM VL=u,i9F(u!Ą[^]ËEE Ą[^]ËE UWVS|j5 u$7E1F t)fF FCFFE+|[^_]ÍED$ED$4$EF u9vtlEE$*`!7 FEFEu E f F Fft$tߋE f F dFfxD$ D$D$@U$U`U$EF$UWVShð3 Ɖ׋@0$F0PE9EED$$qF0Pt$T$8$F0PuD$E$-V0UU쉂PF0ǀTu Xt$[^_]ǀX\D$$F0NjF0TXtXUlg2 Md6u]1҉]UWVSBgg2 ud68u [^_]ËF0$8F0PV09t'Pt($[^_]ÃT1݉UvUPV0ǂT1UVSf1 ud6u[^]ËF0$F0Tt$}[^]ǀP8$F0U)fR1 MU d6u]É]sUVSe$1 ud6u[^]ËF0$F0U t XtTt/$[^]D$\$F0ǀP8$F0UVS8_eÄ0 $7E1EȉD$E$KU+u 8[^])fffffff̀rS[$0 =[US d0 E D$D$t,@E$t []UWVS4d/ D$$΋ED$ E D$ED$ED$O׋U6Et F"-D$-ED$ t$|$D$$$mD$(_-8Q-L$EuKD$$9t:D$(T$ 9ЉT$9D$D$8tEVtEWL$ 9L$(L$ET$(9T$L$tD$(4[^_],UOED$$D$(1D$(4[^_]ÍD$0E|$,E"D$ D$(t$D$(4[^_]ÅtD$D$(t$먋E"UWVSb- EU uM] $\$M] @-}}$}M] $\$M] e[^_]UWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]lfffffUWVSb6- }D$<$`t(tt$<$#[^_]1[^_]UWVS a, uD$4$tfUtf|$4${t>UT$D$E $;Es1 [^_]*"y*l*UE U9r 9]ø]UU E9r 9]ø]UWVS`+  u \27E1ɍ0t-ωD$4$u t  PEu׉MD$D$4$ MtMljMuD$|$E$  8Ftt$E$. 4$uME 9t$$ǃ ǃ [^_]É TD$D$$[^_]UWVS_ï* u} t%>*D$4$tt=t1[^_]À=t[^_]UWVS0_U* ED$0<$tƉD$<$* 4$[^_]UWVS^ * }G$aƅtx @D$0$[^_]US^þ) ED$0$mtU 9P []1[]UWVS U^z) U\27E8s7i1}ƉUE D$ED$<$u E <=,E*D$<$ Åt:<=t4D$D$<$xU \27D [^_]1 [^_]UVS,[Q& $ u [^]ÉC$01[^]UVSZ& $u [^]É$01[^]UVSZ% $u [^]É#01[^]UVS cZÈ% uFfuUT$U T$$xFP^T [^]ff [^]UVSZ*% uV Ft5ft^D$ D$D$$!Ѓt>V FfV fuUT$U T$$[^]ø"8u V F본UVSYY~$ uFftAȋED$ E UD$T$ $!уN tFPVTfN [^]ù뻀fN [^]USX $ E@fu$U[]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu#B[^_]ÃHPtJ ȃB[^_]UWVSӉ΋t B SuUtBu{QtBunQu Q9tW[u믉 St2tAu(t@uAt@uSI[^_]ËtBuBB[^_]uUEU P@@ ]UWVSEpVUu 3t)+~E D$|$F $EЅu׉[^_]1[^_]UWVSExOtX1҉UM~]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSExOtX1҉UMy]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSEpEFM ]M19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)뵸6̀rS[d =[US#QH ED$E UD$T$ D$E$f[]ËL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffUWVS0P ƉE̋]E $7U1xu2  t8u)؋U+0[^_]Í}1 r}̍@G]ȉT=Ѓu]t; t\="t]y$]E k1d]̍襯UVSu] U؅tHNtuxu)؃[^]UWVSHPOm |$4D$ T$L$@utȃ"=D$ uƉFD$8ML$$\$4 u܉t$DL$8D$-+|D$0|$@0D$8 D$<D$@ \$0ۈL$D$8T$wN# t$ED$EȉD$4$+xE<[^]EӸ<[^] UVS<=Ab uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^] US@ UT$$![]UWVS,|@á $7EԉE1ELIBCE_ALLEOWCTEYPEAEBUSEfE=\278t=u tD$t$$ u߸MԋU+u ,[^_]1US? z'D$E $t []ËUd []ø̀ffff7̀rS[ä =[>̀rS[Ä =[USC?h D$=D$ ED$E D$E$[]ffffffSD$L$ T$.&&@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8tt& )[Í1[ffffffVS\$ t$tCFtU8tOu9vCV9u !€t.&CFt8t)[^fffUE1]øUE tUt1ɀ81U ]11U ]ùUU ]UE t&Ut1Ҁ8‹E1]úE1]1ҋE1]UE1]UWVSU ]E8tOt(G1Ht*t-Gu߉E8E1[^_]Ät1ݻ뮉E1[^_]UWVSU MuEEtxtAE1}EXt?:tWEt uԋutE}8E 01[^_]Ät)Etփ뢾u1ЋuE뼋u1UU Et$Mt!tȉ U1]1U]UU E=wMt1]ËEU]UWVSU ]Etttw1=w%tQzt.t&=vۋEUU2[^_]1ɅtE1U2[^_]Åt1뷻1UWVSU }uEt^tgtc1tt+9t#t=vٹUU [^_]1ۅtE1U [^_]þ1Ʌu1UE Utw1U ]11U ]ùUU ]UE =vU1]UE@E@1]1UEt2Ut/u }wE UM 1]øU]1E ]UEt7Mt"U tЋM 1҄‹E1]úE1]1ҋE1]UU E=wMt#Mt1]ËEU]ËE]UE1]UEu E1]ø-]UEUt(U JU1҅‹E 1]úE 1]UEt7Mt#U tЋM M1]ËE1]ËE1]UE =vU1]UWVSU }]tbtC1ɋ=w#tArt)t"=vݹUU [^_]11U [^_]Åt1ǻUWVSE ]tEt)uV1Jt%8tuE1[^_]Ätǻffff.&&$D$4̀D$̀fffffffT̀rS[ =[PS[ [US6 d6u 17[]&[]f̀rS[ä =[USc6È $1[]UVS<6a t [^]É4$\upU1f1ø115 1øUWVSH5  ts}1f1҉9r׃uF E̋ E fE؋ EЋE D$D$(Ẻ$UH[^_]f불U U 1EEEu AfEEt%uыqEuۉt Eĉ }t Ef } }t E t3 9s#M>u +N 9rt ƃ =@AEĿ0AEE! t xUWVS4& \$(ED$XE }|$8}|$,$7\$$1҅ \$X؉D$DD$D$$D$(LQD$D$8<%t2XD$$\$X|$D9s CD$XD$8D$8<%u΋D$8P@D$71D$Tt$\HZw|$(OD$ \$0T$8D$`1D$HD$LD$\|$`D$T7D$\t$\T$09}L$$L$TL$<2L$D9L$Xs'L$Xq0T$D9 L$ Nt$X|$<T$L~-|$L|$DT$HL$X9s0r|$LL$Xt \$DT$X9s  sT$XD$TpT$0D$\)B[L$DT$X9s sT$X;1ۍHЋt$\ABHЃ vwD$ \$0T$8D$TcD$TuD$T|$,؃|$,mك۸D$7-t$\L$Tt$\L$TD$ \$0T$8D$,X\$<8 t$\t$D$<$\$()9؉D$L҉T$HCt$xu4~9rg4$AfV$A;u u;EuD$$#dU+u8[^_]ø1UWVS<! EM uU$7U1ҍx Pf9 9px(qff9t1f҉m4~94$@fV$@L$L$ D$t$$t}tmD$D$ |$D$ $<]E+u0Ё<[^_]Ëqx(ljTL$qUWVSQ- R h9q dqA$7LƋE1D$<$mFw ^P $Pu atZ,pXt$ D$D$$zt$ h@D$D$<$oDWw hx\f9w1~t bTtjDžL$L$$~ut Љ9x CPf@@Px Wf Nj@GGG1Džt<Ǎ L LL$LL(LL,Lzfz9t&ǹ BHHH fWDž\E<$2fLJWp ~p1fDŽBDŽ|:t&t:1t:qt:q|:y 9uf@@ODž@<Dž`DžH,XXW GlDžtlDxtЉ@<< DžP$t ЉoGah@p|l@\ t4F<<SDžtGD$ pt$|D$$K{9?20G!0<$m0ttl9G eHH9G1$,0\m`<Dž*hL$L$dL$ L$L$4$ЃBw<$y/fLU+eY[^_]aËlF<.Dž1l@<cDžPf7H担tt ƍx$D$ t$t$$T$T$T$T$T$T$ $,XTdDžD$L$D$ D$|$$^P |7f90ua tVXt$ D$D$$辡t$ ȋ9~D$|$$;Dž`x$D$D$D$D$D$D$ $/XC)ʍ‹fDž@D$D$$L-8"0Gw0<$,u&L$$vOD$ |$|pD$4$ N@u a QTt$ D$D$D$ D$D$$Ct@Gk <$*Dž`qD$t$D$ pD$|T$$}p97D$$tT<$c*ua ',PXT$ D$D$$膞T$ D$ D$D$D$ t$PD$$蒴Ut$ tD$PD$,X$$0+8$0@  0$S)tߋjD$D$$stG,XD$ D$D$x$4tDžDžPG,BXD$ D$ D$$ÜDž\Dž`D$t$$|Gt0GR$D$ XDǃ<$'Dž@(Dž`$詼D$ bD$D$,$sGGGG+t .n0G0b4R u6d@t* <$&Dž\Dž`Dž`N`!!4 t5,BXD$ 9~D$dD$<$4G\<$%tDž*L$t$dL$ hNL$L$ $Ѓ.&<$Q%`VWd@WO,BXD$ D$D$$RG`D$D$,BX$$轹D$ TD$D$,$Ji\OHuttЉDD@<.<mDžDžpxW<$#D$D$PD@$(n6D$DD$$=x\D$ $^,D$D$4$&pD$|L$4$D$D$$$u‹p9DžfDžd)ff҉T$t$$v@0G0<$"@6xk<$!Džd$*9Gf\dfx‰)fftg҉T$|$$ủ@0G$4D$ ;rx|df9Gu a &,pXt$ D$D$D$t$ 9~ȉD$dD$<$.,PXT$ D$D$$薔T$ 9~D$dD$<$.$D$ aD$D$,$ff -$u\ =$xD$ D$D$,$CD$$lj<$rdHf+f)fffv҉T$t$$TrDžT$t$$5xDDu<$/Y?,XD$ D$D$$8Dž@<W@8MDž,XT$ D$"D$0P$ёT$ 9~ȉD$dD$<$++,XD$ D$D$$]MDž]WSa@TG0G$貱D$ +t .0G]$_D$ GG<$Dž@(@t$D $J<$Rdv\8U0@1<$D$ D$D$,$苽d<$f聰D$ a뿋D$(D$,BX$Fff̀rS[Ô =[UEU UP]UEU MHUP]UWVMu}u }E E=ɚ;~ -ʚ;1yA^_]UVSUEu M ]+M]9|) ZB[^])ʚ; ZB[^]UEU +EU uE+Ex]ø]É]UVS aÆ uED$$&uEEFEF [^]D$E$Ox(E EUVN [^]FF [^]UVS  uED$$uEEFEF [^]D$E$\Nx(E EUVN [^]FF [^]USMEE UQY[]UVSMuMb)E UQY[^]ffUWVSL }E E$7‹E!HW`D$$D$ D$D$D$ED$ED$ D$D$<$ ƅIu G$@ED$D$ t$D$<$XƅZWу @ 1 $QED$ ED$D$$ED$D$ D$t$<$ ƅ~QG D$D$D$D$D$ T$t$<$sƅGD$<$E+RL[^_]ËD$<$‹Pu@fffuGtwp fHfHff$6t$ɉL$ T$D$TP$褴PtGtftPD$<$;$vX$cD$<$D$<$D$<$^UWVS,' }U ME$7E1GED$ED$ L$T$P$蘳L$T$ :D$D$$=E D$D$ED$ ED$T$<$fU+,[^_]Åx$芺=wttH|.uT$L$ D$D$$_UqD$T$P$耲qD$<$9d\UWVS(Hm E E$7‹EE@ I<w$֙&T$$EP-D$ D$D$4$ DA@tD$4$KuDJ@utSFNu tDJ@tEpt$|$<$薅7$*$1U+u ([^_]ZUWVSLü }u E$7E1D$<$11Ҁ.փu9rMd9G GDGDDžDž\x.uED$D$ED$ED$ D$D$<$zU+L[^_]DžD$ D$D$<$dt9^G#GDGD}1DžED$D$ED$ED$ D$D$<$+GGDGD1DžDžDžDž.UT$T$UT$ML$ D$D$<$t>8=^G1҃‹Otth uAED$D$ED$ED$ D$D$<$RtD$<$ED$D$ED$ED$ D$D$<$PG tD$<$&낀xbV1@<t 1ut$t$ut$ ut$D$<$moGDGDDž0ED$D$ED$ED$ D$D$<$)Dž;D$<$ eDžDžDžpUfffUWVSlQv u} FM(}, E(@@4$ fF@fM(fV  ЋM(qfuf fAMEtXl[^_]ËE$V'EE$(UT$D$ ED$ ,D$P$P},~q EEML$D$ E,D$t$E$mƉt$E$EEFD$ $E(f@UE(E,) }|$}|$ D$t$E$FƉt$$ 4FD$E$"FD$$"FD$$E(f@  +E(l[^_]ËE P E, 9pE(@ D$E$E(D$E$E(D$$E(D$E $sE t*E(PE ׋us-tftu ։+E(}(fGl[^_]uu#}(GE(xE fUWVS $I U }E@4E)Ѓ FD$$)FD$E=b$VfFE@ uH1T$$]F D$$JG fffG F ) [^_]ø뗨u믍$aU >U$HU͸UWVSC M uU E@}ω}EE‰EPE)9UB9E9}}|$4$kGD$u4$YW׋u$sBu3u,u֋ED$+E$!+E[^_]äftˍvu4uC먉U$6UM MAyEfffffffUWVS( ljUM܋EGlE8u䍃EE썃E< t< tD$ED$4$`D$ED$4$AD$ ED$4$"/D$ D$4$G$u< tt < u>:([^_]ÍF$~d ʈdGtD$$i닍F$~GjD$$4SD$ D$4$tD$ D$4$uEO F $U~GGD$$賣D$nD$4$蘮tjD$D$4$zuXO@E܉D$ED$P$JOWL$T$P$+yO >D$%D$4$t*D$ (D$4$ugOD$D$4$谭u O@D$ uD$4$膭u OD$4D$4$\uZUmMD$4$蘛ƒ?v?T$U؉t$E$vEUƄD$t‹DgDH U+![^_]Áxservfxer< t< 9< t< tvD$4$< X11rDž\DžTD$5#D$ D$ D$<$sPD$ ,D$|$4$耭PB=kDt/RωփtftPB@D<ЉT$L@$gLt׋$ˆL,D$ $L)&D$M7D$4$*? D$.4$(gD$D`$踩DǀtǀxDž0Dž(Q$D@Dt$D~DD$4$ku덃$g< tt< uDž0<4,LTDD|$@$f<NFVe9xDw@ut;u㈕$<,t$$<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $4L{;$1!$tDž0pvLusL@DDu|uc' :D$D$c1ɉfLu LVfqUD$E$#]UWVSX^à }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|E99EttI\QD$D$ED$ D$D$t$oaBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[ä =[UWVSd^à D$0$T(@$riDžDžDžDžDžx@ N L$T$ VT$D$$ZT$$者@ 9@ωփsUtfth@ lj)#Pb덋ptŋ t|$$莄u똋P04$ɒ@9‹(tft‰)@0DžuY tftlj)@4#tF4$ @9r1‹rf$考@ $+xO1d[^_]U[‹);Wh@ 3ffk$V0P@~~ <9V) 9kVʉ)ȉQ1ҋ;tftH<@ lj)9ts9h΃r5@ $4$B@9q‹ytft‰)‰DžHtftR<lj)944$d@9‹yUffR 3PD$4tumuTk@ $sf+ f넋$~@ iUVScÈ ƀ6t$藟[^]ÍD$0$P[^]UVS9 ƀ6t$K~[^]U U0]UVS ut$[^]ÍD$0$踇[^]UVS|á ut$}[^]UEPM¸t]ËE@ ]UWVS< }E0upq @AD$0$ƅu!yH L$UT$@$tEG D$GD$ GD$D$4$u4$|G [^_]É4$|[^_]ËG [^_]UWVS ;` E 278 (-:)lj}싓( u2E  D$ $ [^_]Ít$E${t$$ ${t{( t1= ;txED$D${uًED$D$ED$ BD$QD$$x [^_]Í@QD$ED$ BD$dQD$$dx [^_]ËED$UWVS  ''w}  )ƉT$U$Dltn  UT$ $ltG   D 1 [^_]ÿ'y qUWVS(" LJ LJ LJ     11ҍLYEE5 )Ћ  ڍAw lQD>ЉD>]T>ӉT>YMHL>@CD> C k XWE֋ xzt =w ;QEt =w ;Q tH~k LJ yM !؉ MeM썇$  MLJ   M싗 1ɍQ]MEUtwM<9ErMtu艷  Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>YLWX;D> rU7UsD>HL>PD>HL> HX7Ë ; eTH P H HLJ X MULJ D> UMD>ЉD>]T>YLW]ف9QTLJ 롋 LJ$ LJ( D>ЉD>]T>YoMU(-E 27E䍇 $,UMD$1ۀ} ËE)؉D$ BD$dQD$$rUMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@pUM^D>E싟 ]X] É %LJ T f gUUxz Mt   ; r tXT H P H HX Ћ]!LJ $.fffffffUWVS0] EЋH , u䋸P }9E,^uԍ\Zu썰L[u؍,]u̍]EE]]Efg E苰L JP X u荾,]}؍,^}\}ZL[M܍]uE苈H UȉUE}uufd t1P}艗T PP , 8 X 5R}苗d \ D$8 $d \ 돋D uЋ@ Eԋu؋< , À8 u }胇49u}UX P ,8 E苐4 ,X4 U苂\ }]苃4 D$ D$< D$, $BGP X >E苀, P[^_]ø]苃, $$Eky…MtO1EP-}L-E7LEDXtE7<$]yƒ9r̉E17R1KU}X MԈ@ }ԋD EU}ԉ+, EX Ћd U\ }Uċ:O,T OŰU苂P , U9E2\9ËU)Ӊ]W(EUȉP H XND]荃D$$f!_E艘T 8 G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]qZGt/U艂P Uċ:MO u#O)ȉƋ_uGE荀DR1uȉMȁ vE W18 M苹d \ MċKщˋMD9UUċ]苃8 $fUuUȋ]苃8 $rUE苸d }\ M[^]=f} 4,U} 8 D} 4 3} < "} , U} U4]Uͱ| U8 ]U赱| U4 ]蠱| 0 U茱| U0 ]UWVSzǗ| \ u"$d uމ4$MULJ\ LJ4LJd LJ` LJP LJL LJH LJ8 LJ4 1[^_]USİ{ E$CL[]US衰{ E D$E$IQ[]USwÜ{ E$T[]øUSNs{ , D$ED$4D$ BD$,SD$$z\[]UVS{ uD$4$Iff D$4$I[^]fffUVS 貯z EpFtD$D$$8F!u  [^]xUWVSInz uM.D$ ED$E D$E$赕Te>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$1DžH V€ʀ UTPjwD$ D$D$T$\ыU !ȃP{v ww0<$xT$8v01[^_]À Vvv0<$  PxD$T$!HP^E E DžTED$D$ D$D$$}Džt HƁ Zuu0Eu0 HG GG G  GGGD$D$L$3PLPP LЃHtfD$PD$L$5H  D$ $PP D$돉Lt8PLen  P6D$T$nWP@ ƒ@ urb2fffUWVSu }EpFtD$D$$3F ^  D$4$u_  t$ur  T$U4$Džu=U9B0E s[^_]1UD$D$4$ot̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$+2[^_]UWVSɨs EpFtD$D$$1FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$e !@MuFЃ[^_]úЃ[^_]ÉED$D$$1UЃ[^_]ÉpUWVS$菧ôr }9EUEEEE;E MmG$Tu݋M…tUL$D$<$VUUD$ ED$}|$4$/u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$]uU|$ $cE}E9}twu})D$D$$] #9utAFD$FD$$] tVTP‹}u뙋u]b}8[^_]ËEpE )}fG w[^_]fUWVS!Fd ƉU׃ VU)D$ED$M$ GMf FE@)D$ED$M$UҋMf f>\?)fDfL[^_]UWVSvÛc E xfEEETf}tU)ƋUJ;MLW)ȉD$T$ΉMщ $'E9EU|6DU+UU\WPHftffP9uEftWf4T]TfTEfEh8E H1[^_]ËUƉE봋uv %E D$E$P[^_]UWVS$+Tb E}EW u}EGft;f~su f ljEfGfEnMfyvE̍DTQ9>ED$E$E@EM $M̋UEHfEEf;EЃ<fD M)‰UύU)ȉEEċỦT$MȉL$E$V9E U/MfyvE̍DTQ9ED$E$E!@EM $M̋U+EHfEEf;/]tED$E$f1E$M̋UȋEE$M̋UȋEf9MsFfED$E D$}G D$|$ ED$ED$E$ uOEEtE@EEEt5@EEEIpEE@ =]c]cx[^_]|Af+EfTM)fLFMfLFD$ ED$ljD$E$eEtpE@ =tGNjUt(ED$E$f}EEEfEEEEMt봋EEfEE1UWVS$FkO Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$(ED$$#Eu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$d…t EME$EPEwD$ |$UDBD$4$c tʋ@f8 $dž KUWVS(蝂M EE} w8}PUEEE@E|FBU M9sωU DF)fEȉ|$UT$M؉$]F)}}C}ffE‹M9sfUM9L>f+MT$U܋ED$M$]UU)UMfL>fD>}f)|FfLFE pH|FU҉׋]9s߉]9TF)ʉU|$ED$M$]}CUfFfۍD\M)f fTN)}uefDE H14rJ|F E9PfD>([^_]ËU9ZC8fDE D$E$]E tpHTFUWVS K EE @u E1Oft{DXND$ t$D$E$]`ƅt|$E$Ff]PMuJfwfuf|Xu E녋U R1M AMf E@ =fEɍ\)fDJMfLBE Ht$E$]t9t|$E$Eh81[^_]DXfBfBFi[^_]fEqUWVSw~ÜI U EzMq uf+4GMM9U t$ED$DM$Lu)uD$ U T$MDD$E$^…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$趵Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS=}fH Eu} 'D$ D$DJD$4$]]tDPfzuft,ˍ< fD$ t$MDD$<$\ aLJ(@f8u$LJ 1;D$ t$DHD$<$T\…@ fEB@fE1fEE$MAE9F ED$EFD$$#M1U)fUN fMD$ t$MDD$<$[…ZM_LJ $LJ(14CUWVS(kzÐE E։Mz@ =uW)ЉEN MMȉEGfEt$'ED$$UE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$@Z…t#M L$M $MEEvEjBUVSu]ED$E$1ɋU Ct1[^]øUWVS(xC EuD$E$1ɉE--D$ED$E$]HEED$E$} fG fE @}E;EEHp@ˍQU40fUt0UfHUff]f\ftPE ]M HwOfw]E;EE t81([^_]ËE jx}D$ |$D$E$]_X] C$NfMЍLLXffFfLF|$E$]DžtMfNKf̀rS[$B =[UWVSTvB E؋}u$7EĉËE1;FEE 9b}}TD$E D$<$]A@fEҋ9E E҉EBFEȃEYf]YfU])Ӄ9f9UsAҋ])҉T$DYD$DYMԉ$]MAfEAfEԋFEUЃfQEf+EfA]fDYȉMԋMȉ]XVT$T$$] D$MԉL$$1uċU+T[^_]D$E D$<$]M@fE҃}t>}ED$E D$<$] @fEfEEE܉D$t$<$]!EEEE܉EFEEuẺD$ED$ED$t$ D$L$<$]|D$E D$<$]tK@fE҉ED$L$Mԉ<$]iM1D$L$$]s]UWVS(s> }EpFtD$D$$FG!9t~rd94D$D$ $ZG)‰T$T$$""E䋆E} v&6<([^_]ËUE} wڋM^E 8t9  u|$4$tH9s`!EEUU,D$ UT$D$4$VOH9r!<ED$ ED$GD$4$u@}} u~$ D$E D$ |$D$4$"([^_]F(~$E 8EE 89뤋$U E\UUT$L$$> H(T$ $GE$]]]USp; ffff]}]ufffffe`[T$Hfffffff50+&!fff] ]UVSo; EEEEjuVjZ uǃ `!7tj.jj-jVjj.j/UWVSEE] }3t>uj/VZYtp@#%t0MPV0ZYMu}] EEAe[^_]Vh!hU!h,'葎UWVS]u 6_h!VS tful6-ۋ=p,)u=-u h!u Zt- -!hj5-- @u5-hDŽ!j#hO!Xu4'hЄ!jMUW6/ZYMtUBk &%u6h!jVKSW(&%P_UWVS] 3h5"jh5"Su @t h!p,DP)-Zu-#1-- (%5- (%jjP- y 5-- -?=0@,v-u h!j-u#--!- (%- (%(-%H%hPRi- yT-P(-%H%hP5-ң- - y5-h]#j,--Q(-u--u-H跛-uj-D- -9ӡ$--sz-tá-e-t-----  -t謢- -t蔣(-%h=`u; - ----%-RP5--P (-t ḧ!jh-hj')hūj)1=-=-= --h0@,P0@,T5(-t'H-L-@-D-;0-4-ss -- u15-5-5--P$ u15-5-\- rPPh]#軠+Y[-u5j5-5-5--P  t5-h]#xXZ*-------K-]-](-] --9Uu/9Eu*--ڣ--@-D-6esEUӣ-- --H-L-(-t1----jJ1=-=-XsE--EUMth-l-EU-uRR --8-8-=٢u=u<=uL*-t=- -9ȋ--s")1=-󪡸----- -t jP[Z -5$- tH -1=-󪡸---- - -)։ -5$- u-=-ujPY@u08th!5--PZ@u h{"jjUWVSX ] 3>h5"jOjvhی!Su  G-$L(%|-1l-H-x-t-1l-H-@p-z<-l-1=H-Yh-J15l-H-3d-$`-1ɉ l-H-\-X-T-P-L-=D-th?!=l6tu hd!jG1nuou8-j,PYZFt@jVD-^Zu ht!W8pj,WbZYt x>1>Ph!h,jp-T-=t-t t9h!Buu/ h-t'h!&=h-thG!\-p,jW|@-ZYu hn!y;O|-=d-t11X=D-uمtՋ=X-jWY[^t' 9=|-tЃ=d-t ]tlj茦ti ȉ=X-\t 1Z01C PbjZP0Ptt 1B"@-~h u)V_Zu h!j15@-DRPRZYy0ƅu(3%=`u ƅu3i@- PV bY_=@-i =`-t9PV$YZt=P-Vh!.}=d-t%" r=P-ugh>u#3hҍ!. Q跤u =P-u7h>u#V3h!n. G=@-=P-u3h]#KXZ=x-t4011Dž8hh$P L-5x-8i@- 192t;t SY PtZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =t-u1&t-@-=x-t50X";@-si 7C1e[^_]USEEE EE0[1҃vU|r҉-UEhۑ!RP* tvpt.Et?SuF-Ƀstxu0 -볡l6---Ph ,%h,p j$Ep,EE)ЉEEt9E8-u/-EH~p,)EEEHEj蠿1ۉ$ZuYh]jDXZjj9Y[hj+XZh@ -Yt1h,h!oXZh!Yh$j_-Et^E8tTE0YtEEj0YZyjZ,E8!tYEh0h- @Et9h,h!àYXE8tjZuh!MXx*-tPh]#Y[hX,X1y"= -th -h"h, uY=-=-h,h!ZYh!1ۉ$"Z&f% ,1-냋 -| thr!Xf% ,^1 -x(2x-PRR tt 1j1ɉ -h,h!^[Xh!1$d= -ujpjQZuh -5-h!h,[h -h"h,B h,h!Y[jZn= -uj袤h -5-h!h,UWVSXu} 7+h"YZu! ful6h!WV utt p,)NvXE8}WGZE1,% tAB9EsEUPQMW UuMt6QWh!jփ빅u Whْ!AE@t1j URPE ;F|E8tEph!jE1~PS詗YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW蟜 UWEffEERhm+fEEERhmW\ 1!EPhm8@W@ x E`,%6ShoE"jf9tfuPh!EPsh!KU1!K U8! duuuuuhtj@u Y[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtP%Z\tSXIEt'U)RPSSÃ~t C}u"h'!h'$2EZYu ha!"}uEEuh -WuuEpEP!u yj= -y h|!}tLjuVjhSy h!:XjVjh5 -y h!Xh'!'2juVjpSjVjw5 -|,u1ɉM̉MЉMԉM_1X/%H>v M DGu΍EPEPjo = -t}t.D1}tEmjEP4X/%Z Gu蘱Ey htA"jZVh~f5 -&Vh~fSSMUE}u j u8XZjUE 0Bj UVSEU #jJ -uc1E1ۋ4h1%Vh."uUCv`,H`,Y^yhX,j 5XZX,PX, Cu u1e[^]ÍL$qUWVSQxq14E-8E-@E-DE-LE-XE-0E-TE-HE-,E-DžDžDž1|h !V @I&/0$1%S'$1%1A,A,A,sA,d,E-jP5l6 :uy5l6hw!A,0E- E-DE-XE-@E-tFh@I-h!y[^h˿!h!hh,jdh@I- 6h!ۋuw1ۉTE- 0E-ueA,=XE-=,E-A,ucÃ=@E-uMh#!mYtpjhO!XZؙjjjjjщڸ{!ih!`mtt Sh!x^_1^G-@u ^G-0E- LE- TE-1x=0E-D$-Džt~ Džh! :2G-Y=tk jhjjjщ¸!hƒti¶ f2G-jI-DP4XZh!w9Fjh$!K4G- 11bG-tJ?tEWh!fG-1ҋΉT 9u9u @u1G-1;=I- I-؀tet\Ph![` I-1Ӌ Ɖ\ 9u9uGtDžDž19~JCWShD! މD 9u9uG뮋y1RPjjjʉٸU!fTƉVf=\G-?1G-2%t2%u ù19rGD80G-G0G-E-11ۀt,4G-t#u;u u@ $ut0G-u돋5I-I-19}{.tK;tFȉP^C219u9t0G-A뢡LE- XE- TE- 0E-=@E-uYhi!6^=LE-tȉD- lD-t h!5[h !hYtMD-q`D-q2D-}q~ hE!?Z`D-dq~ hd!&Xƌj񋅀Ɖ1ƃu h!ϡG-11;G-ÍPP ]ZYx+=w;)uvxE-=tE-5pE-jStP 1eY[^_]aUWVS}] 1ɉ1Dž1h!SWC rfq1stw51҉j P5l6El6 8t :tPh|!&8"[N5l6h!j1Dž-Džp,)Ot֋jhP6P2yÃy2 hI-hedAP y h!=jJ-]9 T@fjJ-1ɋnXu uXh!jhI-hX,蛓諎  tȸo!u5"Ph!\ZYDžfhJ-hI-讎fhJ-hI--k~PSyh!ju"PhwdS h$!1XSk1e[^_]US] 3aSu*US] 3aSu讖US] 3aSu~UWVS}1ɉ@j/E 0[^K-t@E K-­~ Ph!fXZ1 $11<8,(Dž4h_!u Wà A6$D%Dž,jhjjhl6!8jhjjjl6!O-jhjjjl6!O-P-Ajhjjjl6{$ $jhjjjl6!fO-`jhjjjl6F#?ƃt @5l6h!Y[l6O-jhjjhl6#P-jhjjhl68$P-jhjjhl6!P-jjjcjjl6#mA,jjjjjjl6!LO-I@Phjjjl6##P- jjjjjl6(!4l61҉j PSJk< 8u 8t Sh}Crl6<1@CrC,r C1 ~%r0B5l6談~CX1p,;E}0} : P-Dyt@p,=F(~uƹ),~1'rC1 ~ CDž}rl6 h!nh!jhr ~h:=`- jchZ!6!r ~>XZz ~<~Wh!j hV!~Ph*r ~9H~h ! h!HZ$ jjErXZjzUWVS@u} E@hB"WV' tTHth wT$ U%ЁȀπÀ5l6YK,X뫡l6|K,1ɉM똋p,)Ht4jVh! tVh!h$j h -7 -jV)qXZy Vh]#j7 ]1uȉuԉufE5K,]S|SjWyhB"^jhyt Wʴ yO8thB"95|K,hCt W衴 yhB"}tjj蔛Y[t hB"j蕏1҉UUUUčEPoXUWVS8]u 1E62XhCL"VS股 x`At$M4-ăa$U%@-<-8-K,2j"덡l6-!0-v,-k(-`$-U -Jp,)Ӄ= -t=(-tL@- <-t&=,-utu@=-u7<-+=4-u =8-t#u=-u<- K,X,U1--hßXUu hQL"j=<-tEPWjj11ҍE51-tjh*A"P[Xu5-h]#j蛍1ɉ -jjh-jV_Ãt;tMS觧ZVֲX"4~FMK1= -e[^_]UWVSE p-EX1=|-hP"fPgZYu |-dhՀ!PZYu t-jx-g!轨l?: 5-fhՀ!P]u -P"=-tUk"P$f_tPX~5+u!zt~Kh$WZYt Wut bhP"eh-_t8u%hP"eh-PeZYt h-<"hP"ed-PeY_t d-P"1=x-tjhP"K_Z~Pv9j荋K =-u&jEtYuKlj!tj=ȫ-t- t-ujhP"^XZ)jjo^_=0-uh"5s,Y[uZ蚋~jhQ"j50-&$)Ztj'--Bu@td--6tsu΃=-t$.H~ 1-=X-u !`-=,-~jh'Q"Ej jA FjUWVS]u 6---Ƙ-|-ah"P ut-VSD[^~Oj:Y1uhf"j9~!vu0-h"VSz u%/~k |Љ=x-vhz"XZšp,)KutmP-DPu^S購_=vhh"hSh@-a ;tC-@-5x-h"j ]S|h%jҼh%jƼh%j躼h%j讼 S%H^u h"j)@uh"jhX,+hƈ"A u w,->\h#"$S[=l-t"5\w,QYt5\w,h͈"j轇)t Phވ"j=l-u5\w,BQZu€=@-t8jj5-i y h"*Pj5-h xh -j謘`- - `-%l-%`-%d-f-- f~-x-/Nh-褚h-蚚h-萚hj'Y"=t-tM"Ph]#Z-^_C6f=\x,t j>.[4ME8w,utQEڃ=t-u*t{8,x,u1f=x,x,< t< uG< t< uMjEP5-@P f=y,{5"} uA"P3_8w,uLEE5w,PMZYf=x,tCۡP-t H-fEjEP5-O f=y,uEPXRhe"jbUWVS E 0(-W1-t.h+"+Y[t *"`3"d`hI"ZtTJ`MBugl68tpjRPZ :uS1ҋ -buV.. -ht"u u贖à uC$@%5l6ha"..먃 -륃 -뜃 -듺{"l6_낃 -vl6u#h~"h%h0W -h"S^_À;1h"SHZYƿ%t&VRS1 u <2t&h$S^_SPh"@ - G-O3u8=eRh" 8=tRhύ"Y[\3h$S蘨^ZƋtt ug(S衶YSYZh"4jPSI‹ 3 9r(<,tuxG -QRh"SV7h">\u5l6uh<"h؝%hKh"苷1k$@.t!VPZYu@.-yGhK"VhN"j蛧l6 -I=p,u)- u\~=-u,P7Y@u h"j臁"]--Z!Ãt~%t%Ft!á-0Rh"  s-0h"XZ s-0hߎ"_Xt Sh"[^j uh-"tthQ"jXE uC.3hRjǃ u R3hoE"xPhP襆 tlj=--t $"1 X$.hPW`- uR5-h"jh-PZY@u5-h"-t&h-P_u_-05-hÏ"jy@.=.t8-8th-PY-u$߃8u5-h"j3=-uh "h%h0hjs`t. u sh%"hx.P!_Z@u shD".%=tE-Bt,=@t she"\5t.s`t.Y sh"7Cp.-5-h"蠪-_Ztpp 0hŐ"胪 -uB.%5"=@u""up.u"RPh"6 .t Ph"Y[--th-P Z"8th-P_$"#Nu@u h."j}h-P^o'"u RhX"(-%=u5-^[@u5-hv"@x\5- _Y@u 5-h"t.tP^Z@u5p.h"j}j蹢UWVS}u 1ۃ~^;-tp,11ɉ<8Dž4h"VW it1҉4y,t+:t!;B uBul6B뵃Pr5σitot8DuFDž<늅u l6{Sh#h" cDž8Tucdx1jSV|Ctjjj0Sǃuh%VhiP裠 @u h7"j{Wk]Yy,7tvFtjNt^HuTjItBQ cZ.0QXɋ0u hF"j{-k돃넃8td4tck<tfj蜠UWVS$u] 3h5"j- h"SV Btb$%jj5l6*.......s.d.U..XGHHf wT$X%luAjWhC .w `PwhoE"2Džp tt\tGPpVZY`t OP9A_PwZYOdBwh]#ZY$R8t h"jrpoUWVS]u 6h5"j1҉.... hǢ"VS詄 >vBeR0G.f"$%H $Р%a...G.1..a.1. .?.1.1."..1..1=.....p,)ӃUq.=.t*thԢ". . .tbh "jpt3=.||=.t=||)=.||| Dž|4{.j.PCx<hSh},ۖ=v ShM"<h},Y},},X/tK},},1hj=XZ=.t.Ph},,x/uP},@},= },wPh},`Y_@u8Uxt)o%=@xtbK=.u=.t. .t P6P6c_Z@u6h]#j#o%=@t /t 1ɉt4h},h_"jn. .tDžt Džtt$P}ZPvЀ8/uj|VW5x 1lpupCpQh},B^Zh},CHfuFs #PshoE"pDžlpx8Xu$wfushu"谰Y[ftf tt)},C,-},=~TSh},h"i o{DsC(huTttCpj/V}YZpt)xphC">P,YZphp>h)8/t z/t/Bс},vPh},h"赯 VPRpp}, },= },vx/uP},@ߋp=.xt Ph}, Ph},^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh},hգ"CP@% =@B%=@t,M1@ush},h"1Jp΁@tpw `~||t {DPSjZY/sH . .u&fNush/"Y^jSx#;*f5.V..lhO"h%h6tCPph},O^X=.h},sh! E%=@t%fuL=.u%.H..yhw"h%h?jRVaZYhb"nsh"ZY=.t'PRi=.tPR+iPSab|78t h"jix3lIUWVS|]u >j/W6yYZtxhk%Wb_Zu^h5"VS{ @uip,)Ãu]p0LZY@u jj6ije;LtEPtIFu'</h""VS4{ w~Fifw$ %10/0/@/14/$/8/4/1@/,/t(/e$/Vp,4)Ã=,/t /-=</t, /=1=</=4/u@/1ɉ $/ttu#-$V1ɋbhP|=8/xt)SWYZuE%=u SWOXZt Wh]#jgE%=@9tg ÃSxUWVSu 6} h5"j莅jvЉÁp1thb$Vu3y tVmtDžtptc5l6 Xu5l6h"jfhW pW 딡p,7h]#ߋ^Xt!DžtpSZY_yɾߋuڋtVlUWVS}] 3h5"j h"SWv tUit)ft5huP/σvu?/1//15//뗡p,)ǃ4jt/h# jH =/tuϋV@PFTtP2l|pY[uNj|%=@luh2lQ$à =lv2h"jAcltx/tlƄ/CGh>WZD>8/u 9tH@j/WrZYtPRdY dvWh"蹥XZ"@PRl!? t DžphfpCUWVS@] 3/,Su$]Sj>uEUEUSjmr^_Sj=ZYuEUEUSjIr^_Sj=ZYuEUEUSj%r_XSj=Y^uEUEUSjrXZhC"u//1=/=/=//P]1E؍}ȹE? uVSjhxVSjX x"}ujVj? y}tVSj$ xjVj y}tVSj xjVj y{}tVSj˗ xjVj踗 yP}tEVSj 虗 y1jVj膗 yVSjt x4y yhK"0jP5 ^=,tUjh-$/A,[^y 谟hk"0j5/ #=,u=x,t I@h" tYt8u`!V襓ZÅt @|/tCPq/_uh"j3/ZYtlj؍P//h/ h`: j输, t! ttBGuB^@J9=/t h"j;_[=,u,nt //e[^_]UWVS]u 6 h5"j1} 1hR#VSp tLtPt9p,t4hM"r_8/u|h"P辈Y^ukh"S譈_ZuZPS Y^@tHxPh-$ _Z@t2|9u;xuM9 u;Etjj賲Y^uj S!hX,fXZd,@t h!j]jdUWVS}] 3h5"j{ 1hJ"SWo ft]/WPtwR)d/벃vtbit6rtxu{//1/p1//Z/K/</-p,9=/K2zu8QuthT"ўXt/؋Ht ʉA?jl/[/ /u t1=/t =/t@jPW6"ǃ uht"C =/t.u)W;&XCHHf $p%PDs }PshoE"jZ=/tC ?ƒuts |PshoE"蟝/k=/^KPSCd0HjSW*C 1ɉK +C  Cu>S=/tCHSftYwifu`KPC/usFkZ=/u&sh]#/Y[RpVS>E9jh"V uVSyEZYVh"q蚋E E}tSju~ y hB"jlQ}t Whgtu5v y h"XjvUWVSu 6fh5"jwo<)/ xo/11ɉhdt`p11ۉljh,h"VuJ[lRtf(LtntMH1һ뮃PthtPdtXfuyDž`뇃vuhDžds=l6hDžpYMDžt@Džh1 p,E)t 4Hubupt uY//t//pt$t*tt h"jGO t)//>=/tzj:W{OYZt@0j.W^YZlt!h/WӘ_Z@lu B裉>t0<#u/$)/h/W蓘ZY@u ۉk8xPWPZY@u Wh"jN=/tE/E/jSV2ǃ 1uh">pu jSWZ W1X CHHf wg$%s pPshoE"ݐDžl=s oPshoE"賐ttDžl` Džl/ht)KPt;Qu/t;Au A<5/RslЃ t"`ush]#%Y[dsmZ蔌8t h"jMVrUWVSu v=fT/h/< P/ ʈP/d/=P/ ʈP/`/G1JPhmdP; h"jCm^~W\DYu Wh"P/eȺ/t jSR&D h/ZIPՙWhUWVSjj]Sjjh%a@u h} #jBuTYtjjSPjh%a@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQMQh]#nU1G맅u) `,yhX,j sXZX,PX, 1e[^_]UWVS ƅ]-ƅ_1ۉH/L/H/15P/T/P/1=@/D/@/1h* #u uS ycPtJTtgxPl$% 0/뫃 0/q 0/ e 0/Y 0/M5l68/Ye5l6>Vj:VxA[Zuh #SHP/t)XV3xZYXu C[ӉP/=H/t h?!j@l6tuhd!1Ҁnuxou܈,h$P{^_t5"H/芯֋=l6u 0/i5"l6@/\OKh`%Ph #h,nje^]4/i0/t0/0/t 8/p,M Tu)tP1ۉXh~n hm 58/R请XRrRh"RLQwZYTLS譴jjLRPV9X}XTPT0VhP)à uj/SNZYuSh!h$hSiVF)Xu"V(Xu9S(^ty2LhV(à LVh]#juhy!LR5vZYh #LRvZYSh; #jjhVjSb@ǃu Vh\ #j=h`/hzd@Pb uWX/`PhedAWb @uVhm #WNVHqH__9~Vh #(NE X= 0qh~#5r@@0jxlP5@0phP}#f'@uph~#B0@th#A jr HM1󫍝`4󫋅 =d0u d0tJl0 h0P[^@=d0h0l0s=x0u;h0l0}hR @uh#P%ZY@uh&#=x0h0Và uVhoE"j]Ph0P ujhh 0jPyh 0h<#!P%^_@tڋ%=`uh 0hN#1=x0jjh 0 yh 0hs#jPY[uh 0h#jh 0h!J %0t# 0VRW9K^ZtN xRjVh!FJ u ƃrVWJYZuSh 0h#j=00u@00`PP500h 0@uh 0h&1=00,0=d0ud0 h#Ytc uh 0h#h$#SJZYu&$0uh$#SI^_t t Dž 0?=$0th!h|$SIY[thp!h 0hl &Džt'd0RP5l05h0ph0l05h0=l019|Y<@ t d0SQRP(  5h0=l019| h#t5 h0l09sSQRPh#jtdd0 h0ˋl0%h0RPP4 @u+5l05h0hD#j^'0P_Z@uh_#[^ ƃ gZ(CwFk$ &Dž뷍FL$|&jP5l6踺f, :uPfnPhe#0=0I0:jjjjjl6",Vjjhjhl6F#t0P5l6h}#j jjjjjl6"50jjhjhl6# 0jjhjhl68$0jjhjjl6#0ujjjcjjl6#,Tjjhjjl6}#u00Phjhjl6#I00l608h#DžDž}p,)Ӄ=0u 0KtZ14`E =0u 01=0u;00}hP @uh#S[_@uh&#=0.#jhh0j yh0h<#SZY@t=0jjh0 ƃ yh0hs#djP4[_uh0h#;Dž0jh0h!> u Dž0xxjWh!= u ƃrWv>ZYtWRa>Y_uSh0h# 뀍`PPjh0 @uh0h& =0u0u h#jt] uh0h#u7hq$P=_ZDž0t h!h0h&j`Dž0t(01RP5050J000019؋|i<@ t" 01SQRP 0019| h#t5 009sSQRPh#jStM00 0mRPV( @u'5050hD#j(1$0PVyY[@uh_#ðXZ X`&1t\&1У`&1`Hu 9p,t 9}hh&2(25"(2%Y^=u <(2 <(2 u(2(2f'2'2u'288ht,'2hu ~ <(2 1~ <(25'2=@(2W D(2Zu Wh#j<(2@0(2P-t DKt@9t)Ѓ ~hX,I50(2h#j[EMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPhH#R-Ƌ'2'2H19}L'1@91B<(2uQhy#$&_9~'2'1Ph1("&CZYj %Xtc 9} '1FIT&18(2xt&jSjh5,(2@u h#FX8(2t&jSjh5,(2@u h#X8(2t&jSjh5((2@u h#X8(2t&jSjh5((2c@u h#蹥X<(2 t-f&1&1(2&1d&1&1t'd&1ƀ&1')ˆ&1ƀ&1d&1( d&1&1)ȣ&1&1jSjj5,(2y hL#g&1d&1@dB<(2f@fJwuJB  '2J (2J s*EjEPj j5,(2-y h#wt)jwPj j5,(2y hҗ#=(2tTjh'2j j5,(2y7h#q s'jh'2j j5,(2y h#D'25(2SSPh&2h;#'#jhd,hh5,(2Lyd,-d,hX#jhd,hh5,(2 hj*1ɉ '2 '2 '2 '2 '2 '2 '2'2ESEĀ1ۉ]]]]jEPj-(hSje*Z ^_19\&1~h &1jCXZh&1j&1^_ٞzt,-&1݅(=&1ݝ01ۉ@Dp0%ݝ@1ɉ04h &1jXZ݅0zt - &1݅(=&1ܭ0ݝ@`&19X&1}y݅@؞vj &1%10%s=`,t#<(2t &1%1Fvܕ@vq݅@g0&1t0%H&1vݝh%1 &1݅hܕ@v݅@r j ݝh,(2EfEjh'2j @݅hu h{#S l0%ٽrfr fp٭p۝h٭rhPjEP! (0 C38"  hϔ!EEPURj5@(25D(25,(2Ly328 O h#4h,_X h &1jQD(2HX[^~9LU8<(2_  utOPLh#4 LX)dHhh@;T&1 hfXX&1Hff9u `,%1 &1%1%1 %1u%1P&1<@P&1<(21ɉPT s)hPU@ EʉU1҉UiE'%Uthp U%1 ݕP(&1(&1݅P &1 &1h,ܝPv ݅Ph,݅P0&1v0&1؉ff`(25&1v!`t:H(2tjPh]#j}tVSFh@"j}DžuP_|j#t8=d02tj jh@"Wh#=`02t j jh@"Wh#j'8j jh@" tVWhŝ#jWh؝#j h5"h!!h#jjh5"h!!h# }u4jjNjjEjj<jj3 jj'jj jj@u h#jjjZY@u#8th#=j踛X}uj襛_j jZY@u"8t+h #5Y2 u h"##&Z WbXVSwhI# "0jj3ƒ 5"Bu#SPh$jUWVSDu]  't32h&SV v~j cStITtbLu32뼃dw$&32323232zp32k32\32M32>p,)ƍB32=32tjjhDg$32 >Ejjj"32jURh@hP @u hH$uY=32y h%j;u=323 @ WZ) (    mt /  =32t1ɉڸs 1ɉMhjE؉EhjE܉EhjEȉEhjEĉE hjEEhjljEhjrEMU ʃ} ʃ} у} хuu hAQ"E1҉328gtj532_X1ɉME5"E5"FEȅ"CEċS:-0BRU+ZH3U$&32"0,320,320,320, 32uj|32[x32L32A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸ ECEu/CEċSEP1ɸX32uCEċCUEuKMċs t^032hw$&]1R832F@32:H32 .P32@"X32`32 (32 32 |32 x32t#  32 $32 32$32t1|32jjVg1C R32u#EPM̉UEXUUuEPM̉URj^uCh#%sMZY=32uhg#h|#h$  32CHw)=32uh#h#h$ 132SEP1ɸX]ċu32Muhˢ#5u>au uh#"32Eġ32}tuȉuth #j_Mu}t }EEă=32uMEȉE10E18021atctguIE02E020232@3202320202 323202U9sHxt)Ј32t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ 0232tMutHXSVh02M =32t =p32t02##32tE}tHpVWS =32t =p32t0#232tE}tHpVWS譵 =32t =p32t>#32tE}tHpVWS_ =32t =p32tL#32tE}tHpVWS =32t =p32t]#H32 tE}tHpVWSô =32t =p32tj#02f02=32t!=p32u=32t02W=t32Sh02532W u([87tQPh#XZ9~kPh#Y[]83u =32tH 8t32 32 32 32PSV 11ɉډe[^_]We[^_]UWVS } 9h#P ZY…Uh!Wu Ut.at"t=72l672뽺붡p,])Åt>um72t&h4#Sx ^_thߨ#Sg ZYCt/=72u&472ujRKuEVhĩ#h, Vh#h,j=$72u.$72h#Wu t@A3w$&z=$72u$72먃=$72u$72듃=$72u$72{=$72u$72c=$72z$72 G 728 72)72 72 =$72"$72@ 727272725l6Ha72X=$72$72=$72$72j=72l672hr$P. Y[>72/=$72F$72$72)p,E)tH:Eu5=72= 72t =72=72]= 72t =72=72txt4h4#WM YZ!hߨ#W8 YZu/ h4#W" YZ7hߨ#W YZ"hr$W _Z,@JK EÀ572jj5725 72572t572jj5725 72572Y;E572Sj 0Sh]#j72EF =72mE jEPj^ @u h #}EUuuh'#C[Jh`RPtCh:#t SCYyE  1SQ%1RPhJ#cG1=72t5Xhr$S_Zt#h#SZYtjujVha#j Vh#jmUWVS u] 1h#SV tRtfu2H;2ֿϡp,9td1ɉ`zlPV[ZjxPP|ZY%=`=@uxh*uxPh#[^Dž`ddPhV tt1&j53U6hX, t h!j5D03UWVSP}1ɉMM1h-#u W t3gt!utGu.l6El6;ul6E85p,9D6t3SGZt@E%UB6MM@uSh4#j?1}1ɉM}t E{6E1}t6h$EPYZt"8tu hF#jG@6DʋE 46aZ@u6h]#jh-$Y@ttEPW_Z@uhm#}tu虝Y@u hw#j謺tu}Z@uh#FtVRPM)vh]#juh"xXuQ$$jh~#SS许Sh]#jDUWVSu] P3133@3Ur$13h£3a1X!&?t2Gt&W =(3uRh(3YX RwPL <33333h$_1҉tu"h,h0a$sjEDuE3hb$SVj txmtW~փpt]rth,hca$rjft$Cuh3h3h]a$5l6뜡l6ls됡l6tT3t4fxPhb$Mf[^uUu;EE|Chb$联Y1t:S讧Zt@ <uNtSԉXu 1pjh=#h~#` DžpXÅtW5M65M6jjVP蟣3uh,hb$At5353^_53jh_hjhjhUj 5M6Qnhh 33eE1ɉMj@ljxj@Ɖ|tu1 jEkP͍1>XZtu(x-$r}u)xb$rxtr}tj5jUxY~jRtlXZlN t&PA$@uh=&hޢ$v SpS@YvKRh$iWR葉t#8t hM"S0P4X'@Rh$ S dhӃdhu,PPp,] 4 dh u-CvPjp,] 4蕯 dh 7Pjj_ @8th=&h{$8[XdhuGwY8h$A838 dhh%hh$wTZY@u!8th$h=&h$ hh$BT[_@u!8th$h=&h$V 0SkRYt&uSh=&hϣ$SPh$7h $1蝻d%@Z0F(Pjh0jn@u h<%y,\(7Sh"j\@uh=&h^$pY_B@uh=&h!$Yyt$u/JR|Ph,$ htA"#hhN$Hh(\,|Sh"j\@3h=&h^$XZh@SP_tPh=&hY$ .1cd%h u =u vduA%1Ƀu p,} RQ0P辪 @uh=&hm$dhǃ 8$u5"?$u5"F$u p,U QWPh%F0W@uh=&h$#1҉yh[P:OZY@u h$_XWhY(jD@uh=&h^$0_Xu*dhǁ@u dhQP0P1҅uHh=&h$\4PnZY$u64h$_X$P$9x uً4hƤ$‹t x t]@h% h$P0Pʹd% uh $ Y8t tjjM UBXZލP0WPW1d%@tW6Y8t" tjW.Ztڋdh@t) y tI߅uGÁt:Áu- h2$P0Pf +t'%@t0PhQjSV0P0[_~ tVhjjvՋd%@u h+$Xu u0Sd [hN$dh@_dhShjj@Sh j @P5$ZYy)h=&hO$`[_ 1ɉ$ 1Dž$d%0uS|Z@uh=&h_$Y_PS XZt;t HxtyzP P@XR1ɉ_VS _ZtP^辸賸SS&袸S9SP;@,tPx[hƒ@tRt \tBhp$h@Yu&j$RPG} @uh=&hT$XZNlhX,_h$tPRh=&hV$7h=&hg$(%Ѝe[^_]ÍL$qUWVSQ@Y1ɉPT31L31,0<48h$S@ ,H01$\&@6%@65l6fp31Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fp3F누0fp3%Y1҉Lj LP5l6cƉP. 8u!l68tL8u ;Ph$pj LP5l6K ~l6:t L:t5l6h$3z @6@n1th$j @6jhX,1ɉ |, ,,^_l6< @6j LP5l6J,l6 :t L9t Rh?$j^@=RhS$l64 @6 0LP5l6l6_Z8tL:t Pv)ݝ ݅ tjPh$!0%v5l6h$AٽFfF fD٭D߽ ٭F $|,,߭ h0%٭D۝ ٭F ,xy5l6hj$ uh$,^ @6St~h$j LP5l6H8 xl68tL85l6h$&,%@6 @6 @6 @6 l65P-tDFu h$1B卅(R$R RRRRR RRRRRRRRPhH#QzƃH1Ʌ~ )1@6hy#Y13@9u919~3Ph1("GXZj @6t1DžtDžxDž|Dž:h(5Vj5l6tPPhD$(55rJB5R @6@Yj LP5l6F, xl6:t L:t5l6h_$=hh{$@6% - @6k@6%@6% @6CLP5l6脿3XZL8u5l6h#8LP5l6>x3_XL8u5l6h$p,@)Ht;]B6j.S衕Y^u SZ)؉@?wPSP@Ƅ t@ P-t L-fBۍ1V@KjKPV@SVVdPW$TVh$jH Hd`hSVjg S%kX@6t=, h$Xt1DžtDžxDž|Dž:h(5VjShtPPh]#j蛓(5BtÉ3ru h)$ 5Jr rrj5 y h%<A6@t"55h5P補 t h$<1DžDžDž:PtPj ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:202603042102Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]GPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directoryopen: %s%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_RC2 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC2 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC2 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC2 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC2 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_RC2 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC2 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogxfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgcdn.NetBSD.orgftp dirpub/NetBSD/NetBSD-11.0_RC2ftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initnd_dhcp6_invalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingmulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist