08PT`j'&<  'T`j6$[P''`'2 2T`j'&P@@<@T 08PT`j'&<  'T`j6$[P''`'2 2T`j'&P@@<@TU T`j`'2y?AT`jT`jT`jQ$f T`jT`jT`jRAT`jT`jT`jXAT`jT`jT`jYAT`jT`jT`jZAT`jT`jT`j_AT`jT`jT`j%AT`jT`jT`j&AT`jT`jT`j(AT`jT`jT`j)AT`jT`jT`j*T`jT`jT`j/altroot/standAT`jT`jT`j,CT`jT`jT`j-AT`jT`jT`j.AT`jT`jT`jmJ<T`jT`jT`j`hpxXmT`jT`jT`j[\AT`jT`jT`j$T`jT`jT`j$>T`jT`jT`j$T`jT`jT`j$sT`jT`jT`j$ T`jT`jT`j $T`jT`jT`jAT`jT`jT`j'AT`jT`jT`j/AT`jT`jT`j0AT`jT`jT`jAT`jT`jT`j$QT`jT`jT`j8@HPX`hpx$T`jT`jT`j1 $T`jT`jT`j$T`jT`jT`j$T`jT`jT`j6$T`jT`jT`j7$T`jT`jT`j$T`jT`jT`jAT`jT`jT`jAT`jT`jT`jAT`jT`jT`jAT`jT`jT`jAT`jT`jT`jAT`jT`jT`jvrZwTpnZ]?'= Q(Yo 98:މ,}!@cp#&{G8`-I:r,"Fм$?~rZBX{+?flcu OE13azf{2 . ...profilealtroot bin dev etckern libexec mnt mnt2 sbin  stand targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi  ... . .. catchgrpchiochmod cp dd df ed ln lsmkdir mt mv pax pwdrcmd rm shsttysync . ..MAKEDEV and round # up to a multiple of 32 (needed for mfs, not needed for tmpfs). ninode=$(( (ninode + 2 + 31) / 32 * 32 )) # Try tmpfs; if that fails try mfs. # # For tmpfs, allocate 16KB and 512 byte per node. # Actual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"}  . .. cgdgroup master.passwd netconfig protocols rcservicesELF4D4 (@@//@rr%%`t ,,%%NetBSDAPaXUSR&ffffUVSa/_!Ƭ%9s 9r[^]UWVS5/Ú_!]P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*tE9ǍvuUWVS-]!E@@9s{*;9r[^_]UWVSD-é]!E u &M 1ME @E %t/tu*nj%9s 9rEt E$,$Ǭ%9s 9r$ED$E D$E @$$%MD$ D$ D$$1ɉL$T$[$SWD\!5u1ƃ5tЃtD$l_[SW[!4uYƃ4t|$D<$kt?t<$ktЃ_[UWVShhhp& `1t:PYxOvhp&j XZ3h=hp& hp&j jUUEU MsMU HE]$UVS1ۋtVPgZYu C܍e[^]USlPhhp&!hp&hu@ CtsPhhp&jUWVSE tuhURhc@5& t5&h7jЯu.M.E.WVSQRP5&hG}E t.RPhnX u5&h|B1e[^_]U5&螕XUjhc 5& t5&hj1USRj EPSj xU:t Shj袮]UPEU Ph JtPhGEEEPhc5&; t5&hje1UWVSSuE H1ۃv>PW ZYtCuދEhDWZY1tFEEPhc5& t5&hjӭ1e[^_]US u Sh j肭]UVS1tSPZZYtFSh#jLķe[^]UWVS ]u} Sh } ~Sh1}{EFE} t!vM9Mt66EE1EEEK>tt,uhE1}}}}}E뺉t9Wuhj<U9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E45&h "}t}uuu1ۉ]EuM9~VQuhj6k]lS' EYu h4j1}E1҉Uuĉu܋UUMM]]}}Ph c5& u EX@1}Wu@ 5&hRjէEuPE4hbCE rhj&^ElU9U| &h &hXZCtCPh_Xj ^CtCPCPh CtC"PSh Cts؋C4h C$PhZYu XE\1e[^_]UEě&]UE&]UhVjUhlj UhjUhjUE E EE]Uhjjjuh蒯ؚ&ܚ&Uhjjjuhg&&Uhjjjuh<̛&Л&Uhjjjuh&&Ujjjjuh&&Ujjjjuh$x&|&&&&u(Ujjjjuh腮x&|&&u(Ujjjjuh S&&Ujjjjuh*0%u jUWVSux&1|&&1&>W†XuWh'j=S8Y_u ShTjͣxxuShg]hjjhEPcuu뺋&#H t uh P&WPZ_&t/#=t &&tt hX&ƒtuh<t?%t4!t$t & &hjҢ٢&e[^_]UVSК&uX&d&&&h&l&;x&|&rgjd&&h&l&&&X=5&u𡴛&E &)EU}t 13A}uke[^]Ë&& t h&l&UhhjUUhhjġUUSË@4URs(PZYts$hj蹡S4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u8uK ]USQ9s S ZSPEP ƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y hEjC4WPs(Xe[^_]UWVS]uVh&jTC4uu s(P(8jVj2$8؍e[^_]UWVS`&}t h&l& x&|&EUEUEU}uH& t?11ҋ}9׋u} ytEU&&E&& t(jRP5&&P Bu@u 5&hNIuSh`&Ɖ 19|4 u5&hr%8t5&hj{11&E & tKE8& <&5|&5x&QPz0&4&&&1ɉ & &58&=<&9}u;9uu6E9|&u E9x&t&&|&&l&&9}u9utT&t%=؛&u؛&5&h+XZ&t5&hj@)u}h&l&+EUEUh&l&=x& |&9}Er }ME EtURd&)P5`&+ h&`&d& ؚ&ܚ& t8&&&&SQRP@x ujhhbj e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQܚ& ؚ&t/jhj ܚ& ؚ&tjhjՀ jEPgji]eƉߋE׉ptiD&%@&ƉߡH&׋pt)ptZYt puDžp1t5&5&5&5&5 &5&5&5&h6jd]SJ,S3$Sj(&,& t7ƃ/ tQRPhbjdSS$Sj$ &$& t7ƃ/ tQRPh{jdSS$SjH$0&4& t7ƃ/ tQRPhjdSoS[$Sj$ 8&<&iቍhltpRPvƉ׍xPjhtpvWVxPhlSQhjd]S$S$Sj_~ eY[^_]a&UuΔ jTUWVS&&5̛& Л&&u3jRP5ț&ԛ&P B@;1S0%v[H0%S5&5ț&ԛ&P$ t&u:5ě&hjA&uNu<)u&hjt5ě&hQ!XZe[^_]UWVS&& &u?j x&|&%x&RP5&&P B@4tAfEEEPhm5&&P tS5&hjI11;5&&5x&5`&5&&P$ ~fEEEPhm5&&P @t;5&&s>5x&5`&h`& ;|&C;x&7벍e[^_]USˉ< &҃Pj hSQR]S1h&@&tP5@&o 1҉@&YX1X&`&d&1Uh&t*P2@&ZtP5@&# 1@&ZYu0Ujh&h&]2 yjD&D&H&D&1@&@=uUSUE l&@&l&M@&Ћ] Ӊ)~@&@[]Ã06w $@1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1&2&&@ujjh&h&O thh=Y^&&&&`&)&󤢋&1&2&&@ujjh&h&O thhg=XZSjjh&芑e[^_]UWVSƉӀ:0B؍}01҉U"]BuʀEt@9uSE Ythh|9XZe[^_]US&&9&&RPU ZYu[0J Ph9hp&h_ 9&H&ua&tjtJj]&& &u &ųu١&P&&M 1]UWVSSU&=&CE;U tM&119~149u1ɉs19~H &9E~@1Aˉt&X[^_]UVS5&&&19| t!&H<u &1[^]UWVSfEp E}u.h5П&_Z]tjEP_ Y^uD1GhRZ^_FP&Zy }Ou PP x. E uh:؟&| zf%̐&Ѓu-hRZYuu h6X넋&jEP [_bE &&9&=}\SR ZYu[0 Ph9hp&+h_I6&H&&tjj&& &u &uΨuً&EHП&П&8lx #xtދ&PRRe yɍe[^_]U&1&&&&5& 1҉&&H&Yu&tjtjUWVSPП& t u h5X 6ƅu П&8u@П&S5t&Ë=t&X9=p&|^SYt=ğ&tj jsPEcUjjjRV?K ;EtGSZyh1e[^_]Ë &Q &y ;0&| t&J &Uh&PʸXZUWVS u1ۉ߃=̟&tVI NyV躭XHF `=& ĝ&9^&؁}U|WQ ZYU=&ĝ& &u&tjtjĝ&u ğ&C1 mCE &9&؁}ULQM5ĝ&$ ZYMUuXa0 Ph9hp&赴h_2&H&t &/t1 &ĝ& &u& u ĝ& KF @t.0} Ph9hp&h=2ttĝ& &}ĝ&8=ğ&t=&te[^_]UWVSu VE=&ğ&E血&E1ۉ&ğ&X=̟&t5&11҉UuiEZUU&5ĝ&YUt(EEtBD&PPjAƒ u- &t C&tjtj &u &uݨuEVu9uuHtg}tIuğ&=&tEu~hp&h'N=ğ&Y^=&u3B=&uğ&dğ&=&tJE ğ&uhp&h9<XZğ&t!=&t9uuu$&Cu &19uu=&=&M ğ&=̟&t1ҍe[^_]UWVS];!uhށCP'XZS hށPǃ u$0 PSh9hp&bhKJu WYXyh;!u7W*Zy40u PSh9hp&hb4/W蕧ǃ=&uVhhp& &+E e[^_]UWVSu] }9tU=̟&t VP*VPZYy0,0 Ph9hp&耰hz.C1e[^_]UWVSQu VJ[=̟&tW1ۅtW;uRWNZuZW95&u=ğ&t =&u BRUPu xËUF?륃=̟&tuX؍e[^_]UWVSPu]>!uhFFP%Y_V u Pƒ u$0 PVh9hp&dhRuSRUǃ Uyl>!u7R'Zy4轿0o PVh9hp&h.-R菥ǃ=&uWhhp& tE)؍X؍e[^_]UWVSW11 Đ&yh&莦^u&P&s=ԟ& ؟&9&؁}U|WQ ZYUu[پ0 Ph9hp&-h_K,&H&&tj j =ԟ&؟& &u &uΨu١؟&uğ&1ۉ߉ u|&؟&0؟&П&u̐&@t?0 Phhp&hh+f%̐&1П&-f̐&9t{t ؟&؟&П&މe[^_]UWVSWП&C{ u)ÃEП&:TRPx Y^tE̝&ȝ&9&ށ}VR _ZuZ"0 Ph9hp&vh_*&H&t1&tj tj 5̝&ȝ& &u &uҨu١ȝ&5П&ljD s} us*Ext؟&M| th)YoE̝&ȝ&9~P&߁}WR YZ=̝&ȝ& &u&"%ȝ&25؟&NjM}t/s2PR_Ztȝ&D } +s#̝& ȝ&9|R&؁}tVQ0 ZYM5̝&ȝ& &u&uxȝ&Me[^_]UWVSQ]utuh§XZ} 9EueF95@%}h&h45^XP^w<\u7\t.ˆUPh{ZYUtF-/B000CL r1e[^_]UEH!&EPhht@j艟 x$EfvD%Efv@%U=l&uEt&E p&t&p&9~ 1;&~h='XUWVSSu &}t69&+=&=&=&t1C~ Ku"=&tn&u=&t[uSPEZYtI=ğ&Mtj jqP;jjjWu= t9&HhY&X؍e[^_]UWVSP]U u h.&XU19&~BPSYX%KM&uSwP(x?]9tWZu̸1e[^_]UE &DBuh%XP<|&u&E&1UE&DBt|&EhR%XUWVS&&П&EDJ@t t E@П&޹П&0U?& } $@}^@П& &П&8f|y@t t@П&܃tQ18j hП&5П&v'Ǎ vԶ8"uhUA^t-u18UBQ@u^t -uօuh$^r1ۉj hП&5П&&Í vG8"unt@П&&.j&_t|%1Ƀ/QP_ZYtП&M:+@П& FPП&@PX.t(@П&l&;u & p&&9Et9&}؍e[^_]US1l&&p&t&p&xLl&t&p&П& ;tK,tF l&ʃ~l&p&IuAt&H l&˃~l&Iu J П&:;v&l9tt&t1[]UVS&11Å t]9&u 1ۉ&J@։t&[^]UVSuj Zu+60 Ph9hp&芣h_!FV CS FC؍e[^]UME 19tx\uHPQZY1҅‰UWVS=&ujEH!&&PjhFh/ykh}^tZP货[=wJ@ P Yt:WPöXZ|3/t 3/D3hSY5&jhFSjUM=&tI &QU=&ujEH!&jh&"UWVSE&1ۃ=&u-9t =؟&| t8f%̐&=П&?u1П&BП&: u)u ?.u tԍ4&WZu# &uo&tj=t[j&t PTCXPPj0à t9u& &&u른e[^_]UWVSSup&Z;&|1ۡt&x&@&9t9u SEWáp&ZYUSWjq/ u &t$195&~FPVjB/ u)ϋ&tj&jS_=&uZh[M&@t&PjZYp&jPP 1yhe[^_]UE Puh'h`&s}USE8^u@8]u@]tH tA[uPJҀwouH]t ˀ u 9t]@1[]UWVSQu=П&< tE9t>S<[t<\t.RiZÅu!h! { uh^-[1C뵉) &=&9&Ё}UtVW ZYUu[D0 Ph9hp&蘀h_&H&t&tj2\j 5&& &u &uΨu١&5П&ljП&=ğ&tj jRPe[^_]USП&< u h XH< u=&u$huXJ П&R t8u ӡ&PKXu1&t=h&u PB|X9j臬 &Yu(0証 Ph9hp&Jh_hK1҉h&5&S5& ƒ &t+h'h`&PR+a5&蚴 1&R]UWVSП&PП&M&1ۀx%u}M8HuuП&h[s9}nП&PП&& П&\PП&&2< &=&} П&U8u&ف}|WuD ZY=&& &O&tj7jm8uCHП&B=&du f%̐&1؟&| u6/& &9&؁}tVQ聯 ZYuVč0v Ph9hp&}h_6&H&j&U5&& &u&&&&e[^_]UVSVu] 1П& u 1ۉ&U П&< Uu 1w8uA П&П&JπwE迌1ɉj hП&5П&6 v蕌8"uhU1Zgu@П&늸e[^]UWVS 5&]&=&}+&;&a&M 9}y;M)9 ڋEE&}RUu莭 ZYUu]΋0耸 Ph9hp&"{h_@&H&t '&tjtj&& &U&uΨDϋ &M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW&}RUuU ZYU&& &u&t &M9u}EMELE B19uu)d9|T&ځ}tVuë ZY45&& &u&_b&Cw}9|T&ځ}tVuW ZY5&& &u&&؍e[^_]UWVS] Sװ^|=ğ&tj jsPlCjPju6 1ɉ E&}t9U3 9&ށ}V5& _Zu[Y0 Ph9hp&wh_&H&b&tjGJj5&& &u &uΨuك=ğ&tjj   &NjEpSP-  9~U&΁}V5& ZY5&& &u&=ğ&tjj S6 &Nj󤋅  ?u9Ћ)ȉË ؍x&9<t t tjPjuy o&=}tV5&ǧ Y_5&& &u&~+ uEthTZDžW=ğ&tjj S &Nj󤋅 &f u1e[^_]UWVS&t&H&1ۉ]1p&+t&9U졄&@&Pmuu PuƃU&PP[Z&3E&1SwYu' &&tjtsj&t PۭFZPPjƃ t9]u &u &uuE&G&E  EuhXE tu RRK x1e[^_]UWVS&E䡀&E=P%t =L%uhNYm=&t &j&&E=&ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń=&t聺P%&EP%L%&EL% &u&tjt j`1e[^_]UWVS&&Ht7k X< u'ʣ&B0Z9tSe;S ZY1&&P%&L%e[^_]US&9&}Pk& &EuCk& &u C&P&k &ZY]d&j Ph&om tP Ph9hp&ph_5&( 1&&1]UPhhp&Zpjg &Q &y ;0&| t&J &Uh&PrXZUWVSօt%ˀ9u RPhRPh'm uqRPhm `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5& UxhPhhp&(ojeUWVSf@8tXu1P1҉hW3tà g8#)tSWVK 룍e[^_]UWVS} 5&6fDž<^~1҉hPjà t[~8~8u ~1ۉhX9Vf8uFt"SVW yFv~8#u5l~1ɉjjPw @uM~8thj2h)+jWCjFdfDž=&t fDž9DžjRj  fDž9fDž9&jSV @u}8tJfu ft>(@ufDž=&u#K,&@tftfDžftR@u KfDžCe[^_]UWVSQ}u VW肀[ZÅuzjjo XZu hbjd1;s jEPW.ƃ ?tE8thhj1y|8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMu ZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPY_}ËBt1Uj_L$qUWSQ&-&wȡ&ڞw ]]5ԡ&5С&hj誦 5ܡ&5ء&h-j蒦 5&5&hEjw 5&5&h]j_ 5ġ&5&hujD 5̡&5ȡ&hj, E$hj EPP$hj =&t>u&1 uj^eY[_]aÃ=&tUE PujE UWVS}u _Phj耥 3%  &B9tT &e[^_]UWVS$ ]5&t(V'l$V0Y^ugh j0Pu L yWkp4$ 0ZtWVP u WhQ5Hjj0։( y0h6"jju ։ƃ C Wh VPƒ jjWT‰ VXh 8 _Xuh^j [^jh h R(\y Rt Y߉R] Zt-w1ҁbt#bt!tu h1 Њ Јt u hjYu V:7ƅ/ t jZV8 jZVP 7 djjP7& $&0tS SQPR(&,7kP近 Ɖ4W讑 8t t10hj` \9s1BFu hj0 1e[^_]UWVS\]ƍ}ZE5X(,a&V&0u 4j 8_ EPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xPE1RPuut5%9ΉЋt}"Q_85%VPh/e[^_]UWVSP] AEH1RPuuƉMt1׋C|1׋ujQ1RP<t2uPhjP E01RPuu ‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =&EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$hqO5&`Ãt#EUSjPVY2Ht h#V XSzVX&&E1С&ԡ&E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu#9E E~1҉ t1EUWVRP9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh?3REЃP2‹EЋ^_9t"ERQuuPh~j E؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,Pu賎 Y^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuuPuuhj{ t E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,PuNj E_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPhjh E]E]E Eu&&EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWVPuuShj觔 E}8LEiEe[^_]UWVS uEPF VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h6j N1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRPFVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hWj,RWX(}EEPhEPƒyEqRPhVj葒 xhWj,3W(}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPhq1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em}&&ȡ&ȡ&EЋUء&ܡ&ẺEMEPhPǃ yNQWPh0FPhPǃ yNQWPhj褐 1eY[^_]aÍL$qUWVSQ9q$&&,(&,&?1&&1&&1h9VWB. ta#DtNJC91&뷃b$0&&C&C4&u591[&e591/(&R5916$&@&/591& &591&X91&hp&hYX&)lj80!hp&hXZ=&xhR!=&x 8u5&t hjtjj)hl hO+jj![_@u hjj hl hEjU00h'@P]@ uh9t|j/S!ZYÅu@S &׉hOjZUhOjNUj$8 &P| &1urhKj覍 jiF&؉8hDjɀ 803PyP3hjjQ W5&OG9= &=&tf95 &~W&4FX烽(ta1(,,9 & &_=&tjE&xrP&0j&dh1҉ldPh &Pà t$_8:hj11ۃ= &*6, &,4@lXRjPjjT($tPhXP :8zJt&Z JZ04z($J 04zh P&1С&ԡ&8Y_9t4VZyPhjPhj 3‰.Ju lxtH'‰`R840Ph tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRP1ډ߭ dܝ0v7ء& 40& <0[10=4&pݝt{\P'SK- ݅y+؉Phj؈ jPh) \`+EU5&9Ɖ 9jSZY@݅u؉NPh(&ܝp ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhjP8j8P PuPhHY[# 1҉D<50&$&8Hȉ9r09rÉ014#840Phak840Phaj 04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPhPDPh8&SW(~LFD\`HP\Ph8&W\DHY, X049Ѹ4}u014"80Php1ۉ898r;D\`j\Ph8&W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPh DPh8&SW|$~FL,NY8&D8t8&011҉VPh$K=98~k,0D$Aۉ7<1߭߭&&ȡ&ȡ&ء&ܡ&1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP 1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ= &t 1P8&k,8 $98p 9~Љt$DPShTpPhPÃ/R"RJQSPhiji #tV":t&Phj4 ,+ePhj , E$) 048<11ۅt9 ks F(tȃ0tBE;Pdr,9u:s (tvRPYY09us,9uihe (_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV^_Ɖ׋E t1 $DH 9|(l [ (E9s@(ERPWV0,h=(^l  袋9.}*WV0,hlj{t (l fk,Vc 4Z1ɉF0s PHD0,hjt (k X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Ph4<@E0]\)Hu E1ҋ] 1ҋ] t1RPWVkDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =&h!jm Y^wM t1WVSPE(\=DH9}bk,4_$S]\ G(Zj?0|l P4t0$hGj m MH=&tRP0,hjjl EHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh EP bRP@8tGpBu_ E`&%Xe[^_]ÍL$qUQ X&T&5P&5%hEM MuQQ$RPh#&MɍaUS]CtS P S tSPSCr s ^ ZS^ \&X]USEPsH) H&L& @&Hu0d&Z[9u |&u' |&uhgjP4BPQ X4CXZ@]UWVSu EEE#%`&P& \&M11ɅtJA9~ʳ9M}#tP&h{hhh.}9x4u }9x(u9p$t버tP&e[^_]UWVS]uuu SO trNj@thhh1GGWX9w(~6Gthhhh.wVw K4 G [^WY@&%;\&X=t&u =l&uBGWux&GWtPp&WGtG4WPZWX\&j@j_3 VjU3 G _4E UG$W(G,W0wE #%G8`&tz8GC GtWP { _ Ge[^_]USEM Puhhh4h,P ʉPHPPP s E]XPs2H H&L&@&1ɉH h&Hh&.1ۉXt x&Hx& p&Hp&P4JH8`&9t!tXYX tAP]UWVSUu }uWVRcËECUtX&RT&EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=%Y,A0Éa,ڋyY I4 s RPWSQ\ RPWSQ`e[^_]US]C%CSjS]1]UE UMQ1]Uj/ UU P&PYtHJ &@ &UWVS] &C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdX CX ${sX ]e[^_]X UWVSuE EEEE%&1҅9su}K}9y,u^}9y(uVK0ts4q4s4 &K0ts0q4&&C4&=&~ttpRZg{$u{uCuڋ[0n=&~ tRkX&&t$;3uEE EEuCe[^_][؉؍e[^_]UW1&&&11҉&_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE%K,ϋS0c,ʋ{s K4 es RPWVQ\9Cu CC17RPWVQ`uh6Y YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPY_}UVSӋEU tt RPY^CSt RPζY^CS e[^]USËt-w1Ɂbt#bt!thbRh91 Ȋ ЈS^Z19tPQh2 Ћ]Uuu jGUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus ~* C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPY[L(ștșe[_]UWSvhth8h h#ÉЊӃttRP虴Y[LXștșe[_]UWVSvhthh"h,#ƉӉȊʃt$uҁTXe[^_]UWVS vhh hh"ƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPޮYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jM# ËEEC1CC_Cj`C h1C C$hj# Ehj# M쉁j`j" MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmEK EpdK uK SK EE싀}@u jR^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u&EE %&S0tK0J4&&C4&C(tS(P,&C,&މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hhhqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhhhh@]9~ ]B뫋EEP+ E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh}t/EEtP1uuRPh辧]9]tSuuuh7蟧uu] SY[9t$PRuuhosuD 1҉U uD XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhwtC M苉9t.CM苉p9t$1SQ1RPWVh蠤C(S,C S$]9UrSPWVh rWVh)^ ~}t5EtC(S,C S$9Uu9EtPuhP EUjuuWVSuEE؃uju [X }t$EtC(C PWVhq辣}hh,hhEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP腫EuuWVr9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV!9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPh臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}th#h&Y^tCpStCHuRPuuEU}t hLZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhF&6EtM}`d)RPh  tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j E1҉PEMA\Ac\A \1ۉY Y$XZ}t.hj ËE쉃P^_ u =%ƉE} t hCBK[1ɉM%EPjh WVu*hj ËEp }쉻PP P jPXZtS Su%}URjh  t1RPuhjp EEp }}M쉏PP P jPW^_utCHSLC419|} tMhy JY@Et} t#hIZu uuS9u u; X S; X]=t S: XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWj Ɖ_tCtPv ^tCtPP FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h|SXZ؍e[^_]UE Puj% UWVS]FHljL1RPuu pEUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h@ u~ 1RPuu 辢tDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhXZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhXZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhB_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu肗Ɖ׀}Mt1׋C|1׋URju1RPQtPuhd Ep 1RPuut֋F Ft:_vkk փ~t*uuh@ tFVC(S,FC vkBHMQjPjjRt PhXZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhZYEP tu}rz}zP4PR:X17&t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]USPPhlhp&hp&h|~%CtsPhzhp&jLUSSE] t$uhsZY¸tr1EEPhvd5Ķ&E @u35&h#jn]UWVSPu }t}~^hcS Y_DžtFhށS_Zt)hFSZYthS[_t뫿}}uh'vZYuUEPhud5Ķ&t @u65&h#j蝷e[^_]US}tQ,Shzd@5Ķ&& @u5&hjQRP+=vu8&UWVSQ5&Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ &1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉M0&4&ÉEE1RPWVE)Ɖ1UQhv-XZ}Ut4&H9u0&H9u u9rBRWhJl e[^_]U塨%=&tvPhSE5D&5@&5L&5H&5P&h\ 5,&5(&50&54&58&h5&h Phh&H&L&5%5D&5@&QRP5P&h,hO&4&0&5,&5(&QRP58&hcT 5 &5$&h; UWVSQƉ{1ۉjEPVb >u#ËE8uO8"u w܉1e[^_]USЊPq$PhPhPhPShhp&`,jUWVSEM %9uh5% hj9ًEEUMjؙ]!É]]!Ӊ]uuWBuAtV%%=PuRE 3P5&R3 9%uNE!5&}e[^_]UWVSEUϋE Et EU@uSh^XZff=Ut+=&t fuuShff=u%Cth fLJ_f=Ut1=&u Sh0Y^&tShhcXZj(VPڌ x0XŃ~X r&t\fLJᵃVe[^_]UWVS9&u&5& 1Xƃ"&e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEEEtE11}=%E4&0&U1҉U܉E1ɉMԹEM]̋ERPSQ臃PE؋UEUuuRPjRPuuȋE؋UEUuuRPFRPE؋UEUuuRP(RPuh,"uuuuuuuh h&jdh& u hjthlh&Y[&U슀&< <$u z Ћ &DQu<-7j EPh&]Ɖ׋EEhسPEЃEPhuL tuhu5 t L =%Ήʋ5$&11WVSQρƉuhuР ui $&ω%$&Ɖω uEt5 &1Et &1Et &1)Et &1)׋E؋]؉E]hlS YZÉ]; t,h&Zƀ&uh&h 9uE|E9Ɖ]}.uuuuWVhuȋ}u}e[^_]g_USE Pu豹h9]Đ&HĐ& yh&Y&P&؃ t9@t* Đ&y h&Z&P&8 u hjǟ1Y]UWVSEM䡘%E@u h?j葟%EӍEƉωؙ!M!EjuuuPBu @u%%uhuP莃 nR5&P| 9%uVjuu5%Bu@t&K!Nju5%R5%+ 9%ue[^_]UWVSRá&u ƀA Mz΍& S}8PR蠆 & e[^_]UWVSEыEU u1+ˀ &1ۉƉ)߉u}};=&}=&WEUEUE9&&}=&t Ev&KiE9t 5&tމ&ʅu+ &9UE}M1E܋E9E܋U}t0}t}utsƆj|ȃ[^_]UWVS EӋEEh&@Ph&ME 5&t hjȜEU9E|E9u|础&] }) VRP跄5&31fǂU }u@ &5&֋M)}CsKSCPKSs FSj&Ee[^_]UWVSE}u&"&ƒ<1IE E#֋EU EUEUE9@&D&M`&19Et\tSMM1ۉ]]9ً]M}3M9MM }=&]@uEr&˃t & &t!=&>&1hj` &[^u hjRfǀUE裘&EU &&EU&&&ytbt]t E^&QHu&<=&/h>Ygv&=&&;&KxZ 5&t1;EM |9UE}=&t`룅&E 9&u;]t~&H&1+]9~ Fu%uF PPR & * &1RPEU &+E&XZEU &&EU&& ^4Ѝe[^_]UWVSË@S t+5@&=D&9u9t hY]sǹ󥉍1󫍍@u'C CuRh9PXZߋe[^_]Ã=&u x t"1UWVS|ÉסT&tP Yj/Sd^ZuS5%h*hT& SyT&YT&u hjjPz|XZy5T&hxO[^xPS辳ZY@tMuи 9E} 5T&h0T 5T&hG?h h &S{ 9t5T&hOf=&Ut5T&h^Y^S|XS|Z tje[^_]UWVSÃ= &u1Ҹz &f=&u1f=ܼ&I؁= &t#&`& &ܼ&f&f^&Ut&1^&u[^_]UWVS á&fE4&0&8&`&11t#f}u&&t9r $uɡ&E &19E~+f:uzti 9t@Ћ &t=&uaf}u&! 9*=&tu7hY= &t f=ܼ&u/hhA=XZ= &tT&!9T&=&tPh_XPhZYt 1= & = &uLzt|1j &tr&!9tSP5T&hB?=&t1~f=&u3 &5T&hZYu& pte[^_]UWVS(ÉEU EUE؉uF=&Ee[^_]11ɉD11ɉt<u ȉhjhhPtPQRh fu1k t PhhWVhh =%RPSQ|qPh;Y[=&u" &9u1ۉ)11ɉj-j)XZttC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾`&19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu h E Et}u9}E}}u &$&1RPuucu 9tۃ}u E9uuujjR|EUEPuhh 舼h&jdh&u hj@h&[vEHƀ&t'& t9EEHPh&h%( uh&EPА uċ}ȋEEă}t6juuWVUċE&uD<=&1EjuuWVUċEu=&tKt$|=&us=&t Phj[P]juuWVUċEt)/juuWVUċEu}t }tPhj}uf} E U u }EfukE } 1E}t Dm:}ta}tE &1 &&9u19tuugZY &UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P荎& =&u=&<t &(hIYtfu'uEPkE }P$ =&9=&t hmZu&}ft=&hI[E̊@EċE̊XEčE@‰8&p1WVjjjE1ɡ4&p1WVjjjÃ(Uă?1ɋ50&1WVjjj^}̊MO_U? ˆWGEĊ_EčG‰8&p1WVjjjE(1ɡ4&p1WVjjjËUă?1ɋ50&1WVjjj}̊MO_U? ˆW(} &uKye[^_]UVSá&u hXX1ۃ=&u Sh|.Y^jjڸ`&CXZu҃=&u=&th  X1L=&thDu Sh^ԶY^g &RP1҉8XZ=&tC&9&A=&~hd腶5&j5&5&RP 믅<f=&th?^hk[&t=h&Y=uhy"k PhٵXZ h ˵XhhbX=&nPh袵Y[=&&PPh肵 j=&t>u SheXZ9&} h dX; &RP1҉u Sh'Y^jjڸ`&XZe[^]UWVS ˋDž t Dž @uh&M5ZYߍ1jh?S6 t 1/9Cu苅9Cus Pju ;Cuă=&t.{ t(s$s shHe[^_]UVSPE%;%u*=&u!URhmdP般 y hR@]4X`&11@uhB=&u111H &~ ف &@uh3^E&01C;&}. &&&@@uSh3Y[1҉U%;%u*=&u!URhmdP襫 y hR@z3Xe[^]ËU^Phzhp&mj$UWVS|E|x&wShhp&0jS: EZuh(|ƉjRPu 9u9thP j螫Suuh_ 9t"|thh Xji1EEfU}EEEEPЃ<]1E ÉEE|ƉuR~EEE_}t V PSE4h -*&fEEE&&19E~WtL9u.;u&}JPaR@&4h=tuu u@뤃1\3 9sR@E9E~WtM9rϋU9sэPaR@&4hkP }9sf}wfE@f*&}E4h Y[n}tGaPE4h } t}t}u$EEfEEEfEE4&uEE]9E@ƒt<u+ExمuuEEZEEu9uu XEe[^_] &yUh&j 蕴XZá&P& UEU 19s f3P]UERPZYUSBHBy;B| X RQXZ]UWVSQ]u uhS5F fw4hPhS FPjhSFPjhS Sh;XZFXt Sh;Y_FXt Shr;XZFXt Sh_;Y_Sj v(hS芰v,hS| v0hSkv8hS]v4hSO$vFHPh8S.FJPhAS$FLPhQS FNPh`SvPhrS$vThSܯSh:|\us11t\UhS觯UB 9~ShN:XZ]e[^_]XUWVSu} EU MahG8lG,p1pd1ld1pPQhj@tPЪC1w,pC1w8p1w,PQhj@UR虪0URtPhhsQhhVwC S6EXZEE FEe[^_]UVSSPPVu ujVSh~,@uLֻt"t"0r Z3tIPShxjpj象UVS]u VSYZu Shjp;/t"Sh訾XZu E e[^]鑾e[^]USPh hp&航j?UVSPhށPת[^t,PjPuV޾V t jPYUZYSѠXe[^]UWVS EEu EE}]EEE1҉4&a1ɉ 8&@&hYVu NtJb$ 1=@&@&D&<&8&뗡914&jWh591{ u hjnP' YYH&J&4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjPAUXZt1h9}PaZY uċ2jWSh~@uL譸t"t"藸0I ^3tIPShxjlt%@u=8&p&8&_8&MDžc=@&tDžy4&t \dP=H&t p=D&t |=<&t 1ۉXPjjhchj2lShhVu hbjlj/G PxZYt|. ShhVtj/C PwZYt| XjUVS]u VSYZu Shj]k;/t"ShXZu E e[^]ٹe[^]UOPhhp&Хj@臜UWVS]u1 11҉t11ɉphu u蜁 athg$591`CpX591!CtXDžp591XCxXDžt뀃K|wK|njVh 591 u hj%jP败 X<&P;UtU tu4uVEptFuxPVW#Y_@t#ECpJtuUxPV4#_Z@u8VhjGixPV#ZY@tuECpECttu E%Cxe[^_]UWVS SVpPtWu uhWpShjz,@uSVhjGhr@t@1RPhhSj Sh 謠(j USP]jEPSp$U :9uySu h.jAh]US]S$ Zt@ heSZY]US]S Zt@ hSsZY]USP]jEPS#U 9t :uy Sh@jg]UVS]u VSGYZu Shjg;/t"ShJXZu E e[^]3e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RP8Y^CSt RP8Y^CS e[^]UWVSӋEU ΃tt RPN8Y^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]tËUWVSEUˋuE FUU tJ$1EE ~uJ1EE ~<$ffCRVڋE E CRVڋE uEE }t>}tWWV 7Y^Ɖuu6YYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5`&=d&}t M U JpD1HӉ5`&=d&}tCS}t#RP6YYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuhthlh"h}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWVK=1҃t0119s#hV3+ZRP<PH0jjjjXSËPF߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PChV͢ZYthVhj( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydh'^_PDžDžt9t h&Y9~Wth&XZ.DžDž9|ċ9|<t h(&Xh5&h:ΪDžy(hx%^_uqh蓪YI;rhx%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t PhG$Y^Ht2{{ @D0{{@D#Zt⋅9t Ph#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Wh "XZHd 1t1\{ChX\Clg{ OtIh-hp&轒D8ljPh^hp&葒t@t)1L@t31#LC LClC XkT,PxurxtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtp/ct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Whohp&Ռ 9Huhp&hrXZdѽPh dt$h[hp&]OPh肉7 v$tpPhQ^_j iY@uhGh=XZ+1߭ڍP lWW$h3HuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|PYBu@u0 Ph4p tu `duCPODž1v 1񉅰 t1 t19u9t hU_ tG ?9|$ tj jhq$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@h Yu jjJ@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WV^_Ɖ׉ t19s=Pd/D ]j ƉX P YPů FZ@HRjPjjt PhN>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ DžDž1p_<҃D 9sh5&h# Ft Pt#u?RP)Y^f*uGɉf1VfN@ tBhhPhqfFu=@ A)G G p 6p<uGG9rhh@hh)9rhh@hՉϋ)1󪊓t@@tf)thh`hh LP4PRAH‰ljX1OtVjR1RPQytPjh66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=&u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPhs3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV,@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t Ph/^_A |tVC@SDs8{8tGpBu E&%Xe[^_]ÍL$qUQ &&5&5%hEM MuQQ$RPh#gMɍaUS]CtS P S tSPSCr s 7 ZS0 &X]USEPsH) && &Hu0&Z[9u &u' &uhgj?.P4BPQ X4CXZ@]UWVSu EEE#%&& &M11ɅtJA9~ʳ9M}#t&h{hhhn}9x4u }9x(u9p$t버t&e[^_]UWVS]uuu SO trNj@thhh1GGWX9w(~6GthhhhYnwVw t G [^WY&%;&X= &u =&uBGWu&GWtP&WGtG4WPZWX&j@js Vjs G _4E UG$W(G,W0wE #%G8&tz8GC GtWP { _ Ge[^_]USEM Puhhh4hmP ʉPHPPP s E]XPs2H &&&1ɉH &H&.1ۉXt &H& &H&P4JH8&9t!tXYX tAP]UWVSUu }uWVRcËECUt&R&EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=%Y,A0Éa,ڋyY I4 s RPWSQ RPWSQe[^_]US]C%CSjS]1]UE UMQ1]Ujp UU P,&PYtHJ ,&@ ,&UWVS] (&C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd C ${sܘ ]e[^_]ʘ UWVSuE EEEE%@&1҅9su}K}9y,u^}9y(uVK0ts4q4s4 @&K0ts0q4@&@&C4$&=(&~ttpRZg{$u{uCuڋ[0n=(&~ tRkX &,&t$;3uEE EEuCe[^_][؉؍e[^_]UW1(&@&@&11҉,&_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE%K,ϋS0c,ʋ{s K4 es RPWVQ9Cu CC17RPWVQuh6 YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPZY_}UVSӋEU tt RP)Y^CSt RPY^CS e[^]USËt-w1Ɂbt#bt!thbRh91 Ȋ ЈSZ19tPQh23\ Ћ]Uuu `=jUUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus j C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPHY[L(ștșe[_]UWSvhth,h hcÉЊӃttRPY[LXștșe[_]UWVSvhthh"hrcƉӉȊʃt$uҁTXe[^_]UWVS vhhhhbƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRP$YYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jc ËEEC1CCC$ C {(1C C$hjXc EhjIc M쉁j`j7c MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE Epd֋ u΋ Sȋ EE싀}@u jR^_}E UG(W,}x0xdEtFVtRPGYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u(&EE %@&S0tK0J4@&@&C4@&C(tS(P,@&C,@&މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hhhqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhhhhZ@]9~ ]B뫋EEPq_ E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh}t/EEtP1uuRPh{]9]tSuuuh7\uu] SY[9t$PRuuho0u! 1҉U u XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPK MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhwtC M苉9t.CM苉p9t$1SQ1RPWVh]C(S,C S$]9UrSPWVh /WVh) ~}t5EtC(S,C S$9Uu9EtPuhP EUjuuWVSuEE؃uju [X }t$EtC(C PWVhq{}hh hhREzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP EuuWV 9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVg 9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhDEuE‰9u+|vEL։A9u9u V9s9sE]Ã}thiFh&"Y^tCpStCHuRPuuEU}t h2ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhD&6EtM}`d)RPh  tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8jT E1҉PEMAAA D1ۉY Y$XZ}t.hjS ËE쉃P^_ u =%ƉE} t hC舋[1ɉM%EPjh WVu*hjNS ËEp }쉻PP P jPXZtS Su%}URjh  t1RPuhjR EEp }}M쉏PP P jPW^_utCHSLC419|} tMhyRY@Et} t#h3Zu uuS9u u_{ X SV{ X]=t SA{ XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjP Ɖ_tCtPP ^tCtPP FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h~<SXZ؍e[^_]UE Puj% UWVS]FHljL1RPuu EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h@ u~ 1RPuu  tDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuJ €}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhXZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhXZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhB_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu Ɖ׀}Mt1׋C|1׋URju1RPQtPuhd Ep 1RPuu( t֋F Ft:_vkk փ~t*uuh@ tFVC(S,FC vkBHMQjPjjRt PhXZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhZYEP tu}rz}zP4PR:X17D&t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP,  e[^]UWtBRBR t RPY_}ÊtBRtUWRPVY_}ËBht1UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh$hLhhn8UVSuE H$X(1y9)tNp1SQRP  e[^]UVSuE H$X(1y9)tNp1SQRPr  e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh$#. E|BD1H)CNjEahE@ EDžp%pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPhsE‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWV ‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPhskE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWV C0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<u&@&&E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPhs‹EEp E @0E܉F uMMЉF <u v0E@4uPu% E܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉OơH&L&Nu"h%h\hXht5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^ZudM ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h%jrE Xu9utpE MAP9q4uX&\& y(xh&l& `&d&A%AQE@p&t&EY눋EP&W~Z} 1e[^_]UWVS<] E@(E؃} G,u1uȃ{1ɉMȃ{E9C(rC,}t-wSu"XZEtEPt@pEЉUvӋE@HEEԋEYE؋E u1 t1EE}P{}̍OKu؋uЋ}ԉ t1WVR8}̉CPP}M؃1ҀMt)}}9s6H 1B׋}d}9sH 1qBC EsE̋E#u1 t1EE)C(C,}K S$u,C,E Ɖ1u)EЉD1E,C,EƉ1u)EЋUԉD1T11EH&L&EUE@(E؃} G,uWhYIhp&] &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃShBhV边V^NjP ѡ@'a5@'kƃt(@hhbPZYu)5@'CYu*LSh{Ihp&b 7Sh{Ihp&M FhNPPYZu5@'Z1ShIhp& @'Ƅ=FVvhPShIhp&ļ:hPSc}1RPSVH @';5@'Bơ@'Xae[^_]UWVSuSS_X؉8/u@1Ҿ1h\PXZۋtm;thlu1WP ѡ@'S^5@'Yt@9uVSBP uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3f X]] UWVST=&th&hIE[^& nVUX=&E}tPuPuSg uSg EZY~/9jPuSjSh$Kh=Khp&7EPSEPS=&tuuuuh.SC uScg Y[fft uw Z5D'_Xe[^_]UWVS}E U#ÅuWuu hRK=hhWRb ƃ y@Wh?hp&ehp&30 PhpYhp&? 1S ѡ@'@'0f Nj[Yځ~RQW}a @u55P&5 &5&h|Khp&趶F0 PhKJ=&uURQV%` @uG5P&5 &5&h|Khp&j0 PhPhp&N$j%Wa Va XZe[^_]UEU ]U= %#tjjh %{e h %= %#tjjh %We h %UWVSƉ׉ˉ t;5&&rWVhK; 'RPWVBU 's{ S$=&t [$t9{ u9suhKS<XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUhKPb<XZUWVu} 1 tC;5&&s.'RPWVT 't;x u;pt@$e^_]UWVu} t;5&&rWVhK: 'RPWV%T 't H$9x u9pu 1pp P$WVhLi: e^_]UWVSujj[_ÅtJNJ/t tF@PW3ؼZYt [u Ft[ 1ۉ؍e[^_]UWVVj/PM_Zu1,VeY/txtEVh2L9XZEe^_]UVSu'F'9s%)P6S`jj*9tC/vKShILQ9XZ؍e[^]UWVS}u h`L09[u軷YƉ<'uE5& Zu hjL8X)& '9r '''uS{؍e[^_]UWVSu='uF5&W Xu hL8X&Lء'19r C$؃(t''C$' 1ECCDžuPE  EujjY_t VhL8XZVV腶_C[ٸ1Xj/VB^Z@PPQC{G C_ Y^Et5uu XZYƅu hL7_E UCS FC^1E E t)uu ZYt hLN7XًE U<؍e[^_]US]S轵Z'']UWVS]f{t hLS8Y^{u&{t hLS7XZ{ t hMS7^_s{ t]WVqZYuh8MS7Y^49uWVKXZt-~"ЅtP9uSP hIMS{7ZY3'C$'Xe[^_]UWVS]E ?ƅu hXMS27_X9stsF C^ j/u gZYx3WƉWkC$8VP艸fCu fCe[^_]UWVSd=&th&hiM9XZ&E0hFu_Xu,螿0P PhPJhp&uhM55fc E1uE9&&ErFuuZYƅt)GE~SFPj6v}ӃEU1E1}E9&&EuuPZYDžttj$GPEP[uGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP+눃EUU'Mt@ESjjEPE 'E9ʋE E̡&&EUMԉuС&&E؉Uܡ&&EU䡸&ESjj(EPC @t,趽0h PhMhp& uhMM3S舣Xe[^_]UWVS=&th&hM7Y[}uXjj5&5&M 'jP '_Zu hN2^jjjhhbfHwjju/W ƃ y,0 PhQJhp&6uh Ny2xPV]Y[y,裼0U PhBNhp&uhLN:2EЍXjS XZu hnN2YSWVRV y.G0 PhKhp&蛫uhN1j(PPVV xV!W &Zaf EtP52'hXae }yP52'hxae UW}t5U1jh'jjjR56'}UWS}t]U1Ejh0ujjjS56'e[_]UWS}t]U1EEjh0ujjjS56'Se[_]UWS}tY]U1Ejh'jjjS56'e[_]UWS}t]U1EEjh'jjjS56'e[_]UWS}t]U1Ejh'jjjS56'ne[_]UWS}tt]U1Ejh'jjjS56'#e[_]UWVS] }~j PW56'K Rt$Nuj@EPjW0Phaj6+j$pPjj56'rEЃf=t Rha&cXZ91׹󪉍,ƅ8fEf;} 14zj 0P3Htƒ 08t3haj*D,ƅGʉLj Vj56'ƅ914}t1"jhasrm uƅ5jhtj4Pj8P56'<habh&>[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`56'zZ @u hbj)E<u 52'hb<u52'h.bhp&.d ~<tP52'hAbhp&d_Pu󥀽_y-`9CShbbah&= j RZ<hjb`Xe[^_]UWVSE] h荐 Zu hybj{(1󪍕 19}J jQhmk ujQhbNk u#Fuobu 4jVh/k ÅtIjVhbj u'jVhbj uƅ7fDžjh0uhj P56'ƅp9؍t hbSvY_uu"-hS XZthbS Y_hbS XZhbS Y_u hbS XZS52'52'52'52'h c^@tAtif@ffh.cS&uY_`f@ffhKcStXZX)/f@ffhcStY_"u hcZEVh^]Sh]X4S׃X9uEe[^_] e[^_]UVS ] }t3h$VHgt\tPQhygVSPf@PhgVSP1ۉ؍e[^_]UWVS]}hpVjSzPhgQ{vThgQY {yj hgQXZ,C@tPhgQYX,C t PhhQXZCȅt Ph'h~QYX{w j P_CȅtPPh:hUQ S C h:VhTh3QC t PhghQXZhpPjSuj PXu'tPh|hPj O W;} } <;u GVhhPYXujhhPXZjhhP^X>9tR;U }MuRlhhLPZY1ɋlhlPh'PhAlBXXhXe[^_]UWVS] }uhhO^X1C9~D3PhhOFZYj NX}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u H @u hbj<EtU2'<uRh <uRhhp&Q #<u jSRPRhhp&QjVHe[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@U'Phhp&OjFUh4cUWVSÉ֡$8'P$8'uhh 7'Y_ 8'hHhVhW`KhFW _ZuhHPh\j1 J<' u.h 7'Phuh|Ohh 7'Phh|N1X9ډ}Dh<'7A $hN <'tWPjh8' ?;9}~ڃ<. uP<ؙPhɀQNh@8' YuRh2jSY[j^ 1<$1$jmSXZhXZ?e[^_]Ujh@8'ج U=<'u h/”XjtDUSh/謔h2jSh2jRh2jRh2jR$hhh/5 xVj"h<P h<'?j PS jhS (h8'Q$h8'S S ]U2PhJhp&LjCUWVSы&:֍RD{@u1ҊBuT8t9s &DY@tJB[^_]UVSËHuPs8tIS8kC4`9s `R 1s0s4s8X{Xu1ɉKXCXtPЁ Z1CXe[^]UVSu] EPu36Gx9s)e[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|Shj EPGEEEEPhhj EPsGUfT ȃ&DJu.D=uUR蟏P U_Ce} t EP{YuhZHXZe[^_]UWVSS1}11#tAEtSWh΃PSh?P @u hhՃ5WN }YCu}u#hxEZuhhڃjEe[^_]Uh߃PhPhPhPhPh1PhQhp&2J8j@U[Ph?5%J@' t5@'Ph5%IE Pu5%ҳ@' USÅtNRZA'twRtF @'ti%Z0׆ Ph@?'hQHA' @'u=@'u2j@ @'t#Y0葆 Ph@?'h9 tŋ]UWVSEEEEujj}WjVPA @u"e[^_]ËEƒUt PhjPu ZtjjWPVu @u ]=@'u5%uh!E msM;Ms"VvvPh΄EE Uj DX]e[^_]} UWVSEE]EEjj}WjPSL @u-uu YtjjWPuS @t̓=@'uuh?DXZv<9t's sss ssshۄD ՋE荞 kT؋U9u FE1}h@?'hZYdTEM9Mt?SjhS*aD :1;{s֋TM4Ph:DG ,j ICXue[^_]x| e[^_]UWVS}}} }܃=@'É΃=@'tO=@'u:=@'t }u&}u35%Rh!C@' 0h&juVN}u!Rh?nC@'Y_~7j |BX@'~#@'~}uڋUe[^_]уtut3]ߋMtu*E r4s6Ph4]ߋMEtPEPh b sPh,PhyBXZM]ߋMtuuEPhB$M] s SQh-SQh`B }uEe[^_]DBE e[^_]RAe[^_]Ã=@'t@'URh@?'4%hUWVS=@'uhEsjR;j=PY^Xd 1Dž\ Dž`hj`Ph@?'\PVS@u!ڋ\==@'j:Dž`1Dž\YdX@DŽdj`R`PPQV} @u!+T0݀ Ph@?'hjWBuh@?'h:XZ&@' @'uPh@?'h9{@ e[^_]UWVSWE}u =@'R˃=@'t>=@'u3{=@'tNu%"u25%Rh!@@' .h&jWSu"Rh??@'XY~7j >^@'~"@'~uى؍e[^_]it1RE rGK=@'tUPhhi?YXUt2=@'uUPhE?XZUB9|SWhT*-? NuEe[^_]?E e[^_]">e[^_]UVS]=@'t EhSJY^uEEYQ1҉jEPS EUE 9u%Suh =@'j78uQ8u̸]1PSEPuVuu2{ @u1t =@'1@' @'u}u}tPjUEPj UENY^tF@' @'u}u}tjjMUEzjj UEXZe[^]UWVS]=@'t 'EEP18jjEPEPuuz @uuhхkjvS蕪 Wf u%Suhe =@'xj46j3uV. |WO8u|1PSEPxPuugy @u1Ft =@'x|t1p@' @'tpjxUEY^?URV EPVhjduV}:pPUEG$tk@' @'tjj|UE~XZEURt6 EPthjd]S :jPًUE$e[^_]UWVS(%8@?'t f='/='@?'SV:ZYuVh=' e[^_]É)@E̍EӉljDPh=' h\h=' uUWVS`Eh='ABZE1]M;>r2jPRU& Utj@uVRP: V3h WGjEPjh='RU UuE Eu1}u+E9Eu#/tj@uVRP V3hjGQ1EEe[^_]UWVSEUE5@'$ˋ @'@' u'A' @'h@?'h*[^=@'tu*jtHu!u05%uh!=9 *h&jSuDHu"uh?9XZ=@'~(j 8Y I~I~uڋEe[^_]1v{9}E0Phh8FYXt WhT8XZE e[^_]7e[^_]UVS]EjjEPuVuuau @u Be}t Shhj@' @'tjIY2=@'u Sh?8XZuuuuuh7e[^]UWVS]uEEU E$EA' @'=@'J@' @'t}jjEPjuVt @tdMt]QM>g XtMMMjjEPWuVKt @tM;Mt Wo _j@?'PY}e[^_]so }tuh@?'h = t)tu*Sh uShcShSh;SXZe[^_]UVS]E jjEPuVuus @ul} t Shhj< EUEU @' @'tj cXP @'u EPR+P5%Sh6&IuRPh5 uRPh5e[^]UVS ]EjjEPuVuur @u}t Shhjg @' @'tjE=@'u5%Sh!R5 EU=@'h RP{ t P:|Xuuh5 e[^]UWVS,EE̋}uu<=A't3EjjEPEPh E܍Pk((U܉UȉMQMqd XۋMЋUuwuM1BH(jjURPVWbq @uCEԋU܋M؃t (9t$9uދẺE1uhhj 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh%uhjURL2UUС@' @'t7j(EY(}t GE܃t9]e[^_]k =@'uuh?73XZv$v vvvvv vv6h3,뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph|<Dž|tW>b XuJHxjjxPVph1o @ut9xt Shhj l%EpujjڍE_X=A't=19|Wh%ShjURO0 jjUE{G ŋ=@' =@'t jQ=@'u Sh?V1Y[|~+t4Wh91G9|~ hU#1Zj :0Xue[^_]ii e[^_]ÍL$qUVSQ$A QEjjMQuVRPm @u}t Shhj @' @'tjYd=@'u Sh?p0XZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$h#0eY[^]aUWVS@]=@'t Dž SXuhhj 1h\yR& Y^B18jPS@ u.B8"uSh9t8uShj% 9tҀ8úw܉ h\yji 1PSPVuuk @u1t =@'1ǡ@' @'tW EZ)AP-6<$PUEVf tV@' @'tj EvX1P5$PًUESxf e[^_]UWVStx|h@?'5l@?'$='k5Yh='h)ȉl)ȉ='u@?'u|uH1ۋx9t担thbuRPhPPC뿃} t~|P%xwRPh!PP|PhbxwRPhPPU Dž|%|%Ã=@'( =@'th='h?o,XZh='h@?'h,W, EHv hh6<4lh6.,_X}uC|@0|psPhA+Y^P|p4hL+ |p@h]+|0 A'XZpt 6hhh A'hhhh A'\yppu/hWh A'hhqh A'揃\yƀt2hWh A'hh{h A'\ys2hWh A'[hhh A'G\y s2hWh A'#hhh A'\y s2hWh A'hhh A'\y s2hWh A'hhh A'\y s2hWh A'{hhh A'g\y s2hWh A'ChhdMh A'/\ys2hWh A' hhh A'\ys2hWh A'hhh A'\ys2hWh A'hhh A'\yt7Vh!j V'hWh A'QhVh A'A(h A'|p%PhÈ(|@H t PhԈ(_X|p(hވ{(j ' }r=@'=A'u }|xXDž1DžtxTpj`SPPWtd @pu\t|@9uߋ|@(9uΉdQpJW ^dtNjp󤋅|@XPwP_ Y|XX=A'uTE tN|@XpHv9} |pUE"<=@'uh@?'h?&XZ|@XPvhPmX}|ps E z-UEÃ}tP@uj-Of Ph@?'hjs u|xtjh='h@?'|@@uojjPjxtb @uDA' @'=@'h@?'h|@@EH{$|xt|@8d uq=@':t.s j|xtjh='h@?'S A' @'=@'h@?'h*$tx\=@'j|@4p\LT _+jjPRpx@PtHa @pt*|p`t7|@4`&Ri\ ^KQ78 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQTCS ZPtރ NjTCXpsR[ X1@'d1ۋ|;X4,F\sA' @'t%xQuujPtC`jjPSxt_ @jjjjPSxt_ @UjjDžjjVSxt?_ @uI58 u3Q XjjVSxt_ @u jٺ@?'|c^_9SZ [DžjjPSxt^ @tgjjٺ@?'|^u8Q Yuh@?'h;5%$ KjjPSxt&^ @u jڸ@?'*SWY XZhƀ='lƀ@?'e[^_]UWVSƉLH@'j=P_ZƅTt9sx?u @ƅTGh VY[.t%%8| 8Vs tG=^jhSH+ P` F<=t:%M  T=@'u h^s 41Dž81ɉh 1ۉtpƅY1j,T_ZƅtF1ۉH1DžL1<1ۅkj=V[ZÉluhV+ZYu09@llhV*ZYu D1j,S ZYDt @Dh]mV*ZYHt;PHu]mPTh, =@'j110jlPS/ Zuh@?'h;*j VWPSLPrK @u%Tu 1M !8uSF Xcjٺ@?'PjV@?'PSoF )HLjV\`e[^_]UE u@ t]UWVSuE 1ۄt[EtHvFHw 19u5CE  t)Etʍxw ʍyw̍Q lj[^_]US]ylB'lB'@B'kot=}'t=B't&ŝjvfAjO-SEUjhjfUu u@ ZYuUVSuV,$@PVPE#؍e[^]UTO'E]UVSË0>-u F0j PV x;3ue[^]UVS@Ë5O'=X%tjtSvZYuFl6j j5SHFSy$PFShψP\O'5O'F Phj@]SB Sfe[^]USQtPl=XO'uS< Z]UVSÉu=XO'u VS= ZYe[^]UWVS׉΋]Uu E E!UuU.t[^_]USt<0„!1=XO'uS: Z]UWVSLEӋu>h&VZY)ƒ?EljDUh cSP1 EUDEj URPEU:*u%jjWSRPEP,tEuj>u E9h cSV'1 e[^_]9`%t3UVSRPjuV?`%e[^]#`O't úO'=B'uO'UWVSƉӊ>uuVB'HtB1TO'hTq5B'Vq0 =TO'1҉TO'hTq5B'SR0 9=TO'~؍e[^_]UWVS,E9PO'B''}]6SPY^y#B'B'B'=LO'u O' LO'S Z=X=&wAKw2if0[nRf0D=,w$==!f0=Xf0=KwJ=w$==` f0 =%f0 ===f0wf0lf0af0Vf0Kf0@f0 5f0 *f0 f0f0 f0EۣB'EݣB'EܣB'eẼEfE1E O' 5'< Sj5' EPO'e[^_]USEPhht@j 1ۅu E]u+h.eaZtP_gB'XʌT~B'h)5aYtP/gZyB'B'1ɉ \%=B' B'tB'0h9`ZtPfB'[D~B'h4`YtPfZyB'B'=B' B'P]UPUEN'1J$ (UAUDlyUNUGUJۍUMэUPǍUS뽍UV!u,UY uN'N'N'1UVSPh~_P_ZYX%h_[u1ɉ XO'PhF'53 [^Ht XO' t XO'AxB'B'B'iB'PB'\O'y1B'B'B'B'B'B'B'B'~1҉}'EB'UYt0Uu|O'U²uxO'UrB'U`u\tO'UEumpO'=\~'t8=4B'u/UqXlO'UhO'=lO'u1hO'lO'=hO'u hO'U>O't8uB'O'UܝO'=B'tt8uB'O'U'^O't8uB'O'U/O't 8u O'1҉B'EPhhhO'O'GEP5O'5O'hO'O'ިY EP5O'5O'hO'O'.NEP5O'5O'hO'O'. U@"UuO'L3t O'U O'tހ8tٍUc4ÅuO'8t&jjP4 PuuVDEĒO'UӣÅt =\%uO':t+B'HPjR*4 PuuVUDErYO'U46urO'UÅuUS…u=B'uÉO';u Z'e[^]ËB'tO'nB'pO'^=dO'tg=X~'t = B'uMU=}'t=~'uB'xO'=~'uB'hO'1҉dO']1dO'á`B't 1=dO'úO'B'O'O'O'USc=X~'t = B'ul=~'u<B'lO'flO'8thO'8t=\O'uB'=~'uB'|O'!=}'tdO'=l~'t9B'~j CX]6]Uuj5O'1 =t~'uO'8t B'Ã=x~'uUjlXËB'O'qO'bUWVSu M1+uAM]-}tue[^_]USÅthpPZYu ȒtEPEPS tt<`Ux̒Ux< ̒Ux ҒUxݒ]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]U帓pO'O'O'|O'm1`O']UE t  &@t]USuZù¡O'ڡO'ڡO'=}'ttS蘯2XڡO'`O']US=}'t`O'u ]SJX]US]SZ3`O't]]]UuZu Y9Ã=X%tUhXúO'UWVSu}]E Et#jYu7u21ۉ] EjYut$RPyZYtRPjZYuÉE1ɉM E t9Et'hÃu1҉U t EE/vOԺ5u Y [1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E EIe[^_]@O'B@@@ 9uUS]t=h%tjh]XZh%]Ã=@%UWVSO'@@ˁ1 }1119މM}Z O'9t+9xu"9puUpP5@%ȣ UхtjhrFXZ뛍e[^_]Ë O'…t8=O'u/US@t11Ҁu 0@4@[]UWVS$O'$@(@u9t9pu9Hu,@;Ps D15~'%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=8~'t @td%x; @~QMh j* ZYMu 18~'0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x ExO'$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@Bu@ujh[^&O'M]艈@@h%Ft*Th%=*u:Vt3st!dt1k1uUE 0e[^]UVS hj% h,DhP'o hxP'e hlP'[ h`P'Q P'XP'P'\P'xP'PP'|P'TP'lP'HP'pP'LP'`P'@P'dP'DP'h0D1[<=:tjh;?j FWZPÃ$0%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=O'tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=O'u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U@P'E1uNHP'Ev¸u6&E^u =d~'t%ED]U@P'E#1uNPP'E¸u60&Eu =d~'u%E]UE=O'tE]P']USQ]uhhP'[w?SSZt'؃@PCYu@Sh”(S5P'SZt. S YtS5P'j hP'"yEP'SEPEXZP']UXP'E¸uH%E]UU 1}Du% ]UWVSSEIuRfP^X[RVZY1uEV Xt SY-hR'jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRh}V:hOJ:Sh_PQOucjhgV=Oǃ u.ht:Sh_POu0Sh^V O Sh_PNEW Ete[^_]UVSh9P9ZYu3h*VZY1t=h QVY[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPV5_Y[{%=ehށVV GShV #jhVM  1҉p1ShWV t t u@hWYZhWYZhWYZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UEQ'U Q't@]UWVSSuE 8=}'u ^9uO tu QMZYMuGCQ| Wv _Xu s ZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]áQ't);4&t!UjhR'PQ'@ UWVS]=O'u3Q'=Q'Q'Q'uPQ'Q'ÀuQ'%=ua%=tSSHQ'%uF Q'AQ'Q'9~1!PhQ'ZYu(1Q'K1=Q'4LQ'15Q'=Q't1ۉQ'UU1;L&u PS_/EZYKHA$D}e,+1Q'#1=Q'15Q'Q'tQ'8 1ۉQ'Q'=R'vx u-x Q'=R'w1ɉ Q' Q'5Q'GZq1Q'Q'8\<1Q'I1Q'E1Q':41Q')91=Q'Q'=R'v6x u0Q'=R'x Z߀x IQ'=R'w15Q'1ۉQ'Q'8 uQ'8 oQ'oZQ'Y1ɉ Q'=Q'=h&yQ'-R'h&_h&[} t9s RUVhR' Uuω_1Q'ItVhR'FQ'R'XZQ'8=Q't }Q'tP 15Q'_.=EP[¡Q'u=Q'R'R'u"zQ'tމU&U; u C9re&Ed&E11ɉMR'9t)9s"RUuV Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\Q'Q'tPN XjQ')@P,Q'Q')RSP膢Q'0e&8uCSm<XuSAQ'_WAQ'W Y[Q'Q't{}t1Q'PhQ'o-1ҋE7_ZQ'E%Q'Q'9Q'sQ'u,15Q'Q'/]1ۉQ'Ku5Q'DY.Q'=R'v d&8Huh(Zu\1Q'vQ'e[^_],e[^_]UVSQM1uuR'EQЀ w[jjjj uuuVtjh˙Y[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1Q'9Q'|R'áQ't @@@ Ã=BEZ'R XE=@u$HZ't t7tut g ]UVS=\%u=X~'t = B'ut/LB'PB'u ujjj5TB'RPV pZ'u)=\%u^5l~'O'l~'1ɉ O'-5l~'O'l~'1҉O'u H5zY6Y5l~'O'e[^]U]UWVSt e9ZƉׅu‰['['O'='u0t;5['['}jjjG 1O''ld8e[^_]UWVSQE)ơDZ'uDZ'DZ'ǁt#t1 2ux%DZ'Su5DZ'áDZ'ƒDZ'@Z' t;x- st jk1j1Ztjh蹱ZYtV1VJ)Xe[^_]USVáHZ'$N   tw #58Z'jCP7tW6%I/f5$Z'S5(Z'5,Z'q1,Z'?E48Z'؋]`DZ'DZ'PS5<+u C< uhB'tPZ;u 1hB'ShB'X58Z'jPCP=t71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉Z'YYuZ' ыuUS]t CPX]UPKPEEUWVS<DZ'B'@HB'e=HZ't1HZ'18Z'S u݃=\%u yhK5h&jYO =HZ't)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $j1ɺ97 8Z'191;8Z'^  Sq?@j1ɺ;4Y u lpSrj1ɺ%[Ze4 t u.Sp_eZ'j &% j1ɺɛ^8Z'19WSXt1E9EsWQMS_ZHMt QXYKEPU8EtW/Zt WYWEP.XZ}tE)}+} MJx҃u̓@tAu=}' =}'B$}mu;B'}Rj#;kZ'XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e=}' =}'B!5B'V9}Pj#RjZ'XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]U塬Z'Z'|Z'rZ']gUM UZ'y1E E֛]7]UM UZ'y1E E] ]UWVSJ @%jjjP}Bu'@u$5@%J @%Yjhy=@%y]EPhGXZ]UWVS}9=\B'tQƃ=\B't1 Ã=\B'ttVZH V5XB'XuV~[1WQP:`WÉh t,DždW Y]`\Rh`MYZttV_u |$W?XZtu h\VhWS֍}tjS< Y^y SgZPr= X؍e[^_]Uh}ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'\B'<%tXB'tRP5Y^CGjCŚXZutKH݀u=9us8Ft38Ft1 \B'<%t XB'tQPS SՕÃCFe[^_]UWVS]S^u1jjjSΆBu@thVS#; ~ˍ19=O't)RP芨ZYu FSW_XSjW]ƒ =0~'u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=u V;Z S2X؍e[^_]UWVS}1ۃ=VuPǃ VPFZYu SY1WVXZ؍e[^_]UVS]h*S ^Zt(hSZYthSZYƉe[^]UVS]SYuVSZ YZu]e[^],~V&~Ze[^]UWVS u=~'hu#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=}'u2=O'Pk$]'RPWVcWV4Ɖ׃ - ~'uWVcY[uu}䡔'Eu藊t ub EUcuu3uuEUEU9uE'$ uuP&EU ~ÉEf=~'Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃ'g} t}uS*(EƉ׃}s}t$ ]'_E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉U'襅t u`Ɖ1X~' ~'uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=~'t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&= ~'tM\RPj =$ Mj}!SQ{&uu+z^=~'tMWVuuRPEU$=P~'t;}t5 u't t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1= ]'jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=}'uk$]'9EE}11軁 ~'uEU)juuRP蹁EURPǃ[^y=P~'tLۂւ t u, u'<ͅ u@)蔂'訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃ'Ex u5#Å^IJ  ]'MCEă=~'XmRPSO!Eă J…u = ]'~1҉X~'uȉ}E=~'u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=~'t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=~'t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5H%=L%΂Hw t5P%=T%e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S= ~'Ee[^_]3rWVEZYt1ۉ] Ee[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuEB')HPY}ZY!vƉ׃uu1E EYe[^_],XSuWVQ9| 5$~'RP e[^_]Ê t u@UWVSƉ5Z'5Z'hshSok=wWV)RPSkZ'SgXe[^_]UPRdXZUVSÉt C[^]UWVSQƉU<\t <^CSkt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPhjWfϠ5j PWO‹ 9u ^Z'Ze[^_]Ëx]';p]'~~p]' ]' t]'‰x]'US\^'X\^']'^'[]É19&t @uUP`iYtB'tB'tB'tB'UWVS$]'UjSEjSڗ}tUuu$YXtP5]'} ljE5]'5]'5]'ޛE]'E]'$]'XZ1e[^_]UWVSÉ։9$]'~]']'< +t[^_]UWVS׉ˋ5]'V]'Љ[^_]M=}'tt*ttt t XÃ=0~'u[USjm5P]'6ZYȒt:t1ɺNC=]'t=t1ɺ*C]UhE讽P]'PYZt P]'hV艽L]'PƽYZt L]'gjh=U]'jh,U]'$]'h]'h]'ނh]'Ԃh]'ʂ h]'轂1]'ZU1}]á]']'U]'1\^'1]'9]'~"]']']'1ɉ ]'@1x]'t]'p]']'l]'h]'<]'d]'`]'H]']']']']']'h]'(h]'h]'h]' h]'1҉]'UWV=<~'uu uƉXZ11~' }'u=<~'u u$ZYt]'@=~'tʺ@b P%T%~'ut79MM |-M9 H%L%U |]'@x@]'c B}'9\^'H1Ҹ WVY^1 tj uVRP;FV$gƃ1}')9~1Ҹ G19tD=G1Ҹ \^'x]'e^_]á~'t}'=<~'u }'DUS]'9]'~$]'<u]'Ph]'€XZCԡ]']'\^'x]']UWVS]u }Eu@0tjxYEe[^_]+f=O'tW~Z=O'tw/P'x_uSQ~[ۃ]'~K1S|YuSWV~_ZV]'t2dZYu]']'DV c_tW]'uVb^ƒt B'V]'tcZYt tB'tB'tB'Ӊ؍e[^_]UWVSEUMЃth]'} u)}u#=]'MH]'}tuEPjEU RPu ugu=}'t[]'tR E['['ut;UE }EU ['['H]'u=H]'tr1ۉH]'1D=H]'uf=H]'uJ8u u1ɺZYG9{Ft]'1k à]'ك}u E1O]' ]' E1~RjEPy ]'1҅~ ]'TRPuu&Ã=0~'u}u9EEEE55x]'+5]'Ee;5B''EPv_ ]'9]'uY=]'u=]'uEU ]']'1=]'~+9=]'~]'81ɺGh]'w|Ym19}E81ɋUG ]'9]'|1}uEPh]'|XZ]'9]'~Չ19]'~=]'   ]'<<@B)5]']']'9 ]'}1ɋ}' JKݸe[^_]UWVSƉPa[=0~'t<x]'+]';B'~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ198]'~ @]'t 8]')C1[^_]UWVu} =0~'uWV1ZY ie^_]á]',]'x]'(]'á,]']'(]'x]'UU1wR5P]'D-ZYUS]1w%SZ1uS5L]'-ZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6 ) 9tu!ـuJ!) u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} l]'E졘]'=0~'uuS]'Zt ]'1l]']'dSPEZYtJHWVM^_]'xt ]'Sh]' yWVMZY5]'V1]'Sh]'xh]'k]' ]'Pdyh]'x]'@}]'2]' ]'9]'}%h]'xX]']'= ]'9=]'| ]']'؉ESjEP8tU$ t9r)ډh]'w5]'苎1=]'[^0}'t d~'u"uu} U]' p]'~@9]'| ]'|t ]'D0tu u. u#uWV11ҸJt1Jutq]'ЉERj]S*sƃ ]'E9s=)У]'RjSsNj]']'?4WtVL)x]'~뫣l]'m}]']'=O'ul]'PapY]' ]' M9u3_u(t M:h]'t E)M Ma_uM]'UK_uFM@t>SrZt h]'E)]']'PoSPYtE u1l]' }'t =d~'uuu} U x]'+\^'4& ['~9|0&)ș); ['}s$[')WVgU ZYu K=O'tw.PmYtu} U؍e[^_]=O't+=0~'t"SqZtSarWV WVMUmZYe[^_]-UWVS]u }`]'t4 u ti5\]'5X]'1ZYt 1`]' }'t =d~'uVuR=<]'`]' 5X]'=\]'10]'4]'_@8]'1ۉ<]'i뷃=O'tH=<]' 8]'@]' (=O't<]'un8]'@]'ÀuWV1҉ZY%=u+%=tSl<]'50]'=4]'_1%ul 8]'A8]'@]'9Ph@]''l[^50]'=4]'th@]'lWV@]'. 08]'1ɉ <]'<0]'4]'P8]'1҉<]'8]'=O'uufe[^_]Ã=<]'~U0]'4]'1҉<]']1UWVSQu} EE`]'tt t5\]'5X]'1^XZ]'tl=}'tcB';x]'p]'x]'t]']'Q}'B'D;x]'~ }'=}'uB';x]'~1N=]'tx]'@B'9}Թ Qۃ=B'tt =B'u =0~'u 11Ҹ *=B't&}t 1Ҹ 1Ҹ11ҡ]'e[^_]UVS]]' ]'ށ9]'~tu ډ@[^]UE]'E ^']USEM =d]'t)=~'tu ~JH1҉ ;\^'9~^']']')Ћ]']'[]d]'1]'UWVSQSMQyq uu RPG\ZYuh[ƒt1ۃ tt 't[8$]'H9UUt Z]'[C뮋 ]'t ]'teY[^_]UWVSQMQyq 19| RP[ZYu$]'X]'D]E t$'u}tjU$]'Et ,ZL]'UL$]'T1;]'r H$]'E)K]'Uz11҅t ]'ىt $]'eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQjPhUt!SMQPEEPsE1jRjVE)E뜉+E)Ѝe[^_]UVS ]'1 ]'SutFjjP t ]'@11ҡ]': ]'e[^]UWVS5B'B'j:Y119=B'~ !AtRP x]'9}G؉5B'19|)e[^_]UVSu E!y=VRY@ w>uV&SaXZ1jjVM u뾍e[^]UE1҅x &]=w't&w'tUSJZ P+JZ HX[]Ã=p^'y-U=<~'u Z'1<~'jhA5ZYáp^'xW@dp^'UWV1ɉ p^'5h^'=l^',9Ɖ}jh5p^'XZe^_]ø^' @=@w'u1@w'w'^'t^'`w'w'w'w'w'1҉w'w'w'w'w'1ɉ w'UWVS EE} MEEw'w't"C 9Ku}9{u E9C֋sw't^'t w' 1t^'ЉpHMH MHxC;4-=t^'u`w'PHE8}w't'Xp9ډ} EӉEEډÈ}tEt^'t^'@B [^_]ÍL$qUWVSQQEU=<~'t E]!@u 111]9؋]ع5w'w'tF U9V}}6E9F uE9Fu N^*h^'l^'1=p^'w'~t/`^'ZY1111҉ɃuRPEUWVOEUjjRP't 1`^' uue^_]UVSEU =}'t5}'9|)11[^]USZKJy ;J|< t Y RPHZY]UWVSuE E>-uF"Hh(V(h( TEj舦C'j9jWjh Ej by uJ Xh#Xu>h:tu R5_UVXtˋURUIÉ<$IL$QMt5蔻WPURhMQS@ W`z_urVZ5YS| SAzjN u u> jVj8}t&u'h'X,j &u& VCZ'u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jh¤hFS YXujh,XZFh&S&h&A%j 8jUjj H}u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuV jj sHj`Ujs7BZ'jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw kw'GPw'kw'1|''t'|'#tUEEPh**YX1ÉUS.w$tX|''^\B'w'1w'w'w'w'tP0wX1w'w'mNt jhgB'K \B' w'w'w'w'jhw'{/\B'w'w'Y[뉉txux ujh 5)XZ1]UVSw'1۰#4t'5t C'Ca1ɉNF FFFtPIvZ1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5\B'sS CKCtPuZ1Cw'e[^]UEt*xu x u]?@ @w']U Pu]jEP-UEYYut@ \B' |'|'|'E|'|'tPuZ1|'w'UWVSPEf=|'uJ=|'uA=|'u8\B'|'1|'|'$~'|'|'tPt_15|'{u#jPs蓾Csvt1ɉKs {SC;\B'u RWV UP號ZUte[^_]UQMt\B'9Ptjh&XZP@ UVS]u \B'1k9w'u$9w'u9w'uPa~#4t P'@5u1҉[^]UU19w'uǀw'ǀw'=u]UWVSu薾[1w't:PPVF uEw'w'3s1҉w'YS$sXue[^_]Ã=}'UWVSu h9uJ=w' C Suu|'ue[^_]j }WRP` su sʽXh*VFZYtVWsPh0u<UWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=B'E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtPqY1Cu,CZe[^_]USE] =Phj ]S5S>~P|0uD]EPh"XZ]á#&x$Ujh@BRPB'RPh~'USEtzE 8.MU u4@E QhY-R<#& }t jh#}QhY-R& }t jh;k~'#&a#&y~'EEPhQ>Phj ]S4S=~P|0uD]EPhm XZ]US] }u!jSŽYZt]EPh XZ]US] }u!jS^YZt]EPh XZ]UWVSUE t tP(|'^w=}'E}'*}'*tRGYEEPh_XZ]UEtHw1E Ew]8B']U}u=}'u]g.]Q.]UEu=}' M}']UEu*=}'~!EEPh }'XZUEu*=}'~!EEPh}'XZUEu#=}'t=\B'to5Bu @u]]UUE t#u?#&^u2@t+#&!#&PJFEEPh@ US E1ɉ }' }'E 8,t)EPhdE P }t jh3}'E 8,uf@E EPhdE P{ }tjhXZ7}'05}'5}'h j]SC*]܍EPh0u]UVSE] J1 RD+~vQQ r/d~Q wG$) t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPhM1CSPh}'Y}'E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPhhXZe[^]ø= ~'u=}' 1=}'á(~' B'+}'UWVS }8uMEPh{Y[1bÉUP>1$@PƋUXZt=}'t <\u {t C<$ut PWZYtFFC؍e[^_]U@uPhj*h }''PRhj*h }'' }'UuBPhh`}'耮`}'UU1t 1BS]UU)4t B tB]U}ou<¸au1]1=}'U}'.EEPh{KZYUWVSu ]E0`_18-u@JЀ v#tuKuEPh&j uP yu˅tӉuEPhªY[뾅t1҉t؍e[^_]UWVSM}'tFPtu)QjP_XD}'ZjPEP 15}'1ۉ]1U:BE<-t><$<~,Ht<+tO<9 1ECtt%tAS Cu҉uC Sut H OE8t+E8 u@EsUE_u&IE8u}'9{jQEPo C]tSjZYTS\XHe[^_]UWVS]u@E濅u jhmKu@tMEEPh|uUsEEPhC UȃPuU:tuu37tj$XCCKttY?1ȃtyt((S1Ƀ: -S1Ƀ{  kȃt3t;{} t J ҉뤋K S S {} t J ҉Fwhjh3t5tFuYEPjEPOƒ }CKS CCu~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7S'Z9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]UhNzYtP耀Z~#&øU =~'u[h~' ZtL1~'EEEEjEPjK M9 't'_k~'';EMMEEE=~'t=`^'t=}'u#&=~'tuPjEP EufE=O'u);>#&9u '&P\Xʃ=}'t ƒftըu1ɉ ~'uu u 1҉~'=O'u&u~'@~'~Fj.Y<1҉~'y!08m08#_M9 'tu1 ~'Ujh~'o~ UQEPߝEUUWVSM00\u$É4$$|$WVuh#WPl؍e[^_]US]S\ZuSh^h~'4 ~']ÍL$qUWVSQ Yq AQEU}WRPq15 ˉE؉UM܋EuƉeWuuRP u؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEP XZUS#&'t,#&'Sh'5#&B 9t Z']UE#&]Ã=~'t 1~'s U=#&'r|#&P#&M1~'E]UVSP't Z'E1~'EPSXZt'u> E~'Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRP< K}Њh u؃}yC-^Su-0XZeY[^_]aTUVS]1)EM}IhuyA-NQu /XZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%~'e[^_]US5à Hw ot tSRX]UWVSu} ~'ouWV"XZE e[^_]$=}'u`~hB'WVh#&nB'\B1s9B' Z'e[^_]@UEU E Ey]UVS]u .uu ]e[^]#&P-ZE E؍e[^]KUS]tu uR4=YZtg=B' Z'j ZQuj>X؋]UWVS]uE %=@~'t >t:S$PKfPjjjjSPwf$9twVKXnjjb1=@'1҃=4B' PSWqÃtW>K_}t-jh[^tPC 6KZY>1؍e[^_]US]tP 3JZY1]U1}]UWVS|}ue( u [E E@~'x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$E<:N<%<.uFu RPY[ +!@ *u5\B'蜋_vG9^.1u؍U؉ƋU؍C<6$*  ,'1Jk ]'RY19}' B'{9)ISQRPe [u  u11ERP[_19r B'+ }'ISQRP 1(B'N5\B'5\B'P5\B'PDwS@ x(t u(5\B'pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ@'wt,'1&t E;5\B'KZtP X@=,'@'@'e[^_]U5#&USh~'=}'t¡#&u 'PE1҉dB']U5#&*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tP>=Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH @~'@'13CP<1ɉK^։UR Z9Us&RUjEP!P=Utܺ1҉S @~'t @'SuWV>ƒx6Ct P<1CZV> @$jCVPY{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]M'uU5D'Z1=H'UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} Ul'9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5L'jjWuE)PV5H'5D'$'e[^_]1D'H'L'T'UVS=Z't 5'}uuf'1ۃ=B'uDSgYuu CB'H9RPSjY wyr5'e[^]UWVSP%ET%E@u }H%EܡL%EH%L%P%T%=B'u e[^_]=Z't11B'H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v 5V5ZY1CCC ''''e[^_]Uhl'XUS]D'#t-=l'ujhƾXZ]1=''E]Uh\''XUVSu] t1ٸ\'t;pX[^]UWVSEUE|E xB'p$lB'h5$~'uX'tXsmS,Zjj1CCCj y]e[^_]x,X'CX'Z'e[^_]U€u1=X'1]UWVS4''EU血''E܉UtE؋M܋]MjEPjujuuu $''u}u܉}Mut}9Nju|M܉]E܋URP ZY''9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EU裈''E܋Uࣀ'',jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1'=}'u]]USj5L&#ZYt8jٸD'Xx =}'u='uS1]U=P'u @~'@'D'L']xUWVSU EEt :CM@tE3L' s+jhEu jhƾ=}'=~'=}'1ɉ 'MMM1ƉӃu]5$~'+PXZe n=}'=~'jh_XE:jx^@='@1ۉ'.1EPMD'Zx}' ~' j1'#X=}'t =~'TƉp~'u}tpB'xu }@u}uQB'HEP5$~'X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=B'}W؃&MxuƉYjZGMEPjEPjuujjE Mt=}'t =~'tZ}~TJEu2EUutjEU9u9t5$~'RPy =}'t =~'tjFXEe[^_]Uh=j 'XZ=~'t.Uhfjn 'XZ=~'tUE]Uhj0 'jjm=~'tU}tOhjYX=AZYq- STYuZlj4$$L9QZVh%Pj9tVDXhށW] W0 f;?SFYSFjjщ‰#&#&P#&' VhP th='t&tV_ XGP_t u Ƅ@t V [ u& u&DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBV^ Zt1'''%#&#&t''1e[^_]US#&h0SZYuwh6SzZY¸t_h=SbZY¸tGhCSJZY¸t/h*S2ZY¸tjSݏ ZYxP豐 X1]UZu E ‹E2ttHu jhIjhVjhoXZÍL$qUWVSQ 'p x tWV虛ƉY[jj1EUXZ'uBEPEPWVNE؉U܃E EtEU}u}ujh=Y[=<~'tuuuu誗=0~'tEUju4P4ESj:jEPuuS"4(eEuSXZEЅu u؋}eY[^_]aUWVS' ']11~1t2#&t AFKމt ' '[^_]UWVS' ']11~1tr#&t IFK݉t ' '[^_]á'á'Ë'tUrIZøUjE ZujhQ> ZYyjP) ZYxU']øURSjEP5'hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPZ1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3 XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV躀 M9u"9uu uEZYe[^_]Ujujh'|> UE='t&uf=|(&tE]'@]]UVSP'1=0'ud'1(hj`XZhjRY[h'= ^tTjj8XZjj-Y[h #^'u (15|(&='t j[P ֋5T'$&t,PVZYu'8@1ۉ'Z8,t@8u݋8tH5X'R'PZY'@8tSGXhށ5D'^Xuc5D'h?Y[SI$S5d'I& BP5'&P>^ZtbShV NhسP#^Zu @׀8 uSaYϿhlP#ZYt @׀8 uS"Xi8t%8,t8 t@Ћ8tH5X'R'PY^'t SZ@'P 7Pe[^]UD'jj'XZUhj8'XZU!@'jh ': &Q &y ;0&| t&J &Uh&PXZUWVSREƈEj}W5d'$ f=(&tk18'5(&襫 jW5d'z j萫 =8't.V]"Ph Ktjh'5d'# 럍e[^_]USQhjjjj| Åt4EP9 Z9u< hjjjj]jjjj(&j/Sк څtPjRS  hp&h=dhj# hp&h=dh*j USQjh)5|'> f=\(&t#<(&;tSp$S5t' jh5t' jEP5h' }nu5<(&h5~XZ]USPjP]ShG; t=<'u)(&S許 Zy ShM4ZYh;X]US]j5X' SP t ShaXZhfj\US(&t$;tSi$S5d' ja jUS(&j/S ZYPujuhRSI ]UWVSUu 1Ɋt< uB< tЊt* xt t9tA8uˉ[^_]9tAW|$wUWVS$}EԋO_,$&uVRPSQy M؉M 0$&VSQRPqy Ɖ׋]؉]4$&RPWVc{ ƉEuhXZTu&tO t'Ee[^_]g_h1HssP4 $&Rho/OuUWVS]S$S5d' 1ۉ@'jh.5|'+ jhx'5h' ƅ jP5d'W jP5d' =0'!Ѓ uh'jj h '4 $ݤjiXZj TY1=@'u=jP5d'_ =0'҃J"=@'u)uRyY_uՊ< ttJ< uf=|(&tFVhx~XZ)9='&:WPu ~ 9th|Z_@'VPu u~ 9t h|#^f=|(&t$jR+$Ph h 'jjG jhx'5t'~ SjXZu  Ye[^_]UVS hVhZ P [thiyÅyhZYhVh t&  j S~ g hݤj 5|'&Vjj  P2 Z~<9u6j  j Vhje[^]UWVS]ujh.5|'| 1D'hjhEh'jj jhx'5h'o} t@t PFXd'f=(&tjURP<} P j[ _XjPEU^111ɉMKy!SVEZ=D'MuCPE=D')uf= )&tm[ƃT )& ufuE 6 u, fu'f=l(&tj ^EEu ft EPY} tf= )&0f=|(&tGWhxXZf=(&18'5(&& XjEP5d'{ =8'=D't j X,=0'#E (&9ujˡ X< tf= )&uj Y} u*jOƉSyujBf=|(&u>E tPE Z+u}f= )&t WVhWVh jhx'5t'z h 'jj" e[^_]hX UWVSEhVhF 'jh.5|'y jjljjch'jj (jhx'5h'mz &uà yhX11ft#jMƉXP/ Y~G9uAj5d' jC jjjjV Vh/jf=|(&tjWM)RPhAejhx'5t'x h 'jj jjn jjbXZe[^_]UWVSE[hVh 4jh.5|'=x jjjjh'jj= (jhx'5h'y sà yhX11st#j`LƉXP- Y~T9uNj5d'触 j5d'蚦 jѝ jjmjjd$VVh/)jf=|(&tjK)RPhAjhx'5t'@w h 'jjR jj jjXZe[^_]US,]S5d'ͯhup 'u M e 'Sj5d'ۿ h 'jjͿ ]US,]S5d'_huEu %ESj5d'{ ]UShShK S'E'&[tE'&jh5|'u U(&tU(&5(&t5(&5(&t5(&f=\(&t_(&t$(&f=(&thhuY%)&t%)&,)&'5)&t5)&jZE)&t$E)&f=L)&thhX]Ujh{t 5d'zjT jhzt 5d'aUS]Q1usjPLv XZ]US]CStu RZYt1]UVSEhZPZYtP譣 ^yhpH[PhehP荣 ƅul(&uRv $v XEy Zu $u 1ɉ $PhSS3 ju*h(GXu Xu X1u $h 'Zt à ju XP!) Y9u tthp&hmXZ'Y='LjP萃 XYd'tP=l Yd'!URPӢXZ='uM@EPj5d' jh t 5d'; jjYX1}UWVSS]='uh-Yu hj hZt8/t PXx&&|&&Sht&&EPƃ 1=l't6l'X'<','10'=8'u'8'%;/u%l'jSY_t4't t u!hShXZ h_j躵&&9u QRP &&Euڃ=8'u h8'h{P @u 8'%h4'hu @u 4'=0'y150'=l'u\)j:hJu 1҅‰0'l'uShM"t%=X'uX'=P'u Shej1 j:h~u '=,'u3X't0'tR5l'ZY,'<'j:hНu' t (&j:hWu t (&j:hu t L'&j:h3uǿ t1L'&j:hVu調 t \(&j:h~u芿 t l(&j:h@"uj t |(&j:huJ t1|(&j:h&au- t (&j:h Vu  t1(&j:hu t  )&j:h~uо t )&j:hu谾 t'j:h-Cu蓾 t L)&='u 'h&&=$'u $'`&&('t Ph2|^_ 't Ph)fY['t Ph7PXZ't Ph:_Xh'hu @u15'h 'h'u @u1ۉ 'h'h}ue @u ' l''''tj,SrZYt@l''؍e[^_]USdPhhp&ĺShhp&贺jkU=t'tht'htj蔰 j:U Đ&yh&UZuj&P&=0'҃ !Ujj蘿<'hrp jh' Uh 'jj贬 Uh'jj螬 U E E1ɉ <'h?j,EXZjjEYXuhXZh'X YtnE sujYXujվXZ=<'uXE M9Hh&(ZtU < tU EE9sE @E Đ&xˡ&P&UE Mtt @8u1]UWVSu`'`'FVtI)~@t8u\Q ^@P u f^?봈@`'[^_]UEP^vP'^?<tP@Q'R' P'Q'P']UVSEPh\XZ@$&;t[Ct =T'uG'&PPh)sC <Ƀ*PZVQPh 렍e[^]UVS,u]S5d'VSDn VSMn EԀ€Uԃ='t̃Ef=L)&tMẼeewfEf=(&t %‰USj5d'ȩ e[^]UVSuU ]=0'tSRV` y@19t `' @]8u hEe[^]4e[^]UVSP'&EÉT'@$&t68u-Fu#EPPh虳SV1%tك 8]tjEP5d' Íe[^]UVS<)&t8u#L'tP[u]L'<)&Y<)&hcS^Zu0'10'hc5SžZY…t[hS貾Y^tVhlS衾^ZtNhzS萾ZYtShhp&fhp&41Ҿ11Ҿ 1Ɋ%&1 !`'Aue[^]Uf=\(&t'tP胫Xj襫Ujhx'5l'f^ jhx'5p'T_ UWVSjW5p'/_ ފ< uf=\(&u"0U)څ~CCjW5p'^ ǡ'tPܪ_9u1ۉ\(&ƅy0hV萴'ZYu ƅnƅy\(&jP5l'] e[^_]1f=L'&L'&UWVSjj"jjhqj hqjx'fDžd'fDž 1ۉjjP ^ ~Ft=jhx'5x'] ~$x'!S 9X<uY8C L{ t VW#ZYtAEPuWYVXC Zu h7 Xc9s ts tC Ke[^_]UVSá'H!vd3V芵Y''Swt^' &H &x&&P& 'P'"~;0&}h&j XZf{ u<@' &H &y;0&|&P&!h&j!蠲^X3hY[{Vh'C ^ZtaP;'s VhҬ>VhŬ'C Y[t'PPI'$h蒬 ='"~1'hr Ze[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]hңSf^_ug@'&; CteE0ƅUB@tUQM@Y9MU~ 0QRh!hp&4ÃUhp&j 1XZe[^_]UBOPPPhuhp&w't@th'Xj臜uUhuh. hqh̗'UWVSSt ÉֺL0 "hh. hh۫u :u!USPmZYUu='e[^_]VSh `jUEuhh. hhn@0h1UEuhh. hh8@0h謸1UEuhh. hh@0h v1UMuhh<0 jThϪ11f3A@=uUVSEu ]uhh00 j`uhh00 jah聪t0ffPh<fPh(fe[^]Åt$1ɀ8u"UJRPRP<# 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(40 ZYt4G (uhɶhYhhp&ˢ 0 E24݀0 h^Rhp&蟢C uhp&j 袹_X<sR@8t54Vu @W>$WV VEP MU1e#sj@HEP͙ susuh)uh5uhBuhMuhXU$19ń0 t@ uRhp 4ŀ0 hdŞ[^}tEPh|诞ZYh0)uuh2X,01e[^_]UWVS]uhhp0 h{uhhp0 hhL11{ uhhp0 hWVhPsP u s h =ts h-uZY1=߶xt uh@Xʍuu-WVhPsO us hF노"=thPs hSٳ^e[^_]UWVSSljUQ^t#u uSuWO Ãu VDZHWJ u uSVWO 9uSuV u V XV벉؍e[^_]UWVS@]uhh`0 h8C@uhh`0 h9hj{ uhh`0 h:߃uhh`0 h;ŋuhh`0 h<뤋1ɿ 9lj}Ph99|CƁ t!Ph4 1jjh V3N = tS h fUtts hs"_X1jjPM 9u 9t-uRh YPRh? tu@ku hMu hm󥍵ѶxԶx9t PRh`3ZYGLZڋe[^_]UWVS։ˍ1ffDžfCf|[^_]UWVS 1DžOmf@*&{K1fDžfsh蒍_Xth CH$0 fthh^j[YFt VhtXZuh,fvCfHfw 1 PPPRh舌j 蟋X)&f\~R1fDžfvh[_FH$0 -fufvfthh蹋YXKCS &19}k<Dyt+@h,l_09uj x[hDY1C9}Ë8Phh$GXZދQhu XZ뛍e[^_]UWVSfΐ&fuD'\h*Rt荖[_~tuΐ&fp=d'tTjjR8 à xTxPSooZY@u S8 X9E%=tIS8 6ha !jjR7 à y6h ^XH'mD'y h\=&&f=@'u8=L'tL'=@'uL'@'@'5L'5@'S6 ƒ 1Rpȉt@'PW5 ymh)jQQ xPWAnZYjE=\L'RRt@'YtaRhx蚟XZ2tp)Z4t5D'hf H'ZYΐ&ft9tS 7 X>e[^_]Ë &Q &y ;0&|< t&J &Uh&PɍZYU44PPhhp&j蟁'W|$wUWSˉ1҉'M]m hh}fU fUm]mURp pSQh-&0hhp&n$e[_]g_UWVS]E }܍p(}p4EPS Y^tShXZe[^_]UWVSPu} FM% FVFt5RPWl8 à tF_1ۃ8t/h-&h[XRPh-&s7 à tŁftvW48 ZYt#/vh-&_7 ZYu}u2}u$h-&h$Y[}te='u\VlU諙1҉UtRW7 ZY@uT菙8-tRh-&\8 ZY@u"~lth-&h[XuVh-&VZYt؍e[^_]UWVS'dt2h-&h-&Ep 6 d h-&!jjEp3 ` @Euph_X-xP='t ' 't 5't2} F='u:xPh-&/[^@} 1ۃ='h-&hhp&虇Đ&HĐ& yh&aY&P&0 t+@t( Đ&y h&/Z&P&Ѓ߃Yt`2 _(,h-&hJ!`2 DždWxPh-&[^@t1E%=tEjhGPhh-&h1 à uA 5'uh-&hkh-&mGPhh-&'1 ÃtNjOGXW\X\t;X\E@hDžl-&X\ptX \TX9и\T<0XPjj`jjPjU2TjwXPXJ X1ɉX\vRLP)TPS. L9th-&hXZDžd:)։1X\='tX\hoPTY^EphkXZ='Džd1X\t~hh'`. ƃ ~KVh'S- 9th-&뎉X\='tX\htP`/ XX='u`s/ XM='t#S`E Y^th-&h|XZ`9/ ^du S)/ [z'dtSWLZYd='um} tgG t^'9GuTxPS^eY^th-&hXZDžd$E9Gu'#G%PS1 Y^uS. Zth-&h[^Džd='tWh-&9ZYde[^_]UVS]hVs, u sh:'Ƅ} t'h-&9Zth-&hG [^.h-&V. ZYtVhR١'t jsPZYe[^]US]} th-&Zt h-&hGsh-&"/ ZYth-&h^ZY't1E ]]i]US]} th-&^Zt h-&hG$s$s sh-&W th-&hi ZY't1E ]]]U+*PPhshp&߀jwU *PPhhp&迀jvwUWVS|Ӊ΃=(u\P=(tR|Y_u%=@u"|h.XZt#h|Vw =vQZVS]Y_u%=@t=(u^VS_ZuQ%=@u?VO ^uL?XPSh*hS{=΃=(=(|8/uVP,ZYti|hUhSWvWL t=|Ph*hWzVWt|h_XVS6ZY=(S|Ӈ^_uS|h蒒 j/|W_ ZY|tpj/S@_ Y_xt@xxVq_Zt=(|)~=(ix)؉t=9|u fDž.Nj|ƄPRZYkx9Íu fDž.׉ދt󤋅tƄxPRT^_|9;x9 ;p=(h&VShhp&}Đ&HĐ&yFh&t_H=(=(uS|S) ZY=(u&P&0t- t( Đ&y h&_tY&P&΃߃Ythp&h  =(t%=@uSR S$Zu4=(C1=( PSj|j) tS=(u1#|(PShx޸e[^_]UE TET]鬄UE MQTU TE]鑄UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]![^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]霃[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_][^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]镂[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_][^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]鎁[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]3Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]ڀZ[^_]USU EAHtRSHtG t uF u:] M[]9t=T(uyDutJt] M[]%(1 []UWVS(UL( X( $(01d@DHLP4TX\x|hlEE8jj h SQj]Sg @u hjh- ShVeXZ=5(FډWVRP =\(tRPQe e[^_]Ë &Q &y ;0&| t&J &Uh&PPjXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPX(tvv Rh)dÃ=$(=`(tBjj hv\vXjUR @Uu hj+ RWhcà L (AF`VdEUQRuu =\(tRPWQcÃ<( 8(Et*=H(tU]Ã=(u=(tF%=@u FaÉ؍e[^_]W|$wUWVSEUEP,X EZuEEC u=,(tECu}EUE؉U܋=(} (ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut'C  CtNV [[^]UWVS(]j((X=(uEԃ}Eԋ@ ẼM AqP=X(tvv s hva=$(F`VdẺUЃ=`(tBjj h RPj}W( @u hj)) Wsha K (AEUЉMMuuRP {=\(tRPWQ`EPv| Eԋxvs$EPh`=d(u7s,h` wshp` =h(twshAT` F%= u9N % 1RPs4%1RPs0h`dVXN\=`(t3jj hQRj}W @Ws(h_ "{(=\(tQRWP_=t(tF(V,= (tF@VDF4V8[<( 8(Et"=H(tMUF=(u=(t@uZF%=uE@ Eԋ@ 뗋,1& ZSh0j@$1&(8[)Ht u hjh jܛXZe[^]Ã=|(<=(1&/UWV5&wh?j薛XZ=((u6~OfEEEPhm501&> y(~uz1=(]xl15(5h(~SuOjjj501&j>xFjWVRP3 )WV501&?>x(1&"1ɉ (=(1& hnhj蓚XZ1e^_]ÃUWVSPE1҉P1;EE (1&(jjj501&=Ɖ׃xtEU =(uX(] \(9É}EjRP501&\=y%Wh0jК(1& )}W =(t1e[^_]ÍL$qUWVQ1y(1&I(u9h9jjj501&<y(Wh10j (1&)y11҃=,1&~h^ZjRP501&I<Vh~x(19}oMQRPWV U Uthj茘XZjfEEEPhm501&; yu5VVh0jC'(1&1eY^_]aUWVS&=5&tp&P[+5ȭ(=̭(X u1=8[)=5&Oh WV5d(5`(V RPVhhW@5d(5`(hhV@0WVhhV|@}}t^=(tU5(5(hhV?@Vh(h hV#@(V I$Vj =5&ubhT(1WVRPW RPVhhV?V5T(h#hP?0h h(l(`(d(WVRP RPVhhRT?5l(5h(hhtW2?05d(5`(hhV ?RWV5T(,1&HP8[)0h4hP>8}uV5Z)h#SB%VG$VjE }*e[^_]Ã=01&y1T(((UP[) Z)t@=(u7=Z)t Z)5Z)he5Z)7B5Z)=ܭ(tGh(501&T$ZYu1(%=u \( X(u5ԭ(1ܭ(X=5&w= [)t 1&~ jP YX501&] 1&Z~jURP [) Z)t.=(u%5Z)hrb' 1Z)5Z)0 01&( (u 1T(1((=8[)t,1&[) Z)t̃=Z)tZ)J1Z)=8[)tg5Z)hIZYuQ`(d( tjhRP% jh5l(5h( RPh5Z)@j5Z)F1T(ZYUVS ShZ)j yPh0jݓ jSj yPh0j豓 5|(=$1&B 5(6=[)u5Z)h[Xԭ(hD1&SHZYjh<1&SHZYU(C,1&uPSh覑h5PShZ蓑h{艑5&whhh[5Z)hWhMhCh@9h SRxhhbSGZYu5|((1&5Z)hc1Z)[^|tFu=y밉؋]U((=5&u>|(t5=~~ h~Ph/thPh]jy@5ԭ(Zx%x((((1`(d(1 y((T1&~x(~UWVSZ)t hjfx(=|(T1&u|( yI(+(EU EUT1&EEuuuud u})׋E9ƉM}u}WVMZY+u}( T1&19}d( ((;(s5x(PY_(+(RP_Zxh(Ɖ5(T1&( ((T1&x(EU)`(d(1ɉ h( l(z5&hjwXZ؍e[^_]Ã=P1&US=5&uhjvXZyx1ۉ`(d(15T1&5(ZY~%((‰(`(d(1+P1&~C9}Ph#jTv yu뙋]ÃUWVuM ()ȣ(^_]UWVS$]CDž$$ x$|$x $=[)u15xPu ^_y狳_3Vh@0jmvPuZYud%3hI0j(vۉ15T1&5(u ƒ (9|Ru -WQQRu<9uUy%82Vhq0j@u79|$u9x$t hjtZPu ZYy1Vh0jtNjE49}u;0th뗋9}3t)1;x$|$}Ru ye[^_]Ã=(t1US5T1&5(ZY~'((‰(`(d(=u.=8[)u(1$x1`(d(Z)]ÍL$qUWVSQ Q1ɉMM u15(=()9}Ή5()ډ tƋx(]؉}܍MQWSRP Ɖ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}`(d(19<(+(щ9|gx t%u؉}9}M؉]܋E(+u}뢸eY[^_]aUWVSU Ӆ~H(+(U U  )څ$ 9~؋5(}5()É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu PY[u]%.dhI0jqۉtE1҉P`1h9Ɖl  (+ ( } ^ș9hl}hdSpPtPQ5(u O]hlS} yE] Cpt1;x$|$5(=Z)0\t`A9\u\()hl} xdptZ;x$|$}L pN;x$|$#Vh0jLf=Y)tY)sVhP$T${Yyi"8=Z)u<$8$V y5Z)$h'Wje1Y)$G1҉$Pe[^_]UWVSĀlj։ˍxPQZY=([)t1|9Nu*;xu"F M9Nu;EuWh8j0d BE%=@u8hhbSlZYt'S YyT!ShV0jdjS)XZy-}tӸR!tvvS uSW蠾 ZYu1}tuSWhgRjxd둍e[^_]UWVS|]($1u(x$|$9ȉ}$9$U  xWV諏YZ@t$E%=@uVhjb KjAZe[^_]UE$tH $E] ]UWVS]E U$usPr YyI Vh0jWc=Z)u($=Z)t8k<$8$V =Z)($ttC($5($=Y)u(j Y)P Y)XZ($Y)!%PVY_5& 5&t%jjL$H$X$T$V$tG{WVͻ YZyCWVh0jPbVU$*D1$Y)Ze[^_]UWVS]Ct1$H%#($Njt1lp$H$3 5Z)hZY=[)xPV2ZYum%=u[hRV( u/6tVh0j>ap#ƄWVZYp` `D$@$WV :WV蚺 VhV P裹 ZYVh"j_ U{lt lt)w$V#pZYxDžl=Z)tVh'RjD`뒉l<$8$VO lxDžl0=Z)u =Z)tCi<$8$Vy =Z)t#($tA$u($(($$u ($.($($tbYX$5Z)hYZjV>YZxPV׊YZy+ thH0j_WV@1$H%# PVXZ=Z)u ($jZ) 5& 5&t[j $P3VA=5&u =5&t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSu;u h`E18}t}t:|[)t[)E|[)6SVu譽 9Lu h~ix[)p[)Ex[)ҍCtPR;XY P6Yuhpj%\XZ>CPVЉUP EU 0j\̍<+E e[^_]UVSu] }u1NjjjV"y ShjhY)Vq yfSh~0jt\e[^]UVS]u x@PR X=[)t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu 襲 ~ pt1@9uNjt9|$up9x$thjsZ xPu ZYy$Sh@OT$9X$u;t hjjju ty$Sh0jZp1$1e[^_]USY)tP 1ۉY)Y)XY)um1 Đ&yh&Yu9&P&94&uu%1S Y) t뭅u tډӡY)AY)uY) @Y)tϋY)zyP1ZO밣Y)j5Y)hY) Y) &1]U=[)Y)=[)tY)=Z)t Y)@=Y)u'h 2Y)YuhjjXXZ1x[)t9UVSut>uh,j 2XuhGjXY[FV/ ZH~ 8/u3E ؉C1C=Y)uY)Y)XY)1e[^]áY)t@= [)t Y)=[)u4=0[)t+UE$uY)tjP5Y)ҥ US=[)t8Y)1t6{u+uhnj(WXZ3h9hp&\ [Ƌ]UWVS]=Y)u =Y)u$15Y)yx5Y) Y)YtHHQf $3 =[)tȋ@PURURpp p0;9xjjuuuu졸Y)pphj6Vphhp jW Rphp p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=[)L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPj y$Y)pwVh0jUƄ  ǃ$h Y)pCPTh Y)rP25Z)h}  t1Y)@8e[^_]W|$wUWVS<ÉUMMQEPbu}j 9ƉЍM}QhQh)j@S©ue[^_]g_UWVS\]uCE=[)uPh9V ue[^_]f}W($胸 T$X$E(j8$N Ej<$9 UuuPjRj4$Wh5V$ w'@$  R%PhG|$x$hRVuEPh(V$Pw ShYu ShYV Vj ZYVGXe[^_]UWVST]}T$X$uV($9 SWVhaaQe[^_]UWVS]u fVfuPZt%t0SRjP}WF VW莉 Cۉu ]e[^_]v e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=[)!u%U[)hjjMXZ1ø1UWVSSu] E}MM1҉91=Y)u0K Y)Y)9-u BY) &=Y)u" Y)QY)u Y)Y)1Ҁ=Y)t7tMM}E] ue[^_] E] ue[^_]p UWPZYtU:u W3h(x:u9&9}91@&W3hhp&?e[^_]1UE E EE]W|$wUWVSjEPS Ɖ׃EU E9Es 11M9ttuj,VZY…tUj=VY_DžUuhUj G%ZUuhjJS- juZ) Z)BZ)1Z)Boe[^_]UWVSQÍEPS@b ^_u C #ƋE| t@E]S$ZuZ)1 KDe[^_]Uhp&h)! j5&t 9tU5&Uhp&h hp&h]܁ hp&h4́ hp&h.辁 jUWVSPuh\S$8 ZYh\S_ZÊEhViYXuAVh0jOJ }t/1e[^_]UWVSlj/E 00 ^_Z)t@E Z)hP Y[dZ)Z)[)111҉U11Ejh`1&h>u uKzX$4 91|(591hd |(렸1P1&덡918-uxu1ԭ(Ejԭ([[)QЭ((B([)3Z)$15&=5&u.>|1Z)Z)=Z)u Z)Z)5&c [)T591=Y1[)o,[)` 5&GЭ(8Y)91Z)#[)EH9~2MxPVN&XZMuhjFjEƋ91Z)PMЭ(1Z)[)Z)591EЭ(gfԭ(5&Wԭ(5&Hԭ(5&9ԭ(5&*ԭ(5&ԭ(5& 5&91Э(Z)1x5&1ɉ [)591"DZ40[)|Z)&E <5&umu}t Z)p&Z)&Hw69Uu }uj@ ؃kL4&8[)Z)nt HuZ)1ɉM`hljDhP[ZhSZYGZ)Y)}tE^Mth*uZYE&t*hށuEZYuuhj D1E1EE^E}tES&[huZYuY)u&XEjhu$ u@Y)t EtSS&[EP荘u<&XZ1ɉMEHjSu E&EE]}t EtS%[h*uEZYt u[=Z)nu2j5Z)S dE>GEtZ)>}15Z)jP$Y[yRFEMhSZY;GCjP[^u}uhPO[Z_uh*S)Y^&uS(…u_h*SZYtVz^=Z)tShzFtjP8ZYy*hށSXZuSBhRUZYt8jhUR UujjRZYMpjP؃jSu1ɉ P1&}Jԭ(t 88hfC1ԭ(Zt 8ԭ( Z)11jh`4&hu u' z$5 14&ă뿃91|(591h4[)0[)x91ԭ(f,[) TЭ((E([)@3$[)΀ [) 9191hp&h" v 54&h=hp&8 5,5&h=hp& hp&hu Э(0[)91Éѣp(t(19| 591h=%thhTjV=X [)91Shc{ZYuP1& SH P1&Yyhzj591Z\@D[)/[)Phj<j(1ۉ[)591Y591*ZZ) Z)@|Z)gZ)U1x5&IZ):91Э(+Э([) x& hp&j Y[{%E1 u15&Z)&nEE u5& Ge%1ɉÁ u5& 095 u 5&܋E5 _5&.1 t\5Z)hhp& 1 AI!7 PhWšp&Pp& 5&uu8[),5&v/t1jj} 4 &&9Em&9Ehj9ME MZ)PZy$jj} 4g^_'&&;E|1ۉP1&e[^_]áZ)t PZ)Ã=Z)t[U8[)0h>jN9 tp0hmhp&u5Z)htZYu1UWVSM11JqX?tCt*tK[t~=0[)ttjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puhj7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 5Z)h6[_Vh-6h]|6hr6h W6hNW#ZYuhW[= u h&6Y덊uh6ZX<.uuh5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDhEj3|tHL@t<uDhhhp& WDh~hp&t@th WD20 1e[^_]UWVS]t K΄u h4<\u FFu8uj4 Xuhj2^_DžoGjQP; t2hVP SVhjd2 WB[띍V֊t\uF8t)F> WSh j2YR9Zu% Whj1$N1GtYuh> jn XuhS j0[^C31CVZC 1ɉKECE C=Z)uZ)Z)XZ)1e[^]USZ)1t6Cu+uh j0XZ3h9hp& [Ƌ]UWVSuZ)t$tS= [)u S1u=0[)uSu$t9utZ)}FP%Yuh j/C_Zt/1srCt/1ɉK;WZC Hǀ?/uC C$c‹@t 9uBSSb1ɉ$[:h ja/XZe[^_]UVSu1ɉ$Z)u,= [)u1=4[){C |/t[t0CuPFP3 KVPZuɡ4[)u '$tVZYx 1$e[^]UWVS]=x5&tjs{.u{.u Ct:u h j/V, [_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh j& TE@j Xuh j&Y[0t;u GM1GtAt0yVhZ &O}thE8t`W yuhv j%WbGƒWt+G 9OG}Vuh j%W1G=H[)u=H[)D[)x=D[)1 h e[^_]UWVSM=`[)tPÉֹ=1:t9pt@9u9U}tjhZUuh j$[^1p1ɉH xe[^_]Ã=l[)u1Ujh Fl[)YZt1h j$XZ1UWVS}l[)$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uj\YtGGPyZt0 $$$CSEC ECECEC1vSYh6 j#XZ\Uh 3 P 1$$CHCUwC35S/[^e[^_]UWVSMl[)4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3X]e[^_]ye[^_]UWVSS=l[)t51ۋ4t#1ɉ v0ECEP:XZuC u͍e[^_]Ã=h[)UWVjhGh[)_ZuhT j"Y^C =Z)5Z)Q5&Z@u"5Z)Vh 0j"5Z)X1e^_]1Ã=d[)u1Ujhd[)YZt1h jp!XZ1Ã=`[)u1Ujh=`[)YZt1h j3!XZ1UE$$ $]UWVS(}=`[)$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAjAX11q $$$AQ C AK 1St$P[)T[)P[)T[) u+P[)T[)M!u!9u^9uZtLP[)5T[) t:UjZt+UM܉HUPp K HC $$$3GPhjhPj$P @ $$$E؉,$Eԉ0$1e[^_]Ã=\[)u1Ujh=,\[)YZt1hjXZ1Ã=\[)tDUVS1\[)0tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ \[)=1Et#؋M9Hu9p u M9Hu9xt@$uj( X҉UtMurUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!R=XE Ee[^_];e[^_]UWVSEEE EM}\[)tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3SXZ1e[^_]1UWVS]}E=Y)t";/tPSd ^ZuShj$YuShj. hSQqZuShj ue[^_]GFG4W8F VG(W,FVGlFF X[)F5X[)e[^_]USX[)tvCX[)=Z)u{ t s3hXZ5& 5&tjjssss 3輲=|5&t s3YX3,S&X[)XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=h[)FhGSPl <9tjww 55&н;Wu;G t /h8*SR55&+{ 9؍thP0j SR yT$X$G9__W1j&Xjjj55&G WxNS55&z 9u)T$X$GWh[)W84hh (h0j7 WXhj#ZYe[^_]UWVSQd[)uhjXZohu u Eޅt6uY_tcvj ^t;umƉYt#umGZt _E81QV\XWU_hja[^0^SuZYtS)uhmF_Zuhe[^_]UWVSu} d[)t=h7V t&3VHZYuusVۼ [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=&ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh8h S"SyEVh@h SSy=VhKh S߾SyVhYh S迾Sce[^_]USSˋ t%RQP]E3:1U1ɉ EeveRu P, ]URPhdjUjhoø1҃=[)t1UME1҉[)1Ҁ<u=Bu} u,J=[)t[)1҃8]UVS]} ~;uqjhP u%=5&u 5&hj0ZY15&jjPƺ 9؍e[^]UVSiÅ3hV-ZY[uh8SZYt)SVhjh8hhj 5&vSVh+jt[)o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVht[)|[) x Rhp[)x[) U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$08 =[)t_hQj hzhhŃ d~ Ph뮋p3Sc~Rh땹1jdRP1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEP譴jj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 th$%$1$Z)  Z)t54Z)=8Z) T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh4e[^_]11UWVS}} ?jhV ÅulhYVY^¡[) [) u[)haj XZjjPƺ 9tPVhj ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPWPz/@E K<vM E)Sht[)|[)} Rhp[)x[) } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)Px yjjCtP͹<$ ƃ(8$P PB ZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2 ډe[^]wUWVSu>-u~t2hށV躮_Xu$پ0PVhbj[&1EPS ZYt/G}vEVWhujEUt&u1 SfXe[^_]á[)t UU RuP5[)xUVS]u F5[)tRPS tD3j S~ZYu1e[^]US]}t Z)Z) [)t=Z)thp&j & 1Z)ZY5Z)h?hp&Su hp&hp&j ]USjhQW Y[xEhFPD[)YZt&hށS.[)YZt135[)ZS(X X=,[)thQhj ]UVS] u}t Z)Z) [)t=Z)th&j ) 1ɉ Z)XZ5Z)h?hp&Vuhp&~S%Phhp&ǫhp&j XZe[^]UTPhhp&藫jN[)UTPhhp&qj(UWVSƋ=[)tPhhp&E =[)u ЉˋQtjP豭YZt藻8tɍEPsb XZ=[)tVhž ^Xjs js g} uVWPREPh3hp&蔪hp&_Đ&HĐ&[yh&QY&P&؃t- t( Đ&y h&Z&P&΃1Ylje[^_]UWVSAօu9VP;)ZYt&[)h'^_F%=t1jhgT @txP蹋Y[|x^9|u,;u(^9u;F u%=t边/@T Zjjj  ׉NX^\19ȉ}{ 9}Dž 1P R 9y+{Q oS ZCjjjE ' NX^\19ȉ}{ 9}Dž 1Pu,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^\)e[^_]U5\)PhYUWVSQ5Di)|\)Di)PwÉ5Di)^=F7&t yuKt;u蜭1҉jEPSiƉ胭 8uE8t+n8t`"E  tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$t9  u !AuEU Ѹt݃} uWVuu/@ WVuuA &MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=\)%us Љ UUEU=\)&t wE\)\)S1 VVڋExYtEUe[^_]UWVS(Ɖӡ\)\)EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh(j]S艕jSuk e[^_]US7=\))u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HI\)\)SuЉE뭃$9 "tFكPE4EȉU̸=\)#4EEЍpًt(SEȉŨwhf\)SEȉUYEȉŨw><\)ƒ}'u1EURPh(juVjV3EУ\)\)\)S]U]\)\)SWڋEXY E1ۉ]\)\)SWڋE ЉE҉UXs}t V\)\)˃'u1ӉMȉ]SQh(j]S jS5\) 똋M̋EȋEċ}eʍe[^_]g_W|$wUWVSEUϋE܋sá\)\)EUVU)\)Kvu^*9 89 |u0VQ{\)YYuRPUMY_Kw9 9M~ ߉EUce[^_]g_UWVS}USƉ׋ \)AZwSjƉXZ=\)uJE졄\)\)MQ1  SUEY 1ۅÉ!1e[^_]UWVS}USNƉX=\)uJ=E졄\)\)MQ  SUE X1 1e[^_]ÍL$qUWVSQ q}WP5\)XjLP2fZYt5xIu,xNu&1҉Uj PfZYUtB@)։5\)@뽉\)\)m1=\)t !EЉUWiEЋUԍeY[^_]aUWVSRE} _6&6&@c)@c)HO;t(@c)sx&PP ωʋ7@c)tx BM$P M҅xJ H+ 6&QX5Di)SƉRPhH1 e[^_]Ë\)Ѕt /tt@1ɉ \)HUS]u1Z;/uPhhbZY@tEPSZY@tҋU9u;Eu3E3U ]UWVS}V2VP^ tS\)Y]e[^_]鸟S貟Z8"u뺅u0Ph= e[^_]UVSu=\)uE=5&t.1҉5&hT9wPYZtSf\)Xue[^]3e[^]UVSud5t =\)\)tPGY\)@\)\)\)1\)jR\)H\)Zu\)tG =\)t,j5\)hQ)j5\)hTjhT[^1V@$誝\)VP 6&6&@c) >/t[5\)>t'@c)H@c)FxFC7XVԀ~/u#@c)KhNV谙ZYu$6&9r :ƅuh@c)K;/u>thhbVvZYt @c)x/4X/ 负XV>t@c)H@c)FxފFC96&u @c)x/C tX/=@c)u`@c)\)@\)\)tPaX\)\)56& \)j5\)hQsj5\)hTa\)H\)u \)u@e[^]UWVS} ]\)@\)ug Yy \)u\)tuj;ơ\)H\)Zu\)tut hX Y4u1-=6&u =V7&t5\)h9XZuÍe[^_]UWVS6&hƅdh谳Yt ^t>h\dWGZYEthW3ZYEuEE1}}FHπ\ut}tnxP0tB<wV$9 NE1>: 6 2 . * &щǍ@0w\9Eu}7&HyP7&H X JF>/7&HyPh7&H X J }u-7&HyP-7&H [ J 57&7&fBYtfBhHj(1e[^_]UWVS]u }7&t7&9tx u h7&dX\)\)uu1Ph?h7& \)t\)Ph?h7& t&WVh7& x0hSh7&ZYxS Phh7&7&HyP7&H X J E7&e[^_]e[^_]U塸\)uhU\)jPy UU 1\)\)@\)tuRj u\)t \)U1\)EEEEjEPj0 =8c)t=6&tjQjj&jU U=])u ])E Puj:UEPu u(UE])jUS]Su 0uUؖuu 0uUEPu juUuu j}uUS] 膖Su0^ ]Uku u0A UE Puj+ Uu uj UM@: ft9uPU t@Qh4j h\)_\)á\)UWVSP#^ YuOƋjjPx0 ǃ t 30 ;ZC jjPR0 ǃ t s0 {Xe[^_]UShYhe)8tN6&7&蚠\)thB sXZi)XjjSP5he)$j1]W|$wUWVS ƉӃ=\)uj'k<\)X \)1ƉU1}m M1EmPP$hjS;6u{0ujhFS{F S赈ZÀ{0u K{.te[^_]g_1\)\)\)\)US]tvUUt[F~#CtVj RPXjEpSD:~5j Rs jXE@C us YCX C @C[놋]Ã=\)USQjj]Sjjh$6&)@tBEP \)Zt,jjSPjh$6&@t\)PATH@=5\)3\)6&X\)]á\)US ]t6;u1Ct*p˫Zti)PjEPCp(]UWVS }W1t@\)B\)PWKsE_XZsnEX;t.Ey"xVw- YR0Ph1Psux ua \)u\)t[~5jVXZ}xu- ju} jssYX}yjs_XZxV, ^uu, Yu u}Z uqX1\) \)u\)te[^_]UWVS}u 7&tu u1\)1E܍]SXZ$0; uwYX=7&m=\)%jw~XZ=7&K\) \)4jwNYX=7&=\)=\)=f)tVW VW=Sz =f)tVW=f)tzjwXZ=7&=\)u=\)uSZU ?1=\))=f)tuW =f)tuWS趌 =f)tuWfك=f)twww,1ɉ \)jwXZ1=\)\)jwY_=\)tr\)f=f)tKW,SXZTjVW S6Rhh7&"SȋS轋Y S贋f1S Xf)ta=6&t\)t tPtj=e[^_]UWVSE ǃE܍uV 5Di)ju_1j4Y=7&tKt>=7&u5tUYUt E܃PuRcXZ=\)u V؊X_V-Zu1\)tje[^_]UWVSWE} _6&6&@c)@c)HO;t(@c)sx& P ωʋ7@c)tx BMP M҅xJ ċH+ 6&Qو^\)PS}ZY1\)\)e[^_]UVS]\)1js&XZ=7&=\)tT\)u\)H\)x1\)뼃u \)Q\) 1ɉ \)MwE5\)=\); ut-t)E Ps5\)XZ=\)Ro \)5\)e[^]UWVSu=\)=7&u1EP薈E؉E܋^Yt$hPS#P =\)b[E؋E1҉\)]؅6FDi)=7&Pi)PۧP h8Kv 7&xWPyP7&H =_ J=s7&xWPYyP7&H X J 57&_jsv E Pv =\)=7&uJ\)t:u\)H\)-1ɉ \)Hu \)H\)1҉\) \)=\)EP蝇Xe[^_]UWVS]uVE؉E܋S Di)jPspN[=\){tuGDi)EpWSZYtV1=\)uZ=7&uQSC ; tDi)u P \)[_.[Di)u P\)ZYu뇋[g1\)V蹆Xe[^_]UWVS]} 31EsZ=7&{5Di)i)PwPhStj RU57&UR hXu hrX7&HyP37&H X J 57&X\)@\)ujShuSPEv~trtu;huu \)u\)t3jsoWsj\)H\)u~\)tunUu;Rh1ɉ \)\)H\)[\)e[^_]Rs\)\)H\)Zu\)t tJ=7&tA{t;5Di)i)P跣Ph7&Ee[^_]je[^_]USD\)EE1EEpX=7&tlExtc5Di)i)P;ZYEP{$o[EXtj S57& [hD[57&XjEP ZYtlE\)\)jXEuKt&:EP$ X57&oXԋEt\)j5\)_ \)@\)Eģ\)j EpCXZ1ɉM \)t5u Ep-Y[\)@\)E\)jnX \)t\)t뻡\)tEt"EP($*X57&Z]UWVS}] 1CCC =7&EP΁\)@\)E^y h2xjWmejWPzu31ɉ \)\)tu jujWu E؉s \)H\)Zu\)tEPāXe[^_]UWVSE 1 i)8@i):-uJt-tuzu8t Dž1ۉ Dž u+1ɉ 7&7&7&7&@Dž0\)$AK,\) 1o8t4o8t*o8 uxPWZY@t oWKlX뀃 h u tCƒv~ ])PSP6h#jUWVSuU F^fftfftdNi)$U jS$PJPxk IU yхtvhXZWkXtkhWXtZhF_MtIh5Sh\)@\)vP$P@c\)H\)tShiY[?\)tQh,Ph PSh~ t-7&HyPy7&H *Z J*7&HyPL7&H X J e[^_]UVSuJ t"8u%uCVPeZYt؍e[^]UVSu@J t8uVPeZYuCݍe[^]US,6&1ҋ ])tHft fux@ |u[]UWVS}\)@\) ])t,Pfu9x fu9=,6&| P肑X҉΍^])t \)u\)t e[^_]e[^_]UWVSSui)X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPh$uZYUt>:uGFC딃=,6&y t ,6&u1҉MRM ,6&Xe[^_]UWVS\)@\) ])t!f{usSPXZٍ݉w])t \)u\)t e[^_]^e[^_]UWVSutA%< ]) ])tCVPBcZYtdߋ} tX\)@\)V^$9fÉ1fCC VCPm \)H\) u\)t=])؍e[^_]US@J tjP)f@SPXZߋ]U塰\)@\)]) P\)H\)Zu\)t(UWVS] j/u*^_t[EtFxPuZYy i8ti8tiffCf1CƋMi)9tMEth#QT Y_tM ju_Zt>HftftfuEEu E u=,6&yƀx u91ETtE,6&tuDYDžDž\DžXDž`juEP` We])Z?/xPWrYZ2E%==])NEWH\Lȉ`+6&$cWbjuƃfx`QWfXZF FfF CfF fCFC,6&f~tF\`9\HPh$qZYtuYDž 5])h,pYZ`9\~8f8kf8]fXKWuh1s\)@\)dTujuY_f~udfF`FDžX t@Et$jXPuh957&of`\)@\)dTujuXZf~udfF~ \).\)!1 e[^_]UWVS$EE111E11EEhF"zEZtPEbw$; 1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEEhe)81 ])tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u57&^7&@hP"[EjWZYt[@ft:,fuu>he)Phe)8ufHu*}"fu}}t˃=,6&x ti)PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZd]uEԉERuIEe[^_]UVSu \)@\)ju!Ë@ZYft&fHu sXfCFC fFC FC \)u\)t e[^](e[^]US ]\)@\)fEEE6&fEu ZEEPSL\)H\) u\)t ]]UjuTZYtfxup)X1UWVS 1ɉM11uhvZt(ptvtVuEEлɋE 8ctu ދM Mt4Pht}t5hrhe):t/1E he):he):|RPh'm? jjV^XZu}jV)XZGfEGEEfGfj/V!ZYEEԡi)}t2EjVEPGEPt]My`uh9XZhe)Phe)0IhIj wI! h*wh9he) 87&HP7&H he)Phe)0YV_8uVP`XZYmIwh wh9J he)Phe)0i)PjEPV1MfHftPh&Y^jV1Q_Zuu haYV`^0謋PhЌ;he)Phe)0 u%h-uhC uhXVh9he)Phe)0_Xt!he)Phe)0E.hu.YEE~uh넋Ee[^_]UWVSEP[])+6&PZ6&XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=V7&t"E u @c)xB p\P}눃=@c)uX\@c)6&8uu@h}XtVZ^E %E1b P)cYuVZZPbX VZXu‹E|}u5F< v@ @c)])y[P])Csu2bG  <w @c)])y[P])8t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:MhV5= ZYEąM9EЀxupx9u"E EEE9s2>uF9utsE"E tdU9UvsԋUE͈@ĉƃEM9MUPyYPEPy EXZt\uuЀ>-utF<]tm/uu}NtFuc=])Uqxvtu@r t@١]);}u5])S[rxRP謽ZYyZ9tt1t9s'@ZxvttE]S@ϡ]);EtP9Uu8/t}G hb\P XE9])t@/Džp>t F1ptJxw@tu@o\)tS Ypu{F/uS Zt߀x .u o.uǍx jWt tptWu8Q 5]) 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu])skY@uP])DVY])u+6&,+6&EEt;t}1ɻN)ЉE=F7&8<@.<*&}tE<VE)HPhf1ۅI~@@c)H@c)Cx])P])S։MPBP])SM뻍G1҅~օ)xu u܋E%PV1ɀ} k])+6&ыE))])]) @c)@} uS-7Z}EtsŠbG  <w2 @c)x])H ])UfAH ])U @c)x])H ])U7AH ])UԈC뇻11EԀƒ v! @c)xM])H ])CuJ @c)x])H ])ĈU@H ])U뫈U@H ])U뫻1111ɋE%Et>@u=le)uM @1 1E @€}E$0< U5])Q8])^_Uzu LuЉU E PuY[ExU^1 @c)])y?P])5])+56&uuuuVuu%])+6&ʉ]))@@c)uZ0uuuVuƒeuXE)Di) Rh}O#uOQVHPRh#u EEEPVE)HPRh襨u9u1ۅu"uԡ])+6&Pu 1Ҁ}t`]uu E]Etq|wt ]) ])׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tE7&j)u j)E])+6&E܀;~uE t u SXZE 1Es‰E<}<@~< T$l< <:<= {s{u{y{@u{=uy1=])}} t @c)])y<P])e s @c)])y<P])Di) @c)])y<P]) s=])t(])+6&M9~xu@c)H]) uE uE 1* @c)])y@<P])҃}u C< w @c)])y<P])S @c)x])H ])U;H ])U tsDi)E#E PVu R])pd])])!V[N @c)x])H ])UV;H ])UۈEE t5Uuu/ZYUtU])+6&jPHP UE {~=u}1Eu V[X< uDi) @c)x])H ])U:H ])UۈEE euuZYP])+6&jPHP 3މe[^_]UWVSEu ]=&7&t1҉])P ])6&])6&@c)1ɉ ]) ])PDi)Sp_Xu&])=@c)u9])@c) @c)])y9P])])+6&P6])])XtAh])W])1҉])])Y_ÀtS5])S+5])@_WjW6x])])Y[&])1҉])tNFe[^_]Ujju56&z@E5UWVS$EPEߋ5])+56&hREС@c)H@c)ZYx])8P])=6&VW]Se6])+6&Pq55Di)W֓EԉUS66&]))Љ])@c)@c) -8])uuh(j5])s])׉Gu}"tj)PV8 ]))O]))=@c)EЍe[^_]UWVS]u =])1}DPS]XZ])=@c)uc7])@c)=])}=6&}t }tA;tWh9h7&zj= EtPV)KShϠjWVX+])=]))@c)e[^_]UWVS]u=])CvdE%PuuXZ])=@c)u{6])@c)=]) 6&}M  t?9s@UVWQM} MUt <CÍY9s1:UVWQM6 MUS9st{u8u@@9r9sS륍Y9rVSQM SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+])]))@c)I9tKCCG+])])@c)x C])4P]) ])@c)e[^_]UVSu]S2F ])6&])6&@c)1])jvW@c)H@c) x])T4P])])+6&P^1ju PES2Ee[^]UWVSuFPhys7&xWP[_yP—7&H Y J19}E 4")ZCWh?7&xWP_YyPd7&H [BJE 4N7&xWPYyP7&H XC9| J1e[^_]Uh ݜUh МUUM 06&t 9PuH]Ë @b)1-06&B t xt 1z1@b) 8b)UWVS}u ]\)@\)06&z tj(/06&J B ZB$B 8b)P@b)Pe[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~Wt.[tW.XY*Ft~uH<-tB<%t<+u:6&6&i`b) `b)\b)E1MxdtS~JH~?u(UFPQM0 YZMUt UQW-YZUu뗅uV}-ZtjV -`b)\b)XJxRt~i90tM΅x29\b)~*i`b)t" +1ۃ} uVPE؍e[^_]UVSh 7X=Xb)tYh9r7&HP 7&H YXSnhe)Z8Phe)xjhe)0Y^u hI褊=P+`b)i5rO@Phk 9DiPhPFXZՋJ ;1e[^]UWVSQ111Uhs6ZUt$jtptguܿպλǍH~hw he)tyt h跉UjPYXUt 1t+`b)i5rO@Pht$Ph4]XZ1tiHi0i0h軄7&BHBCY_y3R X9H 7&z99y9H y:؉؍e[^_]Ã=Xb)u!UjuZYu11áXb)u!\b) `b)Jxu 1øUE=6&t@=8c)t7uR+`b)i5rO@Ph57&范UWVS=Xb)t.5\b)`b)NxtS{X1Xb)\b)`b)J\)B\)uhViPpË\b)`b)i߉_19~i9uFPC^`b)\b)iƄDŽIu\b) \)u$\)tt \)@\)=N7&1ɉfǃPb))؃} ~iE P]Z \)u\)t؍e[^_]UWVSu]=8c)u18c)\)c)S{S`{juj蒶 u$1Pb)}uJ=6&}u-=6&*SjsSjsSjs=7&t u 荴8Wj ^X}u-W56& ZY@u0NIhPhD=SjjsSjbsx}tXb){}uuSjzSjzu }uA߃u2au)j= jh QQ th Qhy贄t =6&ye[^_]US]U M=7&u1t uEM E[]j UWVS}tE1ۉEPu EPǃ uZ8f)t\)@\)`b)E1i\b)M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉]tgu tUP=8c)t =6&u;u uEɃ@ ;u uEuEu7&R \)u\)tÁe[^_]UWVSjjjà ~ jjj=7&tQCtN56&_ ^9t7ܰP56& ZY@u0EhjPhD裁1`b)95\b)|btPu=Xb)u>SX5E t t&tt M ڋE:F떍e[^_]US1h-Zt$ltptZu⻀ۻԻ͡he)u t8t Pho cjo Y[=6&u =V7&u@t4jhe)0‰١7&he)Phe)YZxuS57&?XZ1]UWVS411Eh4,Xt)ntput h!5de)Eƃ}t1E̅u4Xb)E̅trHhe)8uEu=Xb)tO*jjV_ uVhjVY_t Vh =Xb)t}`b) \b)=he)Ix.}t ?u1҉1E؋Eԅju6EZYtxu M؉}tDE؀u8jPsZYÅt j7Vn =6&)uiXE؊u CM؈`he)8tu E؃]ȉ1}ܡ`b)\b)1Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV范 OuA1ɉM܍EPjj @utE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_EԅthPhDz\)@\)SSË\)J\)XYu\)ty؍e[^]UhH&Xhe)US] h)&X]Lb) Xb)uPUS`b)\b)9|:t%uh uLb)X A1Ë]UWVS fE Hb)EDb)E11}uEE@<}%<T~<w=$< )9<=Pހ<'<\FEF1FEv t!5 < t, E0 wE? < tC փ8t "B1tG1}~ unFEf"dt`@6&t ɉ1:GS@6&<}tO~u/SCAE\U$I "O  $F 1E]CMtjBBu] t}t E"M@EEDb)EHb) [^_]UWVS]} =Db)3x$< fjsZYu h<4Xhg[_jshf jsshk n[ hp \^hp Q[Y1벋st7jv3XZ>t hs 'X6jsjs u7{t1hXhXjsh1[(hw js u h<4_hjs { t&u h<4n^h{ cjs T u h<4H[h hUh ,XjsZYu h<4Xh js u h<4Xh h8Ks hjsyh js h Cphs t=jvihdjv U; uh h A_vh s)h sZ 1] %1'1` 1c  W S9tRhyj}W6pWV^w-C yh*P jVj胢 S5Ph qjVjh SWu uÃ؍e[^_]UWVS}t b) =b)dPXi)u i) i)`1\\9b)~jh= `Pà u\b)dP_KP^؀;.8t@x/t@xPSnvZYy1EЉEԋ\ńb)\u94b)E} ])u e1t:t@u=@c)h S/ ^_196&XaX6&5])߉S_k7&xWPYyPj7&H X J EЋUԋ\b)b)\ne[^_]UWVS}uV[1ۡf)te=6&u\ujJY=7&j57&Njh7&"i7&jI=7&uQ1~jIZ=7&u8u{=7&uru=6&t`=6&tWh .jXC+t'=7&u1҃=Lb)‰Lb)jPtY[1V4QZutVyXe[^_]UVSU:\)@\)jR [^y$ \)\)e[^]mjP\)H\)ZYu\)tm=f7&u11.1=7&t 7&1ۀ=7&t 7&jjj =f7&tt7&t7&e[^]e[^]US]\)@\)jS ZYxjP\)H\)ZYt Shy_m\)tljX]Uu}~E pdPeKd1Uu Zu h5!lUu u%ZYu h5!lUVSuVa@$VP ؍e[^]UVSEX96&}]ށ}\)@\)FPb6&P6&56&6&\)H\)Zu\)tk\)@\)56&6&)6& \)u\)tke[^]UEuj hB!j- 6&)6&6&UE6&6&P6&P@c)P Dc)PDc)]US]\)@\)6&9t6&P'XC6&C6&C @c) \)u\)t ]j]UU\)@\)BDc)R~\)H\)Zu\)tjUWVSW 6&\ k\)@\)=6&56&G9ui`c)ta6&CPW¡6&6&J 6&+6&@c)6&Dc)^^t5;8u1H+pp X@MSNjM󤣐6&6&X \)u\)t e[^_]ie[^_]UE\)B\)6&)6& \)u\)t]mi]US6&6&@c)6&[]US6&+@c)6&)أ@c)6&[]UU6&)6&6&6&+U У@c)]UWVS,ME 11˅t MPZMwDGƋ܃}tE0v hM!iFPKE0u _E1t0wLG VkYMVu MM̋3XZ̋EЍe[^_]UWVSD])11EE hj!wE_t/}pt}rt}duܡde)EЋde)E뿋=he)?u hp!7hjE^tt SPcf[EjhCqEZYuEسEP 56&6&@c)X1EEЉEEEÉEjMQj HMu6U߉Ӏ\uN}\}uKjQjΘ Hu U߃ u Eu}tjPb[X9UUtRUuaZYUt@RhسMZYt}tc }Eu[}? @c)_/}] @c)xFUpUԈ+6&E1ۉ]E@c)u#EJ@c)xFpUh79ZYUu.J@c)xV }P+6&RE^)u\@c)j56&7k 56&6&@c)1ۉ]3=@c)u2@c)#SuZYt*ShسZYtNE6&9s}~}tjuhk j56&7 k t jh= PEP+E؍e[^_]UWVS1h)/E[t硰\)@\)j P \)H\)ZYu\)tdhe)1rErǀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD5wFuD5xFD5EPEPEPh!_Wh!__X0 wI112NЀvSh!%ɍD=vB:u҅t Sh!cP\)@\)SWU ^u \)tW0'PSh"cׁWPES ËUR\)H\) u \)tb\)tbӁS设 Y57&\Z7&@th!"G^XEEe[^_]UWVS,f11}Uh3"E^Ut*}St}at}HuMЃMʺË]E@= Eԃ8t@9tE Sh"bhe)8}Ѕuxt h]b}uEhu ZYEЉE1E؉EEȋE@HЃ w7̋}9 ErXk] eډΉ׉u؉}뷅t uhV"IEX 1RShj] }9Us uhC"}e؉[}uE@= 11114Eh\j hy=\ Et‹u}eh\X}j hy=\ YX;EPC P@sCP3he"P\EE|u}eC 1RPWV/ ƉRPh{"\ *C 1RPWV ƉRPh{"[ Oj hy=[XZ M؉]܍}WE@ P菓ZY@M؋]uP0$Ph"HE}tXEtM]tM]WE@ P [^y0#Ph"_EԀx udj~b)/tM] EtM]uu h"[Y$E@ 1RPSQ RPhZ 57&XZ7&@th"PZXEE̍e[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPSM t#9t9uƉׁvSh<#Sh'#a^e[^_]UE0 w @8u1]UVS]1tSZ1tpVhT#SN ¸tVVhS4 ¸t<uhSsY^¸t0 vSC Ze[^]Åt2US6&t1:6&u6&Au6&[]È6&U6&PPT7&PXZ=b)tM=67&uD& P + P襐 b) XYuY-jPhY#3c UWVS}] Fh]#W_S1ۃ<6&u,6&R6&#RPhu#-XUCuġ7&HyPxV7&H ^ J 1ۋ6&t#<6&tRPh|#W Cuh#/W[16&:6&t26&#t RPh#6&RPh#jW Cu7&HyPU7&H YJ vu&h#WK^Zu6&@uK16&tPWZYuډe[^_]FuW#Ph#[e[^_]USMU 16&9u ]R@uQ#Ph#ZUVS]Ct&st PXCEe[^]e[^]UWVSP]1ƍ@uPkXtUPUBX1hle)rpe)5le)=te)1҉xe)Ye[^_]UWVSPutf1=\e)\O he)P-udX]}-t@BBt&ctQo:tW؅u1PRY[=he)uxu+t =he)1롅ttf\e)e)덋Wt؅u1=he)뗅uSj#Ph#=Yru th#bPh#TjNYUSPXZUu)7&7&uuMe[^_]7e[^_]UVS] C}أhe)V7&16&@uV7&jjXhe)8u=\e)un7&=6&u*=n7&u:j^tjYt 6& =6&u=n7&u6&=7&u 6&7&e)=7&ut :-u7&1<6&u 6& 6& 6& 6&@uԋ \e)=n7&u>he)t he)u7;\)Phe)e)jP耿e)\)XZ=\e)t6u h#cWH he)\e)Pthe)e)he)te)qe)le)1ۉB9tt 5le) he)e[^]U}ujjjjYE\)@\)jche)Z8tPX \)u \)u11VUU0 wj jRR^ Hu1xe)qe)UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh$ \à uVh $cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh$[à tuVh$h7&Pjh$`1H9ujQh$a[à 1Mjhh$D[à M+E@1?1ɉE11ɋU Phyj MQwPhMQh5$Z ÊEEEjMQu Z( t1E1҉RjSe[^_]UME  h<$PTP ute)=qe)uxe)1ɉ |e)qe)h|e)hxe)RppUVSM`e)t:u>he)u1:-uztXhe)z-uztBu he)ͅtɍr8tuPh_$9Yy:u܀y:u.zu he)J he)2u Phr$]S5de)15`e)e[^]UWVSj,he)^_zth$:8->E he)1`e)jhe)Ytzth$Rle)uD8-u @P5le)P)Xgle)9Zyh$9|EPá\)@\)te) le))<}_߉ƋM9sω9s x19r )ЍpkME9s 15xe) \)u\)ttQS[PYle)9} h$\)B\))أle)te)ljNx=pe)tE7 ZEy1ۍ te)1u1xe) \)u\)tP1e[^_]Ë7&z8U @c)x@ 6@7&J87&z8]ÃxuUSt P* XK]HÃ8uU1҉P8u]UVSƋXCF~hy1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P7&JHR P UPUSUJtXxv-u~u C $t h%7&B0+B8PCXe[^_]UWVS46&E{=u6E8t hh? 3=6&6&@c)} E=6&6&@c)\C@c)\Gà " @c) G46&=k@c)H}t@c)G u͡46&@46&褴=-} uE( u 耴Eu 9E@EIt9u& u46&7&HH FՁt| tfjE)VP &kx\[x @c)@x 46&7&HH @c)xO H6&)Q7&X46&U)Ѝe[^_]UWVS@} 7&B ]urVY wVh%Vh% 4? h%j"S HSZ؅tWh%}xM4? h&jPGSUWVS]S;56&MM E,ZY96&ulPq_H=e)9s<wDu 9rMW5e)ZYt%e)=e)M܋=e)5e) &&S>e[^_]ø7&ztGUS])ttt*3&#i)i)546&P])ZY]UE])jZE!FU蜱\uH蒱 u"46&7&@8xtjjX;jjh: OUVS7&Xt 1ۉXX=x tjb7&1҉P Y7&1p846&P0 @b)x8b)P8b)0ƃ)c t,~tŁF $>  46&7&PP @\ |td;Z=t R u?&u7&@17&@_|u7&@踬7&@$&t;u,7&@ 7&@ b7&@7&@r7&@_L=t0 u746&@46&7&B0ztjj[Y7&1҉P٫jhI Và ؍e[^]UWVSSá7&@tuxt =7&,uyGEt7? t,O8uQPZYu? ^_8Et2jw,Y_t XS(4$PS Rt 7&1҉P؍e[^_]UVS7&p$ t jj7&ubX(x,u{ upV ZuhK&P: uBPV7&BC1ɉ ^t‹(wjpVe P0+P8RuF Xe[^]Um7&B]US]V9tjS]UWVS 3t u%j 8XpZʡ7&@؍e[^_]UWVS7&@}t11[WT@ t1MHwRFuv7&@@},jEu-뤃uj p1AXumtCMuj 18XMHXj 1҉WPMHGYljރ}t' }uZ虨jE#BW}uG7&}u:7&@@ T@ }t jj7&@e[^_]UWVShEӉM7&@E1E\)EkE+6&]jEP( ZYt I fxI u fx @c)E46&7&xtjjZXsbf@fLdxcTd*"t~L tgF=.H#"$d> Džd't+pЃxPЃv;46&7&htNPЃw t ddƍ@;w`u h&\u\uh&ރ?bDžd Džd11`誤PЃ `w t0)Pw t0Pw t0A Ad9ud(=w h&0=@c) á@c)HCw6 @c)?ʀJ R @c)CC@wj @c) ?ʀJ w @c)CC @c)?ʀJ vH @c)H@ @c)qwj @c) ?ʀJ w @c)CC @c)?ʀJ vH @c)H@ @c);wj @c)?ʀJ w @c)CC @c) ?ɀQ vP @c)P@ @c) ? @c)?ʀJ w @c)CC @c)?ʀJ vH @c)H@ @c) ?ȀP vQ @c)QA @c)?ȀH vJ @c)JB @c)?ʀB< vA @c)AA @c)ph '} ~€ u @c)st] t%B't:\u3=uh& 46&7&xtjjFXӝ  ŠbG  <w @c)C @c)sfxt @ @c)C蠠=u @c)s\ u'46&7&@8xtjj^WHtujXY>tt-uVƉCY;b)} ;b)~b)}>uQy>u |u &u ۘUtv&uya1ɉK7&dj`dB(7&@(X46&PZ-7&@(u @  1҉P Vy1s7&X$7&@ 7&\H,hP SV7&p7&@ X P(Xu1 @c)GD@c)r5H"0聗jhډMX@c)HXq{t "E @c)X+56&T @c)`X@Džd{1d#kDžd}tm"E uW&DruJt?:}u詖5袖e)e)jjhe)蓖 1ɉdtDžd "E @c)t> @c)x`@`H`"E uKЃ wC @c)x`@`H`iÃdt@@Ѓ v6t'H@c)X`XX, Džd @c)x`"p=d%:t #u)Ph`? [Z…t!Džd[Sh`? ʼnZY…uH% @c)x:F p:Džd @c)xF p_? {`@9Ë`uBW`衔`Dd u(}t# @c)x#F p#Dždcd1ɉdGfxufxt dT6&Jwd@ ӈd ӈ{dNj@f@f@dK@I 1҉P:'uAW|I u1@c)X\Nj@@bG f@@c)X$eH @c)JNj@@BF @f@e[^_]UWVSS7&1ۅtXC17&0x tjR7&1҉P YF8Pv v^S‹FP U8tSj7&p迕jhH P`7&HUJ@ B J]e[^_]UHu+]UWhPT\)l蔘d7&`\)\}1󫡨7&X1pjEP ZYE\)\)E7&Tjh ”jhH Pc 7&B t$Pt=^7& hppDžt1ɉxR|T}E7&jjtP\ 6&pnX7&`7&dVZl\)\\)\)u jl Džpu^jI,DžpZ'X7&`7&dXl\)\\)pu hpp}UWVS 7&@1ۉ]}U 7&u@$x @40$> j袿jCjj Cu;jiF EjUBjbjUB뻡7&xu jF Y1҉V @j]j á7&x 14$pCjj_Cj7&@A. u7&x,u pr[u hr'j腾 7&PS @0CB7&Yx u`x,uZhp辺^ZuGu 7&up0pY1҉US@PvjjfHu?8j@7&1҉P P7&J0HCBHYvB7&@-ttjjjCV7&@^Xjk 7&B0+B8C j f7&p0C57& ~ uhv蒹ZYt hCEFu7&xjƋE0FEY7&xu;7&x  jj p0‰EEU表7&@Zu UBE밡7&xt jj@0FjF 7&@Yt-Pv jj u 7&@FEM1҉@{j jeC1҉SY^tNjjLX=V7&tt3j7&@X&}t7&@uWd^_Tjj 7&u@$x@1ɉutt;tj ;XZÉs؍e[^_]UWVSV} uE E1ۉ]1]7&xn 7&u*p0QƉXYtա7&pZu1뿋H up$E0FE뢋}9u}} uwj7& 46&H4^S ZYuh'Spj/v$ t h't 7&46&+A8F%F7&1x4R@@u} u jj1E1҉j1ɉHEFE F 7&@0F[e[^_]UWVSS7&@1uG u=V7&th'7&@puWj Y1BUjBËUBpXYUj)&C^Ut1ɉ ֡7&@tj)pZƉe[^_]UU7&1ɉHHPtjjYX7&1҉P t/Ht37&@j7&Ytrrh'!%7&1U11ҋE]FUU Et 9Pt]UMe)tPt9JuB]US]j袷SCU PUPUP X]UWVSEP [y h2u$u;57&~57&ExWZ=w PWV `jjj˱ uNuV jj8jj/jj&jj$jj SEpuWjHu@V Ee[^_]1=e)UWVS}u }t~h@VW赂 à VWǂ ZY}t9u9t:WU X19t-y谺0bPVWh(SU SVWh(D#97&}7&؍e[^_]UWVS]{tN7Gu e)} t} t&Wxjw PR+GxPAU YW&Z1Ce[^_]USe)\)@\)uSwe)S\)H\) u\)t ]"]UVSue)t1u(jS#ZYFxPT X6utse[^]UWVSu] 957&}57&97&}7&9t7SXT jjSV%9t"8V9T WPSh(!؍e[^_]US7& @7& 7& ~.CPjjS x97&}7&PS X͹ؙ } e)]UVSue) ~;b)|l5e)j VS à x97&}7&9tPMX P|@ <u~tvhySy S4|@ ZYt vVuQShMMSh*EF y)KySP-Y P-PhyS Sv0XZۍe[^]UVS]蟫0=f)u'\)u\)…u uU4f)tY<~qtG<e<Xt5<L<: f)u} MԍEPjW; @}MttRtY1U=7&t tGv =6&u<9ue MVWZY@t_Mԅu f)u jW Y[1҉U܉UUUO>v  DjEPj%@ u}t1g)}e[^_]ɜe[^_]UWVSu] uhsZYtshVY_uh*; j57& h*VŞ_ZǾf)tl\)@\)f)P1ۉf)^u \)t\)t4jW\)H\)ZYu\)t G@u15f)1ۉ].{h=dWZYtheWZYu/p[vtEuEu11j1}h3贝ZYDžt}N}u N_}1f)t@taGwuu%h*WXE=}}uUf)tf)Ph9mY^PFƃX?vsh+57&& h*f)Zu h* f)P XV,Ph 넍Fuuz\)@\)\)@\)u1 WJXf)tf)PZYv ͞ DjEPj7 S觔X5pf)貕Utf)Epf)dUWVShA P ZYj'V9__Zu <)ș19e[^_]á\)@\)7&t,UP17&7&Z \)u \)t \)u\)t'UWVS]߅~91Wu u6 ~ )Dž~E u F ~) 虝8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfuh)CfKS u>\)@\)s覘C CC\)H\)^uV\)tM&Ffu9s\)@\)6CPRvC S)S\)H\)ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 97&u]e[^]e[^]U57&uXZU57&u~XZUPuu EP E u h+uPJu UEPu u UE Pu57& UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'V[_Ztt~tnh+V"ZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%hA V? ZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'97&u]e[^_]we[^_]U57&uXZUh7&Mh7&CXZU8ruPh+Ph+cUWVSSEPE X856&6&@c)j=RUNYZYj=SBYZYU))9~߉Ӊ @c)I @c)t$<=t xFUp UCɅxUU] Ue[^_], UE1@u,Di)+@i)Rpp h,jhj) j)UWVS]} Mt t9u t113"E ƍCt9t"E u1@t)؉[^_]UWVSS11h)tZuA=u܍PEY1h)t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE*e[^]h,S|ZYSƊZ9u;Shj'SAWY^ƅu+Sh.XZ/<'uh3,sXuS)Ph6,t e[^]UWVS]} sSt"CtS҉XuEs1Et Wh!Y_}t5uh XZ$7&Jy R` 7&z9 _F>=u y:Cu}thUFPZY7&HyP7&H X J e[^_]UWVS=,j)u(j) h訐,j)Y11ۋh)tJG} tE t8tEt.(j)9P5,j)耐,j)%(j)XZ,j)1tfzuh jjh`C 1zuHh jj h D BRl .uh jjhpD h-P}ZY1uhD UVS|ƉӀ8!uxu :\|fxqpftft!f u&P(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$B SV{Y[SV{_ZYSV{[^SV}{ZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV{^_xPSdZY04]E9uc9u_E98PV"^_uWxPSZYuD04MU9u9uE98f9]PV^_t1PxPSZYu鋅|9u;xu͋ 3E3U Q>~u5!uډx!(u;)u{u ?e[^_]UWVSu] h3Ny_Zu!Nu xtP!zUW Yu UR&DPtÅt S> Z@tM}th6FvZYu }tM1EE8%u!P]X6h.0_Xz}1ɉj EPuKiljыE 9Et:8u5 t/u u 9uM-}8Mt#y޸euPh. EGSWz YZ@u'.|RPh(G Etu jW< XZMuUVS@Qb)^)b)^)51t j=SL=YZt hSLXZ Phyj@]Sg jShM/|j h7&hk(j h~h5$WGf ƒ uY-j PhY#2j,hR/h#!j h~h8 $e[^]Uq=\)t 1@b)j)Ɔ?j)@j)e[^_]ÍL$qUWVSQ01Y1ɉ j) j)7&f`~Fj%s1_Zu1h&SV< tLu%j)ۡ&)ƍ NAEčCEԣj)j)EĉEEp<<\uB1ɍUiE衸7&HyP7&H U[븋JE<%u}%u?7&Jy$ER~ 7&ZEYui Yh;1V@ _Zƀ>*uFE$Eh3V Y[EEE8.u(px*u Eh3V _ZEEu uhB1}f?f}‹}G}HE @,1e[^_]UVS]ss 3shO2T N tVTRPhz2T S9 S< VPh2iT e[^]UWVS uj:u }(ZYE u h2j @E } hO E Pb Y_8j=P/(_ZqxEPh2WO E 4xK ZYu^ 4)j yJ ^ 4Xr2J4&K4rJ4~S4ÀuR4Àu#R4^WY4 rX4 r"X45.a4u`4u"`4g4uf4t"g4n4um4t"n4u4ut4t"u4}4u|4t"}4rk4@u4@t"4KD4 u4 t#4$4 r4 s!44x4y#44r4s#44r4s#4}4r4s#4[T4r4s42+ r4a'3 s34>}w t24&4 u44r4r"44@u4@t"4y4Àu!4y-4Àu4PI4 r4 r#4' 4 r4 s#44 r4 r#45 r5 r"55u5t"5~5u5u"5^W5u5t"570&5u%5t&5 u^-5?'3t3^-5}wu145%55u45<5u;5u";5C5uB5t1C5`%Yt@J5JR5@3>uMI5*tOQ53MI5 Q53^X53@R53^X5^X5}w s 3 r3%=t)wt=u&3=u3 33Q3 r3<}vw s3`5#'`5 r_5 h5rg5r#g5o5rn5s#o5w5 rv5 s#w55r~5s#5oh5r5s#5F?3s3sj3^}uS5PN ;t3CaP3h5jd,W-B 1 11ɻN ;}t SC8t{$(Wh5j ,(PA CPh5j }(PA $A u,Pى WӉ Y_1Ƀ bt,P跉 EP讉 XZe[^_]U Ph5hp&9E j; U塸j)6=j)uePRPh36hp&E j; UWVSQÉU10;#uCj EPSS fU 8t Shj E8tWSh6j e[^_]USÊt%<#ueSUZt@j)]UE E EE]aMUWVSÉU}utj VSR  @t 9E s T8"u"3O;t)t:Et&fDB@fO1e[^_]UWSPh6(Zu$).j URPRR à u+T8"u h7j 1ҍe[_]UWSPh"7(Zu().j URPQ à uS8"u h27jy 1ҍe[_]USÃ=)t =)t?)9t6t2@t=u@QRhQ7V )1))]UVSƻ`W t[PVKZYuICƒ )$)C()Cj)C 1f‰)te[^]% Vhm7jV e[^]UVSÉ֋t8uVh7jURM1YZtVh7U XZ)1EEe[^]UWVS11Dž=0)~ Vh7U XZ1 RPhS=t=0)Vh7@ &f}Uu1.=0)Vh7U [^v49tV Cfw4[ hOPh:h& > s(h:h&= s,h :h&= s0h':h&= $s8h.:h&= s4h5:h&= K= SLftRPhW:h&= SNftRPh`:h&< SPtRPhi:h&< STtRPhr:h&< 1E9E>h&h9A Ea6Wh{:h&i< vWh:h&V< F (tlF c)h5>S;^Zƅuq;jP11҉ZYth?>#F _X )Fe돍VhW>S* HuEt9j)s(hf>E j)f)[^f)uƅhBS:ZYujhh)hmS:Y_ujhx)Y {h>S\:_ZuAjV11҉Y^))h>S :_Zu.jV11҉Y^)h>S9_Zu.jV11҉PY^L)h>S9_Zu.jV11҉Y^ )lhSM9_Zu.jV11҉ZY)-h>S9Y_th>S8_Zu.jV11҉Y^~)h>S8_Zu2hV11҉@Y^<f)hS"S{8_Zu2hV11҉Y^f)Wh>S88_Zu2hV11҉Y^f)h>S7_Zu.hV11҉wY^uwf)h ?S7_Zu*jV11҉;Y^u;)h?S{7_Zu9jV11҉Y^tWSh>f)Pa<w{tSh(?;=j)rShC?A <~!jShc?A ‰))]‰))hlSn ^ZÉ;uh7!A Y[`Z 1V1Zߋt ujPSVq uO`Z )V1YÀ;thlSm ^ZÉ;1ۉZ ]&DPt7hP11҉ZYt&h7#@ ^X Dž" !v&Sh?? h?? 1ɉ)_ `)Ft<$`T u^ \`)l)F )!)13FfF`)l)F )ta)t613Fsl))h`)Ze[^_]UWVSP1۾`Z <`Z tCtg1}jSEP& th?> Y1@E h< jSP1E4?n FZ9uu~_Xe[^_]UEU M= 8&tMU E]<:]USÃ=D)= )u1҉t%Ph`)XZFK u= )t =H)tFK Vux=8)u=,)u7j h`)hedAS/ tHh`)hrdAS u/h @j h`)hedAP y h*@j ]USQ`)WEV)WEVf)h`):f)X=D)=H)u2h`)hfdS y88t88t;@rE=H)u2EPhmdS? y hL@gaZ$8&hX :" XR=H)t1&h`)hgdS y]@:]UWVEu `)t `)e^_]Uh)hmd5$8& UEU 19s f3P]UERPZYUS]EPu  h&hS; ƒt$< ttj S ZYt1]US@8&tsPhE# 3/`E EE]# U=)u PhEP: ~9$u ~#EPV~ EZY9 HtSh0J XZ‹FTe[^_]UWVS( ]hNJd` XhaJVY_@8&tۋt?R $RV$ uG|u VSЃ 뛃 뻀L`?$ʃ`9&A 9|@fNj<u8t/j } tu Sh(M, Sh _X뿃} tu /Ph(M 벍/Ph [^띋$t $PAYPwAZ}tEGjPS' y h蓉 XAЃu ƀt/tu1PH$u h#R e[^_]UE)E )]á)á)UE Puhp&u hp&j /" j UWVS]8ށu=)t5)h? YX=)t"=)u5)h\N 1)XZuu /ZYyWGPh t7=)t.j  X=)t裳 P5)hjN j e[^_]UE Puj' UE Puj UE Puh UE Pujj UWVSx1ۉ)Ph\蚈^_yhNhVu ]t Ƅ1PSMZYyShNLY[u%=`uz 9u;u)Shh)&(ƃ uShN뜍xPVЇ_ZyV끋%= VhNe= u:u*ShVn( t ÿ"ShN0S謿 [+S蠿 Y0hVq  u|h)h5XZ|듉e[^_]UEP ZtPRPhO u uhOhh )  )U)tjXj USmj0h ` j\)jj E]US2jƐ jj jj ]UWVSÉ֋x CPww wwփt=)~j o X)e[^_]UWVS1=)))1)))1 Dž蓾 u/h#Oh.O [^Dž SUYu襼 Åu~3hV ǃ uVh` XZAP~XEtVhLO Euu듋CuOHujsVsUYE >9 C 8H1u"Wh^Ohp& Dž CC jhPjV Ãt'$Phzd@Sv @uS[W; YD &9rDYt)PH)t4KRWQe  u <tPȉjWFC1ɉK C C1{;)C))XZ{ t%Vw YZuVhpOq XZ?joVGG GG1CG8{DžaETuDž)Eu)} u:E 5j ; YtshO s _Xtvh= 6M 9~=) 1ۋ9U tE 9}?Cԉ a^ EtPs sshOR …g=\Qs sshOhp& ҋC'BDž 1)C) 1F)H)~ + )(Pa ^t5)9F6냽tr)t`:t)hOPhOhp& )t/;tUPs sshPhp& ͋ ׹  Ph"P Y[0F1҉StPVS s6s6S6 uU89;))?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs sY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss4Y^} GWssY^GWs$s Y^G W$CDȉGDs,s(Y^G(W,C@ȉG@s4s0ՖYYG0W4CHȉGHsNjCSMEAE@ufFZ[tA 1H)Ee[^_]UWVSu^8C@PvBBp+BtPR|[^t)) hPqY=X)t-5(9&jjjj)) hQZu5,9&RPjjPt)=X)tohQ9# b5)=) t(jj[[XA!HfAWV#1))XZ=X)tj _)) tjjRPe) )u h Q+5)5)[^f%f=@hLQhjQ ZY5)=)5(9&jjjj)) xRP5,9&jjy\jj5)5)ƅDž WV@@PP WVf@5)5)5)5)蹷^_8thuQ1ɉ H)[)) tCjj RP}{C9s#Qjj RPzN019r)#u 5)5)u"hQAh 1H)XZ謶fH^_f@t 5)5)hNu6!@t%hN5)5)5)5))Z[@@fA\5)5)f@5)5)ChQ<$u thQB =X)j L XeY[^_]aUWVS}u w wTXZCfEE9uc0)t=X)t =\)tj jjjw w'u0)jhQW  w wNYXG )9O u,9&;)tf%`f=@unGRhQw wgE)PuhQ =X)us=\)tRyNj  hRXZ=X)t2h)R _=X)tfE)fCe[^_]Z h5ReZHt1ɉ H)x밍e[^_]UWSáԙ)p8hSY t& ԙ)q0RP¡ԙ)H01z 1҉Ѝe[_]Ƀ=$)tf‰Ã=$)tÃ=$)tUWRP_pY_}UWVS(}M] U ));E] w+EU 9ԙ)p8}E9|+F]!É]E !ЉEEUEU9}"=|)tWN#uVu uhGRA 5ԙ)}̉Euuu uI}EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=|)tlSQu uhoRn ԙ)\Tumq֋]!qISQuuhR ZE̋UEU؋}9Ћ}};=|)tSQu uhR ԙ)uuhR $럍e[^_]ÍL$qUWVSQ0QEU}9Es9=))EsuuhR"{(),)ԙ)sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuusŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuu&vK` t1Ɖ׋Cu}ܡؙ)t`s0WVխؙ)ԙ)@x1҃ RPuutM])Ӊ (),)ԙ)@x1RPuuxtؙ)R=P)tЍeY[^_]aÍL$qUWVSQ8QEU))Ӄ ))}9u}9u9=) )EsuuhSy))E؉U܋E9EEE)@Ẹ)ԙ)\1ҍMQRPuuqUEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuu'tK` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=)u )) ))EUܣ))Suu5)5<)腧=())})E5)=P)19}VVdf%ZYf=u Gvdv`iYYF`VdvlvhiYYFhVl1tttpMiYYM؉DpTtA u1MiYYM؉Auv<=)u ԙ)(1E؉Ẻ}EċM9MSuu5)58)躧rVVif%ZYf=u+=l)u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡) ) )=P) )ЍeY[^_]aUWVS u} ԙ)M]1EuuWVgp ‹Mt WVh(Su1) )1(),)5)=)5)=)1)=)8#AH)=P)态1ǣ)1ã))5)t C) =) )Qh)ZYu hMSte[^_]á)tUP1Z1ɉ )1)UWVS u=P)tFVFV zEUԙ)H0AEUSQRPt w 1҉UtE4PX3)RPuu n)1{{E U 1҉CS1CC E UC SEC$EC( P)1E v 9st DpTtD(D,T0Gу} w))9)ub11tDXGu뺍PRFZY=)u htSr))d)P))e[^_]UWVu} )RPWVsm)t9xu9p tWVhSre^_]Ã=)tQUS))\;)r 3X5)5)1))ZY]áؙ)@ UWVS$Ɖx@t@VЉ_uDžۏ v vv ԙ)p0vvxNjHԙ)P0@t 1ɋ9}=؋ÉA빋EU RPlÉ19r= )thP)tF1ۋ9}&G q1/cYYQCG W58)ɣ[X9}W ʉ@~ ԙ)9Htԙ)9Xt~zG=P)t T <tYv vhShR RV莤t"G=P)t 1ɉ ؉L1҉G 1H)C|W58)[X"~@)EU 9GG=P)t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉH)FV RPRPhS¤ShSo hS蟛Xv v!ZY=P)t@V+EU FV@V z+EU oFV hS 4)gX g؍e[^_]UWVS uE 8t18E 1ۉX0X4P)tFVFV щ} G$W(ff%f= ԙ)fua(9=)t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQh1P) t ԙ)#8tU@DNL!Ή!؉HT tԙ)@8] C t`d E x@1҉H)P @RPRPhS聡ShShl hS^YHE p p^X=P)ԙ)tp0PCSp0 ЃW)  B=P)=l)tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u1))))FV =P)tGFDG FHGXGpFDGtFHGd F@VW[X=P)=L)t =d)G\uG`Wd uGhWl tlhV[Chu[ou 1ɉ H)21G\G`GdGhGl f!0XZ=L)ubԙ)X4 ؙN0ʋF4f0F0V4=P)LGWF ԙ)W\tF@I0D11 ԙ) G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPh[mA=X)t h[ Yh'b7mZ_XF0=P)tV4CSCh~@jjv4v0vHvD wh[@hVTlH ZY=P)t `)@ `) 4e[^_]UWVS̙)E1ۋ ԙ);Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEU)CBHLY4DEUE9ƉU}:E1EEU)븍U1E 1ɉ ) ) ) )Mԙ)];X,}|1Eu| ԙ)EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh )p5<)ԙ)}=()t =$)t =$)t5ԙ)u5<)P =P)tE@x ԙ)1҉EU=)t6ԙ)p,kEd1<SVuPh[hp&s 1)=X)=\)ExU t1U u E#uh\=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEE)ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EE)ËE} u 1s<}%?}u}9t uuu5xYuuhM\;j轌 1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]5)= )|U) )ԙ)M]11 19E}eu5)9|]s1-h1l|]+hlȉ uvj)]1t_}}9u}9to<%?u9tSQh7\:jB M]WxY[M]u Wuhq\9MEsE)lj1VEi1 )e[^_]UWVSEP@EUE@ E}juu# t )t`}9xuPu9puHEuuh`Ep p{ )qyEpxu}qy )9)u )u덋= )98tEUMK؍e[^_]UWVSTU1EE\ ę) )111Eԙ)x,9}=)t2kEd1E7uWuPh\hp&轒 1=)1ɉMԙ)M;9ظVSXZts]u$)=P)tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=$)tf‰Ã=$)tÃ=$)tUWRP3)Y_}UWVS EX8=P)t 1Q=l)tt1;))slj}1RPk@C^_DžE@4} G0.3ChhbPZY'Mqy u9t]Ep ph_^bHu Ck1H)iE@=`)ƅhhhbP过 `) $)ufwhU]Ep pnCCD 9sK\;tCPha]5Y_\PaZCfVPS< wh\Qa_tr<3Ct)jfC^PSW<LfVPS{<E@0P4p p~ifH Dž};G0G4rw w@Y^=`)ƅhhNP- `) $)ufE@4} G0sKF79+)!ffCE@01x4 1RPMhfH1󪋅fCXZ3txChNP虖ZYudA1A =`) {h]Ep pCh_._H1=H)Epx P@ uh]WVRPўSCD9\;tCPh]2Y^\P^ZtguE@0P4=|)t h] XH1x CfPh\;^^u@@ uE@0P4=|)t h]M Yx1҉P C;ufWS79 a4 +fCPSV9fWS8u}G0W41RPefH[_DžCMq0y4<wP{.uJ9}:uh] { .u)h]Ep p袝1ɉ h_\Ep0x419))s h^=`)tqHuW{tQh^1RPEp pb=$)%Ch_U\ZHHt{t1q1RPdXYu-uY};G0G4~.h^1RPEp p趛h^[k1=H)SB<M;A0A4 t!=X)=\) ]]R1RPEp ph^,[H]1RP襲_X4f%f=@AfF1RPXZG GU;B0B4R ARPRPhPc ‰1RP1RQhPdc0Ph-^PhU^L.=X)t h_^z Xh^ZYHU;B0B4} R AGW=`)tTSF9tHhj^1RPEp p虙FCh_YHt 1҉H) DžfNPRhy^},u Dž 1 e[^_]UWVSdjja_ZP$ a h^-hlQX[^u 1ɉ H)_hjjjj赢 h^+h^,hjQX_ZuC1ۉH)hYX^jfj?} h^p,hjQiXZYt#jjhjjjj%kh_6X_9jj软[^L%@?f Ph^+=`)tjju`fXZh j5)5)XO1ƅDž 5))9k=)tD+)=)kX*WSPh_hp&? 1)C$ w0h6_ss 趗 )A 1C$h_=)WC SRPRPhW_=\)C$t5)RPWhQrhJ_*5)RPWhQrhJ_*=X)t h)R Y )C$D1C$=X)t2ss ԭXZ=P)C$u*uGW %h5R VYHt1=H) KGWԍ@1=P)@fC$1 S( v Dž 19}L,@ HLPtfC$1C( v Dž 19}T,L0`d@݃ vHC SCSt1`d~PPXZ=)u)h5)1=)9s؋{$@1=P)@uzfC$1S(19tL,@C SCSug`dakfC$1zC(19tT,L0`d@1/PP请Y[HX u9r.x$tڋP @Ή11׉ t!@tSQZXZ@ FuRVFFV =|)thp_vv RPhNpppp /fKXY_8u695)|_ssدFXZC SCS u95)|)js s]Ah_,#hP%O 3ss訦1ƅs{Džݼ ^_=P)tBBBpBtVR`ZYu h_["_PsstQDž ss輥VPtVf@Y[5)5)~VfHXZ:e[^_]UWVS(EP@EU̙)Eԙ)RVuu!EEmƉׁ\TtCЋU!CQC RPh )S5<)ԙ)}=()t =$)t =$)t5ԙ)u5<) ExU t U tuh` XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUM)EMBę)Åt4}9{u}9{tPHSKę)PίX#E}tlExU t}G`ǡԙ)RPuuӉE1EЋE̋Uǃ))Ex@t+jjԙ)@4 ؙRPEpHpDp pa ԙ)Ez89x t0}t*E@$ EL@ EUMM}tttoԙ)E{89x u^E@EL@jRPEppK` tPuSYdh 5ԙ)5)%5ș)5)W=$)t)PP-zXZ5)")h )zR@)e[^_]Ã=$)tUWVS\U1E 1uԙ)X,9] =)t/kEd1VSuPh8`hp&w 1ۉ)ԙ)u1EE1ɉM)MU;9WVWVQEu} P)tCECECXCpECtECd EEP$$a EXftbWVYZt=|)WVh``!WV^YZt!=|)WVh`s SEP襛XZ)Ѕ9xu39pu.JZHX)RjhQEPLjhQ$tC CC Cu jh`jh`EP躴`WVPh`E?Ee[^_]UWVSԙ)̙)|jj'P1󪋅h_X=t)xX$=X)uh`*G^uha)[=X)t؋1ɉ$p)h 5ԙ)5)V"5ș)5)+T=$)t)PPvXZ5)t)XHXI$~6P9)`~$tl<hNjH`ltW,Ћ9G0sVha$^_n=X)tVh3aY[hGaEZC=X)uՋB,t|Fl$1~H`F|@ltË#XLS5̙)|^_u h[a|̙)p)h 5ԙ)5)5ș)5)Q=$)t)PP/tY[5))ZP)tt DžPLDžHLPP1󪋅lPP TCHX$~@=)u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPhva1hDž\L1 l)׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtx)ttx1tX,9t=)t4ktd1=VStPhahp&'o 1)tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh )F5<)|=()t =$)t #=$)t5ԙ)|5<)r =p)u-|xU tU ttha[^=()th )(H@)Y=t)t =)u() h) d) ԙ)Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5)58)kC ԙ)𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh`)E=t)tthaXZXԙ)ph5|)5Й) =$)t5Й)5|)*n_XЙ)\8 uǀ\T5ș)5ԙ)KY^=t)th bPE_Zu)5Й)5ԙ)CY^u9L)u ԙ)Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5)58)Aj5ԙ)HXZΉlߋpËlቅlpplp8T<DT9ƉD} TDP)Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh/b CVtuPU u PU u P1ɉ`T9lpD)8lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P =|)`t'W3VslsQs thLb` (hbPX<ZYtej PSh 5ԙ)5)5ș)5)A =$)t)PP-d_X5) )^1ۉH)=p)tP|x\|P uT|PTxU u |PTHU u HhRP8 hb\P@;ZYtw\S| HU uHڋ|xU tT |GThRPh )c;@)1H)=\)u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPhb,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPhbOXZlAu농U u PXRP txhcP8Y[taU u P|xU t |G\XRP h )8@)t j SV  =|)ts hc![ DhbPu7_Zts󥋅ƀƀh 5ԙ)5) 5ș)5)<=$)t)PP<_Y[5)&)Z1H)e[^_]UVS1;] s8ShnZ ^X1E0PhhcVZ FZYuj eY XÍe[^]áԙ)!UVS1ۍsrT =X)t409&hcY YX"mctcP.Zty=X)uɡԙ)t4象ԙ)1ɉ Lh P5) 5ș)5);=$)t)PP]XZ5))X15H)Ktԙ)ԙ)=X)t hc [hc-Yti=X)uۡԙ) h P5) 5ș)5):=$)t)PP:]XZ5)$)X1H)jWjWYXuj]Zuj]Xe[^]UE)E )]á)á)UE Puhp& hp&j q jQ UWVS]Vk8ށu=)t5)h?W YX=@)t"=)u5)h\NW 1@)XZuu 8ZYyW覗PhW t7=)t.j V X=)tb P5)hjNVW jP e[^_]UE Puj' UE Puj UE Puh UE PujjhP UWVSx1ۉ)Ph\Y ^_yhNhVu ]t Ƅ1PS ZYyShNLY[u%=`uz 9u;u)Shh)wƃ uShN뜍xPV _ZyV끋%= VhNe= u:u*ShV-x t ÿ"ShN0Sk [+S_ Y0hV0[ u|h)h5XZ|듉e[^_]UEPbJ ZtPRPhO u uhOhh`)S `)UD)tjXj T_US,hj0h@a jH)jj\h]USgj jj\jj\g]Åt3USӃ=X)tPh?OT YXShcXZ]USu=T=Tu =Tt=Tt=8 uI,)t=u 1111$)) )()1<=T=Tu = 8u1ہ=,)묃[]UEL) h)t,\Tu ǀ\8 Tu ǀ\ 8=d)t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC"Zu"hd'[=$)t hd)Y=()t)PPQXZh 5)5ԙ)` =$)t5ԙ)5)QY[ԙ)\8 uL)ǃ\T1\TP)uSChEZd= V )΋)ѡ)ƉϋKdC4)RPWV))) =)TC,HEƉ׋Eǁ\TtC!C1uCRPh`)'=t)=()t|)PP^PY[ԙ)ph5|)5Й) =$)t5Й)5|)&PXZ Й)\8 u ǁ\T5|)Q5ԙ)u tc=|)udEKheJ =Й)ԙ)shX9s΋9tRP+ԙ)Ph1eK hș)5ԙ)*() h)[^ d)t[h 5ԙ)5) 5ș)5),=$)t)PP#OZY5) ))XE)e[^_]UWVS]u E)8)D)xPS Y_yq]0#PSh{ef=T)t(jS<)_ZyT@]0PShe5%= tShwhYp u1I =)t 8)=X)t"he/_jS8)ZYySheSI 1ɉ @)X) @)u She1I XZ1@))))))1))h)l)1x)h h蓊)h hyǣԙ)h hc|)h hIЙ)  ʅ ʅˆt heVSTY_¡T)t"ujV_ZyVhy ^<)=T)u%RRjPVM8@t))t:) X) T)PDPj5<)S7@u SheY^Tu Sheh"tV S_Zt%hfVRZYtVSh%f `LuShPfC\uShsf+5)V4uShfuShff^_uShf܍X1‰11p~u 1ۉ)}Tu%HSQRP6DžTӃ~ ƅtBtѥPD1D1É1P1RPWVOډSWRP|hgZ1ۅ~;srPƉρ}Tt!1׋ t1)1t ;r5Ch;ghYghvghghghghgD 5)hh@^_=KÅtԙ)\Tu [t1ۡԙ)!@)=X)tth#h[u hKhYYԙ) h P5) 5ș)5)%=$)t)PP-HXZ5))_1ۃ=|)tԙ)Ph{heC Y^ԙ)=()uNtJt2=@)ve=X)tPhhXZ=X)u hhXԙ)8<))C,)1=)C0k NKt鉅 ׉ ЉNj׉   =P)=t)ԙ)=t)x=X)t hh^hh[ԙ)1҉XǀP1ɉh P5) 5ș)5)#=$)t)PPE^_5))[=P)5=X)t hiYh9iZXԙ)PP #ԙ)ǂL1XǂP1\hș)RC h 5ԙ)5) 5ș)5)"$=$)t)PPD[^5))Yԙ) tyPh\ihVT Hu^ԙ)  h P5)8 5ș)5) "=$)t)PPlDXZ5)V)_ԙ)vuhighi`[^Hu\ԙ)1ɉh P5) 5ș)5)!=$)t)PPCXZ5))Xԙ)@_X5)?))^ԙ)(=P)tx<PhjJY[=P)ăxԙ)(=X)uh_ZHuqhiN _=X)th 5ԙ)5)O 5ș)5)$=$)t)PP=[^5)m))Y ԙ)8<qH։9u9RPhjqԙ)BHЉ8< =X)uh_. ZHuqhiu X=X)th 5ԙ)5)v 5ș)5)K=$)t)PP<_X5)))^ ԙ)@DqL։9u9RPh kԙ)BLЉ@D =X)uh_U [Huqhi~ Y=X)th 5ԙ)5) 5ș)5)r=$)t)PP;XZ5)))_`)=P)0PH҉8<PL҉@D15`)ԙ)=t)ԙ)=t)?,=X)t h0ki[hPkI Yl)ԙ)ǀ, 04ǀ(<PH҉8<PL҉@Dh P5)H 5ș)5)=$)t)PP|:XZ5)f))X=P)OL9=X)t hlklXhkL _p)ԙ)ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S5) 5ș)5)=$)t)PP&9[^5)))Y =)tvԙ)=)uhh P5) 5ș)5)X=$)t)PP8XZԙ)ph5)5|)? h`)58) 5ԙ)Shu‰L^_u Shk1׉1ɉ5ԙ)9)~09~NjLWF8HLNd t1RPS5<) t>t Dž)hkhY^Zu1ۉH)jw, =()tHWSS6 ԙ)WA8HLId t1RPS58) =$)t WSS6 ԙ)@0 ))11Shs£)XYu Shk1׉^,jSe)_ZuShl}=) )) ȉڃ9 sA)))1ɉ ) )jP_eã)j5)Ke)…ˆt)PhFl"Shr̙)_Zu!Shil[^1H)jZ7&ԙ) \)=T)u*t!hfP{<ZYu ) )>hSP5)5<)ƃ ))))=LBALt[=)hlh_Y_jjjjjS6:=)fGW69fG)CJtejPhlk =X)uh'bBZu9h[v X=X)tC=)fGW8fG)_fCff=v]hlY=X)uhmZu8hmv X=X)tfC=)fGWZ8fG)_fCffuihmY=X)uh_lZuDhiu _=X)tjjjjjS8=)fGW7fG)f{f9}zD3<:uƃu}EEUEURP5)u uy )9u)E ;}|v)EUtJ9tFRPؙUEЉEe]EUSQRPmRPhn+' RPhX' Fyj +& Xe[^_]UWVS}u EUEUEE)ؙMʋEeEUMuuuVW.9Eu@)UMuwhnp& X19]~KؙEURP5)VW )9tؙEURPhX+& )E e[^_]+% e[^_]UWVSQƉӋJt,B=)n9us sRhnC 1҉Sss ssV)1E1ۋԙ)9)؋r09~ƋL߃=$)t VWWj) ԙ)VEA8HLId t1RPW58)=$)t VWW) ԙ)X0Ede[^_]UEU z t]]UWVS]ԙ)Hdu } t1)9{ u9st7S58))uWVs5<)Cs{ ECe[^_]UVS)5ԙ))t+NdEU  t19S u9CtCt[)uh"ouu uS$SPC))X)K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPhMo9{@uRs s8 RhXZ=X)th9oKj YhEoZu 1]UWVE5̙)ԙ)x=$)t5ԙ)p5̙) * e^_])ÍL$qUWVSQQ9) )s RPhioH5) ԙ)1ۍ}WSQRPGU Ƹ89&;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE \)uu1_Z=)u <vuE )4]e[^_]0)U1EEƃE9Eu E9EEUEUEUEUEUEUEUEݼ ]uuMURPZS()lj$SW? wG/ 9raEUEUE Et@EUEUE3 ENRPMURPcZC1ɉ )1҉)1)E EtF?N)Eu ]e[^_] UWVS]\TUH} FE 8uh`O} XE u hoh`SP) =|)t hof _L=()1@J =$)uE PP1$Y^E \=$)uPP#XZ1fEfffE@9uރ=$)tE PP#_XE \Ǎ=$)tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\PM UWVS}u=l)1H)8)y <)h)P^_=E)=)=X)t hov[h pVY=X)u׋ԙ) )=P)ux șRQ|))h S5)^ )5ș)S2=$)t SS XZ5)))8)Xh)58)5)&Th )58)5<) T)1t-)t%FS58){sSSSϡ)9t )Ph&p#1=ܙ)=ؙ)=H)ԙ)=X)t h=p^hXp[u 1ɉ H)=H)ԙ)ƀ1҉PTXh P5) )5ș)S=$)t SS(^_5)))8)r[=X)u hopsa Y=h)tshp_a L)h 5ԙ)5)` )5ș)S4=$)t SSXZ5)))8)_=d)tqhp` 15L)h 5ԙ)5) )5ș)S=$)t SSY[5)))8)hZ=|)t") )kdPQShpA /5<)X8)Ee[^_]e[^_]ÍL$qUWVSQ(E11҃}5ԙ)~8]9 )))ӉMЉ]ԡ)E1҉])؉EȉE9‰؋]1EEЉEEM]KE9t*EȉEËE]̃rAMEEE؉U܁\TtFЋ}!FEU܋̙)QF EURPh )5<)ԙ)=()t =$)t =$)t5ԙ)S5<) {U tU tuh`XZ=ԙ)EUؿEЋEU ){U tEC`؋Uu؍  0EU9Uuu5)=)ԙ)MLU9P8u+KIjH`URSPU)S$) )Q h 5ԙ)5) )5ș)So=$)t SS^_5))h ) @)EY[E]9]yV11ҍeY[^_]aUWVSu )!Ut 9rt8R}t-jEXu hps1rBЍe[^_]USM )#AUY9u ЋR9uX[]USEU ԙ)1!t4^Fu(9u 9t331 É[]UWVSu} ]9WV+ZYWVqZY) )t9ZtjSP ) )M]XM ]$HX )t}9xtju5)e) )UMHU M$PH e[^_]ÅtUWVS E uV8b <}EEH89~kًEuCd E4@d ߋE9x8|EU!9u(EU|EUqU߉eMMG빃 [^_]US] EUR`t(t7uS /u<<+  !8]Rha hqUU ME@`t+tDuTɃu:< %ЃPha hqoUSE MUR`t't6u?Ƀu)3  Rha hq]USE MUR`t't2uAɃ)u+5 Rha hq舺]UWVSu E$ %EFlU(EFhUEEM}}~ ExE$E8NpU9r UùupE9} Etуu EFB܉)EX؋})EyEؙ}ǍW?ك9M}tu :JI)ˍD}9~} UEU~E U+EU~E U+EUE$E~CUuI[^_]UWVSu]tVV_uVhM&jE`1ɉPhd@u f tGRhedAu  @u!U"8tuhd&蘏 XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(hrƹ ߋSh|&VDCPh&V6 C Ph&V$CPh&VCPh&VCC,$C,Ph&VC0Ph&VtPX}!uhzd@u  @RhedAu g @uuh&j41}󫍅Pu ^_@4ȋ9M09t(Ћ}1ۉ1E1ɉ [Eƀ*Ptj PEP,1e[^_]UWVS4}jhPjWt*tGjPjVWVκu$U ʋMQ؍e[^_]UWVSu] 1PV ZY1ɉ%= j/VR _ZxrPRV)Ph qh0WN jP‹ 19}e WP8ZY u$PV͌ ZYyA =@uu^uÉ1ɉ PS_ [Xuk%=@u/h(qh0VG VsT ÉD= jXZy.hh ׷à 1҉PS ZYt-SvY 1ۉ 9u 9t0PBS _Zq8T8PRPS+ s>PhFS( yL8S轷 Y h6qj$W jjW賶Ãy}tW謳 MZt8PhF|@S y&hF S^_P!AtP AY}}Wt9P@1R XZtP@XiutQ ߋu0P@_t Py@YtQ ZxSr룅tQ X؍e[^_]Ƀ=$)tf‰Ã=$)tÍL$qUWVSQ0EЋAEqy AEĠ)Eסԙ)X0]؉E܍EPuuWVSUMUȉM̉E9މEsMp1Mȋ])jj`SQӪǡ)U4ڃr hBq迯_W!ʈEċxlEHX)!9tPRPhXqu)u< =X)t hiM ^h_2[u 1ɉ H)1!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=$)tUWRP{ Y_}UWVS EԉUMQƉ׋] ԙ)H0ș9Ή}EE5EPWVuPԙ);B0u Exth{qtXԙ)@0RPWVQUBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hqˬ,=X)t hiJ Yh_Zu 1H)1)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSNԙ);B0u UztWV2K_X5$)u  )QrRP3 E@ `ԙ)M ȐȔh P5) $5ș)5)[^=$)t)PPEZY5)/)Xe[^_]UWVSE XChSlEEUE EE=P)tP@P @ƉuOEXuhq1҉H)YX5$)ԙ)@0RPWVqS E@ `ChSlEUE Eu hq蛩ԙ)H0ș9M}sE E>EPuuunLԙ);B0u Exth rPXԙ)@0RPuuUBEPT@PChSls}EgUBXEU}GWEU G8W<5)#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tEМec EЎc)ԙ)}}{rT 9RPYXJԙ)ws$d 1҉Ut4Vh8r=X)hKTG Xt4Vh[r賨=X)FhKTF YRt4h{rkj) t4+XZf%f=tCԙ)ڔڐVPhr5=X)hKT_F XEPjjQJ=ԙ);G0u Ext+Crt4ljE Gԙ)E1ɉ ‰L_XP=$)%JXF^9t(ߔߐVhr蒧E`QB9uР)8BufJEf9uwhVT@_uS hVT/Yu(hVTZu1H)}tԙ)ؔؐ,F_Xԙ)1ɉؐؔԙ){rT uDVhrʦXZ=X)t hQD ^hQYsS5ԙ),XZԙ)t4*EEPjjujHԙ)Z09u Extuhs1j @E܋E=P)tP@P @u4puSQRPEP,ƣ)X1}9}~hԙ)X01uE)ù`1j@@P0_X1U9} MȉыU @ۍzEE܍Hhhu EPUEk[^1E9E~+u܍Lphu EPUE{WVp^Z‹;SXt)tsLsHhb{Wp YHE ~A Eujjh{h{Wo(uu h{h{WT  EujSPjjuu W Au  ujpPl1RPsLsHWn t 1҉ll;CPs㋕lSTp4aF(V,+F V$dh~>VhhtQDhdv$v tQh{W>,jVjhdv$v W 6lQPl/SX1e[^_]UWVS ƉUMjQRPtuh{V_XfUt+tuuh{VS{^111 tuB t@uمtr} }uWuRJtjjh{V~jjh{VjSjjjjjV pfuuh|V~uuh/|VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh%|V ~#1ۉESPuuRRhA|V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 SyX렍e[^_]UWVSu} hjY[u)Vhq|M XZÉEEU(,E$E U$0418%jhSPVcuhVS h|Sb<RP: ZY@uh|B$D%=u?$Phd@ @uh|S&^_$uh|M, ((Phd@f @uh|뭋, (h|S딋Eu ǃ$$, (uO1҉MRQWVq ‹MtQh|SVb  (,u(,EU싋$1҉MRQuurƉ׸9ЋM|RVh'}StRVQuuhC}SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tPDxXhl}SS 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@0 @u%hy}SXZuSh}S E]w]US]jSYZuh}jS YZuh ~SXZ1 F܃e[^_]USQM$1SQ,({neY[]UWVS }u V 91M19É}uRPh~WE&EPuZYy591h.W #UEF9ø| 591h~ύe[^_]UWVSxu >1;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|PJ tijWRF uYjuWUu!@uuZYjuPUu@v0sh~us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h~S 1e[^_]ÍL$qUWVSQ qyAQEUy uh~S{ZY8$E܉E1EuuWVi tuWVhSBHEPuuuugƉ׋EU tuuuh@뷋]9ً]}eY[^_]aUWVSu 1ۉ^h\y591}_X1td1SщU f MF YZMtUBuShtu} $f (f   Vh\yj|XZ똉e[^_]US1,f  f uh `u܋]UWVS ]} WhSL 1$f (f E؋E!ЋM#M t:;tUUWPS W f S UҋE!U!E`uE Et;uuhjuV ;tUWPS覄 WVS螄 ؍e[^_]UWVS]} tEU E U uhS_X S^u E@P;E sPu hS؋E pVSZYEtu hS 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u hSn Ee[^_]USP] ;u:j EP591C  U:u1҅u591h.u Ћ]UEUitstau+u PJ uPZYUg@RhP UE ft*u 5914ZYt591h8uA US] ;u#591i Y1҅uhSu%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~hePY[E1eRP6 $RPn[ZR@8Zfu%S5913ZYQhwP\ ֋]UWVSu }jj hWVj]S;yEWVuhϽ }t Sh軽 ZYj Ӽ Xe[^_]UWVSQ]M tu EEQhS'M $jRXZM uWhS 9jVQjjuuS U 1ɅuWhҀSKVa‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_Zth2jS,Y^ujjjjSbEUE Eu hSXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h8PP @9E}}EU u hV'EUjjjS@ $urY_u hpjPjuujjS9 uVhSZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u ha @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9&tE j 1҉Ue[^],(h܂)$h' $1RP,(?aRPh h  jSm uh XrX CRPh6蹸 s,s(hTs4s0hh$C8PhyhxVi-Vh{q sPhd 1e[^]UU E$E8E U]UWVSVEUFV E܉UEUEUEUE9E EM|vuahOWE UEUEԉU؋E9EEM}6u&uuuu uuuuh^W(1FM]3M 3] t?uuuE Uà hWEXZ맋M܋]3M3] ut.u}t#uuuuu hWEFE F E$F$ku}tRE}w+Mk E}w Mk Ew k RQhӄWx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuuY t/E؋UWVRPZщΉE؉UMWVuu^Y t/EUWVRPZщΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuuXEUE Et6EЋUEȉUWVRP^XMȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuuUÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw Uyh %uhurXZ~th?O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuuVM؋])ӉM]MЋ]9]u 9M9ME}uuSQh`uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uuU ‹M؋]t&M]uuSQM]UM])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uhu+GxpF)^N^ 9MEu hz~t hFV E؉U܉ȉ+EUEUE9E؋E܋U} hɅE؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yuEԍe[^_]UWVS@]u }(,EUEhWV(} t(qtsu&jsEPjjS@uvE95&thr j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE EuuuhSE$1RP,(EƉ׃u؉}܋}9ЋU}uuuuh)SjSEZYtE̋EЋ@E Et hefEЋ@ EjS^_u h}?jSzZYu hy!x G EG$EjSG jS9 tu hS^XPH UMċM9Mu"M9Mu}u hSY[1p GPGT<9s/jhv V{ tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuh׋4E؋U+EU9E̋M| hU9UEUиM}9|E 9ȋU|&}tE؋U܉EUh5SXZE9E؋E܋M u}uU4}u hWSYX UMH0xh5S{XZ1}9}[uujSD@1jp juuEU+EURPS uhsS @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋EhS_X}ffuS7Y^@,hÀ}|h5SXZje[^_]UWVS]1uuuuu11hЌuu x btENtoat%itClhY1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9&uEU t thr jZYWVRPuSe[^_]UWVS EЋu} jj hRPj]SyEWVuh躗 }t Sh覗 ZYj 辖 Xe[^_]UWVStƉPZt 9St[Rh8V *{ RhP> $1s3щ¸g$1s sщ¸WhhV (WhyhtS SV裢 uhhV1 SVh$詖 GPhyhS Sh芖 $jmSj$G8P7Shh h,^ G0W4 uh3X X1RPhP?P: ލe[^_]Ë &Q &y ;0&| t&J &Uh&P^ XZUWVS֋U} $ s Ew` u>h0z臕 X ׋󫋃V6h~I XE0ze[^_]5 h+ X8ShyhtS Sh shEE뚋A t h~ʔ Xhȍ返 C SX1ۉ019u 9tCuEҍ!mtPPh4 h" _tjmWj$8Sɽ1tttShyShhWWhē ZY?hDz趓 Xu+u"EmVE Ee[^_]道 e[^_]UWVSxh hP h|x h5 h> xà Džp'Džp s3x pݒ s sx p Ct Ph.荒 K Cs31 W{ WhhPD WhyhtV*VP uhhP茌 Ph4 XZ{ h)hyhVVh_ӑ Vhȑ h軑 jj hx$K x$cRPjVu x$K x$cRPhI "jmVj$G8PVhߎ h  G0W4 uWh3 X[tVh_ؐ GPhyhVVh贐 ZYgRPhPP hg腐 K Cs31 OC tYC 8P)s t󫋆RhyhVVh 1e[^_]UWVS}] u1EEEEh9VSn t^l`~\a wT$0s ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9&th`s j^_xjWZYu hC9 X]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4h h謎 h| h藎 h W+ƃ E'EE v6 uR v v u>  FtMPhm XZ N Fv6U vXZp hgɍ Y볉؍e[^_]UWVSD] 1}v }Euhuu Ql tditHTt*PLt7olt Pwb&hY1tukVS_Z@ut6PEPSB @u#tjhv VB t E 9&thts jZYVh EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMhuVSk tfitLat%bt0lh/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95&ths jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0h0RSʉ ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVks W uu wu uRCu1jSks V u%u vu uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPShaW薅4 uEyƒtsVx ZYu+C xu"mt s sFYXj #k Zuz Xe[^_]UWVSE @80ƅ77PhweuX t 7u~ Cu X0u: ^t h0p jVh ! Ttg81ƅ9!@󥍅8Ph%jPS0Ph%jPuVi VSh+j2Sһ [t hj2T˅t_S zuR(,Wswv ZY,u1(zu%B hSShUe e[^_]UWVSVu)_uhw hj+-ƍEP [t hj-juV0?Nj] t>sVp ZYu+C xu"t s s>YXj c Zu0 Xe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h x hu0^uh x hj0,sP3^ s Ws^ hsu t.P,EhwutE tZu EYLEPh?/uP }Chs@PuW\ @qhpuXZt VYhxuXZt QXMEPh?/uVPE Mu {hE EEEM؍CU`EPu u @Muh x hfEftft5fu6t2C t Whj*}tC(UhC0ut3h͙jQ*t C0sHtS4KL9sщ}t:s@shuZ us@s`uZ @u;4mu 81t/sl`}t$CU[s@s`uZ @uEsd6CptSuZY@u s\hs8sXu{Z @u s\hte[^_]UWVSPuZu1iu '_tQVzYt=WEWu M MuSQVb[^PQSm uVGZSX؍e[^_]UPEPhuZƒ 1tEUWVSu\PhVR t\Mfnj4Zu\VXtd$1jRVmVhiS3Y @tt}f1RPhu Y1e[^_]US]uu S? @t ]]1]UWVSu u[^u Ks PY9Es.s ?VƋ}M)1Ze[^_]UWVSu u&[^u r PY;Err ?VƋ}M)1Ze[^_]UEPh^uOƒ Euqr UWVS8uEPhVN uhh0x hhg h4VW_ZtPƹ}[E]ShiV5}ĉjSPh4u ƃ SYt=EUu؅yكۉM]! EjEPXZuVh4u VV He[^_]UWVS1Rhiu4 @t|j7RPh>hSsހ>tVht] V3e t j7RPh>hSr;tShX] Sd \ e[^_]UWVS]h4SY^tVP(Zthh x jVh'f V.ƍUܹRhiS3@u hj$e[^_]UWh%1󫍅hPhiR3 t|}UWVS\Phu=L uhhy h0hme dShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPhVuK uhh z hhd uS1^Xu h5jh#CPSZYu h z hGPhpu n uh z haj"#Su1e[^]UVSSu] EPSV @uhy hj"hyV_ZYuhhy hhc pEuwPRS׾He[^]UVSSu] EPSV @uhz hjj"Eu hj-"hxVҽZYuhhz hhNc PhxSVHe[^]UWVS}hW肽[^u@m PpY@vhV蘉Zu hj!VPhW@u hjk!xtdPhiWp0 thқ뮉`S跑X`e[^_]UWVS}hW轼ZYu{l rP!pVYXuhߛDVShWE@u hj 1҉Uu]EPhiW/ @u h j S X1e[^_]UVSÉЉʉƃ ι.uQuRPShrX e[^]UWVSu1jS,Vhxi PQ @uh& UЉUPXۋUu h?j U]Vhxi WP @uheڋE9E~E1}~ WhW FXZ;u} j V Yj V SjQ UVSPuVZt"ÍEPu V @u Sh~jq@PP UWVS$ƉUЉh+Pĺ[ZtP`ƹY1@]Shvi V.j SPh+u)à VHZe[^_]UWVS0]EPhSF uhhy hfh_ MԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EPXZtVh+u LVHe[^_]UVSuV[thsV`ZYuhhy hh^ P^fx PS+ZYu h5jPX1e[^]US]EPhS;E u h &juS,ƒ 1Buhy h XZ]Uh( 1US]dPhԜSD uhh+ @u h X1]U1EEpPhiu+ t hқj1UhyugZYuhhz hh\ Phpu HɃ0 v+BwBÍBwBUf ]UWU1ERhiuG* @u h j=1}W|$wUWSÉЄtGjj hQPj]SS4 zt.PShR hb¸UXe[_]g_UWVS -uhy hjjLhB&& _ZtjmhB&& ZY¸ uWPSh+hp&T =h?&t VW?XjmhB&M& ZY¸ uSSSSSPShӝhp&T $Vj_K UEU P]UEU P]UEU P]UEU P]UE1҉T?&T?&1]UE1҉\?&\?&1]UE1҉d?&d?&1]UE1҉l?&l?&1]UE1҉Pt?&t?&1]US]ShB&@% YZt Vd =CЃ v؃߃Av 4d hB&qX Z>ud B&1]UE1҃t )]UUp?&t H9t@]UWVS81ۉ]܉]E䀖5Ĩ))EЉ]ԍEPjC ZY@MЋ]u hKEU׉uȉ}̋}5)ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEP胠 [@tEЋU ЉEhjvuGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEPY[=Ĩ)u4]늋U9ыUjSZjuB j4H EPjA ZY@UE]9u]9u9}~ 9UȋU}h$bjMUWVSÉHPZtP_D 1D1V9"LY@u hy h&RPHSƃ uhy hejR1RPhshWmiWVhM jVWZWhiLaF @u Wh6 t PhuM XZjVWZWh~iLF @tt Ph8M Y_j PL pHZ@uhy h$ u =`?&j:RPh2hW;b?tWhL W]T | j:h2hWa?tWhʠyL WT | tHSW?YXjVWYDž@WhiLD uhנ L XZjS#jVTW5YDžd1hlWhiLD @t|h{Xu hl@1dWhiLDD @@u h@lhTK @R訃 =_)t%owhy Rh+K Y_HS XZ=_)u0=^)u'DjHSDP jV`VXV^)-{k?PLlC @u˥=^)tYPjhq;˨)%X th4UX thUoX thDUMX tRPhOI hqg˨)j_ th4U^ thUY thrUZj LH 5X?&X%SV65p?&tjHSVv e[^_]UWVS]S^t EPu S @u Wh~ju ; SY)Etuhy h|jZEPi EZt hjhu1EVtRUWT ZYU}tRUuS ZYURhSfB tFE=ͨ)tFtj=̨)tFu[=ɨ)tFtL=ʨ)uE=a)u+Hu)}tj F Xh&v ZY U6"=a)tj F XSquiuٞ j@ UWVS,ÉUP(^uh@hS謪ZYucU̹ Rh8i(S @uLZ 8t hjjhuQ4 uh hjEܣ))u Vhj}e[^_]UVS։PCVSPhΤjWUWVS]U hS^_uhh h2hbO ‹)ށ؃E u %ERUNjUR4WP tDPEVDZYUu 9ER)~E ËE É)X1e[^_]UVSP]U Ch>SZYu X WPvS薷VP Ãt7EPS5)"Eƣب)S}1Fu2U)e[^]UVSP]U hTSZYuhh hhM PضSVP Ãt7EPS5)Dƣܨ)S|1Fu2U)e[^]UWVSS]U hS^_uhh hh\M Ƌ)%EV)VIWP2 ƃt1PuuCZYuIEM É)1e[^_]US]U hEPhQS}3 uhh hhL )%˃ uˁEU ى )1]Uhp&h[ XZUWVS]hS蟦^_u3hTS莦ZYu"h>S}^_uhSlZYtP) ܨ)ب)!‰)d$1󫉕tVh7iS @u hj e[^_]US] u?PhhB E tPL@Yt PhEB XZEP~@YtPSh!)B \y܋Et Ph B XZ]UWVSuV[u h/VYu1P4Z@u hԃ hp 81jS8PN8Ph8i(4D: @`%1󫍅`PhiVT @uhԃ hǥjE tWphץ A X Ht#t8uP9u Q XVh@ XuShxW _XjPtY^u hbj\8Ph8i(4R9 @uhH=Phk@ hgHH9Tt$hW@@ hgTj)J? j @? P4Z,H%(hץ? _1ҋ0t` xtO(9u 09t4#HɋL UuQPh!? ,딅u hf? ^j > YjmZti 119X~M%9u>uW><Ph? h? h'4j > F뫃 u]e[^_]9we[^_]UWVSӉϋuuJ0TZt2tVWPڢ u31ɉ [u1VZVQ Xe[^_]UVSu]}t Q j諵NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6uQ BpW*Y_u P ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP}< Ɖ׉‰ 9иr E8tmP 8"uo^P ;sC| C 9s} =P "WViY^u #P 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPX1e[_]UWVSÉUMU1}E;E t[ztMUj8l^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(Pdr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(Pf_,fCNj ֋$B$@tPN ^(SWS,o LEHVUE [@2Ex0$,S ZYu,Sh hja@PVϦVn uh hGj3SEpE0V uSh hajSXE}G }xG }G1e[^_]UWVSu]}t W]= Zv I WDUYuH #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAu}uE$EXExtHu E؋Exu[}t1}t.EG G }ue[^_]UWVSQu}uG EX$Cu S{0u3PE 0蒗YZun?-uGPRU? YZUu{(WR? YZuA{ Cu CuHPE 0?YZtPE 0$YZu^F CwH$ PҪ-w7O` w7`XZ1u(7R_uCPhjȋK 11PE 2Z@tEF EFC4FCF13F Ue[^_]Ujj$fZYt$І U PUPUP UPUPUjjfZYtȆ U PUPUP UPUWVSu] FtVuVVPjX1;}t$jaXt0TQ1҉FNG1 VuVVPRjXFue[^_]UVSuj(jeY[t2 EC1҉SCCuu SB @u SiX1C؍e[^]UVSj,jteY[tDÉ E CEC1҉S$C$C(uuuMU @u SiX1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79r9D GM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EV'EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u j^Zt$pSuCCC]e[^]e[^]UWVShʦuChѦu4tÅu'j`h hئ4E A  V袠S蚠Y[@8Fthަ^F1󫍅Nv󤍝tJvr󤀽uCU9 t hj|t uh"jPjSzPhJiu @t1 h>D Xe[^_]Uhp&hN XZUWVS, =`) ƅƅF1RhKiu3 @PXujPWY_VjWhQRP@ qpujPXZpVjRhVpQP hWZ8 $,hR98 ZY,tRVRSPh*, e[^_]UjhIiup @u hj1US]DD&9t@tu)@5)BX ujjS ) u DD&DD&]UWVS ]UUEt ;0uK &f|JxuEuE} tˆUPu f ZYUtC}t:=&‰EHffUtSUBf<fuhE9r^h E9rhӧnA X1_EtE &WtU0 &fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uS &f|PxtN=&119} fLOu0t ,@t@ޅtt SVhSPhT*) %h) Y19};Phh) GXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s< 1LuÍKكt :M؍AMPXZtfP׋Me[^_]UWVSQUU} uj[UuhRZu hjjPV5 u} ]e[^_]a! UWl$1E|Ru ul}UWVS,E u:[u h hj6Y@uh hjPx Z@u h hݍF1jRP" s3 ^_C xyDž@Rhi! @uh h ZYq:u]S `)PjjhVPRn u+t"5tVPhz& F~ Xe[^_]UWVSu FPZu9 8+u1hj\`%1juS3t \vSh iR @ux9 81tn9 8/th6账 Xpe[^_]UEU =a)uRP*ZYE EF% UVS] t4sVu1 ZYtC P;UuPVZYft1e[^]Uhp&hU XZUWVSSÉ։M1S>_u}uJhyjjhP:0 uW&DPtVh:iSf @؍e[^_]UVS]u1ɉh@uḣ hjEPhS u7 )EfEVh9iSƒ 1Bu hjze[^]UVS ]u1ɉ@uh hjFEPhڨS2 t,juV E؀8t-EPhS uM7 )EfEVh9iS=ƒ 1Bu hje[^]UUE9@t-EMfuu tURPhèz# ËPt<Pt2PPtPt )4øËtI't?t2tt )4ø UWVSljӉʋuFEE9s]19tc  ^w@v|UShW K 1UvAE9s:2UFPhh)ȉMP M UuRW u9utD7...}e[^_]) 1e[^_]UVS ]uVhiS @u hjEPh"S uhh hh,* E߉EVhiS uEhq5 XE1e[^]UWVS$]uӹ!1j EPhS?uht hjEVhiS @u hj1e[^_]UVS ]EPhS uhh` hh,) uVhiS @uhE؉EVhiS @u hqj1e[^]UWVSxhShu@uhT hj*DžDžDžDžDžShĩ\_Zu?Dž1ɉDžDžDžDžjSh̩ u ؉8 &DytRx:uL҃0jWVh\yPt;9u8tMhթjjRVjPdƒu:2 ;t 1҉Ŕ@|Phi8uƒ 1Bu hje[^_]UVS0]juVhSо@u hH hV6Zu Vhj-Uf@fEލEPhiS4 @u h,j*1e[^]Uhp&h<腫 XZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Phj&h@ [P\P <fDžLVhiS @t%fNth=_)t h& XfDžLVhiS @t%fNth/=_)t h9 XfDžL VhiS @t0Nf=) PhDg _X=_)t hLP YfDžLIVhiS9 @t0Nf=) PhR XZ=_)t h[ X1|󫍅|Phi8S @t}u(j  $PhiS@)_hb EEEEĉEEEԉEEEEE|Phi8S^@uhpO Xr}uMu u uuBEH~HE&DJtx:t~&jPhĩH uWhj ^_Eyhĩ Y111Pt՘hXZGj, DYyhĩ Xhn Y4t8hzg XZ hY Xj r _PhiS= @PhiS! @jh@ PI u ftePh [^Vf"fPp1Ph  ft Ph ZYj  Xe[^_]U81EE1҉UUUUUUUUEPhi8uF @u hj<1UWU1Rhiu @u h,j1}UVS]EPhSz  uhh hNh,! uVhiS @u hj1e[^]UWVSÉUPhv S Ǹ) 6 9|j Xe[^_]UWVSƍt1fDžfDžRhiV y h~jih' 1p)֍H(@!P }_9p}p' Džp hhhhBTh>h6hpph (G(\G!PO(!W Y )t  )E!)tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P-h )Sld`VPPpphˬ) G"`G!\ƃ0`*w/wNtA2FltU0W=_)FQSPhhl Ql=_)==_)$YdPh# XZ'd9 ʃlylRPh C\y빀=_)FPFPFPhh F1d^1ɉll9d&j> [S=_)FFPhWKStRTRPh%, RPh/ l대=_)FPh6 XZlF=PtlbhAh Y[=_)FPhF FPhK ^ fdV\ȫt5X\PQh!D \K XdˉX\lT\lXtWlͫPtګPtPt)4PQh! lX 렊dزT<\t=PuEFu:h^hG XZ=_)%FPFPhc$ t#=_)l򸴭h^h Y[=_)FPh| XZ1D dD ҃L ll\ltdRP\Q4 h^ CuhhA [X=_)FPhF# FPhK ^V l\lȫXt5dlPQh! lK dNjXfld\ Td\tR\ͫtګtt)4PQh!/ \K lXkT؃dPhR ZYkl=_).N=_)'$ }jtsoti[`Y RK!D)=169/C(H!QZa uF)`j  )hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh3 XE1e[^_]UPEPhɭu uhh hh,k ME\UPEPh0u> uhh hh,# MEUVSjjj" y hҭj \1ɺxBhPS y h1 ZuufiuSֺXe[^]UpPhiu< ulhό Xl$Eu hjEE1UPEPh]uF uhh hAh, MIE@u h9j1UPEPhNu uhhЉ h4h, M E@u hUjO1UUڀ tr t M| Jt1G&]á)t H@4K )USE UUXt=EEEE1҃UjURPk 뺋]UE PujJJ Ã=)tMUEE EjjEPEPjEPHGƒEBuhǮXÃUS E=)tF9Et:EE jEPjjjEPF@uuSh5 ]UE PujJI UE PujIIj肕UWVSjM N^ _9ȉ|+)ډE܉UE9}| F@ 1F11~< uEvh"z[^E=)t*h)ĺYth)F$0hH*jD tvhpj誔 ~(]tz蹰 uvhXZWuS1}}}}jSj t y hѯYF,P0vF,0hj j%Z1EEEEjSj讴F$P0=vF$0hP jg e[^_]UWVSӉι1j P+ f6j SP E8}u Ef4S v\jSP P,uPhDoXZ e[^_]UVSыX u X(upVpɃ0Vp e[^]UE조)tQMQUEUUEjURURPPtEphhXZEXUSp>C YtP>s$>XZC(tP>s,>ZYS>X]Ã=)UWVSƉӍ1Phvj P fDž6jEPЛ ff>ffv  ![^]USh;h)h*hS  S萟]UWVSlE`E]U1EqEh+R uSEPSjuV? @uhEdUE`EEE1EsEE\EhR uSjjjV> @u hdXe[^_]UZ=)t]]#UWVS)t `@41Ɵƅt(G)1tQCP6 ZYtH؋[4)CuCCt jP®XZ[4Չm댃K9tWPsh;CF t~u CC)Cdu-shKCZY#jP?[^1ɉK K e[^_]UVS֍XjRSA tjVhhSASAZthhSA e[^]UVS=)jh)j|PhF @t`E EtXE9EEEM|MQptAxjpPj αd )t{t C1s41))tPP^t hڱfYjjjjj )t T1;h7hXZ =)t,ڀ %F6tugK e[^]Ã=)UWVSEࡰ)֍UUEj}WURPP ECCEE)jWPP tsh.X^_1҉1ɉKCt-C0S4tP4)S4tB0؍e[^_]2u G&M| CjCP~ XZ؍e[^_]e[^_]USQ1ۉG&u +)tW{u/u G&M| 9CjCP 1XZ[4jEPj-t tUkG&tڋ]USS)t H@4jjhhch<k>hhch<V> 14 j`ZY@t1҉)j Y 8uM=)u) 8 tjEPjvs t؋U 8 tCuh>UX ]UWVSd15)|~11ۉ]]]]]E}W]Sj uVSj ˣ Ãjhk ZYukx[1uuuujEPjE1}jhhEPhRq hRhݲjj u6hy[jjj5r jWj jVj j1ɉ G&jEPjr u 8tvh0Z6UE$E9uW,Ph|jWjO jVjE Eƒu+=t$hbjS" =G&^ =G&tjWj jVj G&pÄt8=t1 SEEEEEPBX)jWj{ jVjq * e[^_]UWVS(蟡 Åu1EEEEEEj]Sj jSj  xEEг1=)uE1ۉ]jEPj蜥 t%h)˪Yth)hjP VhRhhRhسj* hhRh jjjo jxZiU9t/jVjoǃ u 8thhRh&Ẻƒt(ƒuIhhRhrU y=thhRhQ0jSĥq=tt9u=G&r uEEEEEPXu} e[^_]UWVSl1=} (E`jjEPh)h虤@umh Z8EPuVh+^ @t5U1}EEEEj`RjjjV3Vu)uh)r _N9t h״^-h\h) ZYt=} uF1)1)jjhhnh< 8hhnh< 8 É؍e[^_]USQjj]Sjjh G&+3thu%ȭ)Zu hbjjjSPjh G&2u‹Eĭ)]USš Phhp&x hp&h& Shhp&Y j UE E ]R UWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9tt (  9\$ t\  @ 11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9tt / $ 9L$t\  @ 11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]t  $09tu\  E@ 11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9tt  $9L$t\  @ 11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]t  $9tu\  E@ 11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]t  $9tu\  E@ 11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]t  $9tu\  E@ 11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$tt 9T$\ uwy|$y|$L$ ˋL$ ˉ$4$19tt 9L$t$9T$t @ 11 [^_]Uh- jjh@G&u 1҅tPUWVS jEP2Eu_X1E9}2uSP ZYt!SPt ZY tG1EEe[^_]UVSQË0tRVh"EPV(ERvZe[^]UWVSQ1:nuzouPHX1҉Uh\yP荪ZYt98nuxouSP,ZYu}SP,ZYuE1V'(Ee[^_]U诛 PPPh(hp&b j UWVSÉϋu ,PQZYu Wh1}uHt*hV^ ZY41Uu1u4h\,P ^_u~u M }jPZYt1ihVjhWy uU jZP,P@ t% 9|\ 뭋QRS u) )u1BhWj Vh EtEtEtEt6 u0P,P6ZY@tjj@0^_,t#jhS uhոV Y[0tShShhVp 0 ,Dž@h\y,P XZ9 PWXZڄtVB L<-u.1j=V@ Y^t$S@LS4Q ,t1ɉL=)t>}uh _17=)u卅$P Y@uNhl XA=)u}t2ҋ4h=2 GXZ9j E X=)t=" t t6h(k X t =#XP0#=)tj}t0$jj(@u h0k _G&,W3h*h,R P,R| 8tV,Rh(Mj ;ut 8uWVWhj jw t O"[PB"Y}u, Ex]( jj WS$ ~)t}u2h&,Pv XZj P$螖 ~j,PZ` @uhi X,Ѓu ƀt&qttP)PVh# H}) )0SVC2Y_@uVh"Ni XZ e[^_]UWVSj Ph-= ;11to tZ t =)t> FWtUQPh! !ǃ 끍W.WtUWPRh@ udtjWtUPhUT  t 0h hy) XZ=)KtSp+F=)u=)KtSpWtUQRPhc =)hUh sds`sTsPhu slshs\sXh 0=)~chSjjhju.t%j Sl ^_tSh h$- Y't\Ph XZ He[^_]US] 1t-tPu ZYu)1=)]UWVSEt48nuxou )P X1uhp_ f X1Y,u@B uP_uhbe S[^ljxj,SM ZYt X1e[^_]U Phhp& jW UWVS]!11tE1҉91&111ɉplhAu uP 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVSh"謸,@uL t"t"| 0.Z3tIPShxjҦjm UVS]u VSaYZu ShjѦ;/t"Shd XZu E e[^]M e[^]U菊 Phhp&D j UWVS]E1ɉ#11d111lhhu u HuLf$M,9tQG.C|g$@ UC| C|C|C|591 CpZDžlL591CtXDžh.591CxX591Xjuh 591u hjPX591u> XDždC|&P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPW] Y^@uRWhjRxPW] YZ@tECp'xPW] YZ@tǃluECpECtuE%CxdupV\ Vr @$XZK|ǃe[^_]UWVS SVdPhWu u hWdShVӴ,@uSVhjbf@tKRPh| hSSh  0j~ USP]jEPS^ U :9uySu h.j蟢]US]SZt@ heSZY]US]SSZt@ hSsZY]USP]jEPS:^ U 9t :uy Sh@j]UVS]u VSYZu Shj;/t"Sh XZu E e[^] e[^]UhEj譡Uą hahrhhƽhPh,hp&` j UVSQÉj EPSb] U:uVShFj?e[^]UWVSuEE@t") 1VFe[^_]PɃ _u hp_jVP ZYujy ]e[^_]LUWVSQ]E10u1G&hu u腷 2F$@ =h)td)뷃=d)uh)c뛁K뒺a91C8K t l)hK\cPD91jC@K@2K&g91@P蹮s4K ,I91C(KK@KEPuh@ 591Oƃu hjjEt l)tctKtK@tKsK t=h)d) s=d)gh)c@tKt1҉,H&sc sKsC  sC sheV"`)Y_EthqV C$KXZEthhVC KY_EthnVC$KXZEthwVC e[^]UUM B<t<ufJPhjAUVSRuEFxP輀FXjjpV} à yFFvpjEPjjSHppSJ(ujuu S%} e[^]US]CEEiEPjEP!ƒ Jujuu sF]UVSu 1҉uuuVu~C9@)u7VJu/^˅t)v  0 0Sh h e[^]UEH؋U PEf]UU otzȉEEȉEE1EjxPjEPjjhuA w/ 0Ph h# HxUWVS]u uu uQ fMA1CCS1CC@)@@)ȉC1҉SCE ȉCЋEȉCԋEȉC؍~E$PWh4 E\ YYPP40 \ YY04<8[ YY8<D@[ YY@DLH[ YYHLTP[ PTXȉX1\ʉ\@uꋆȉȉ ȉ $ȉ$(ȉ(,ȉ,40Z YY04<8Z YY8<D@Z YY@DHȉHLȉLPȉPTȉTXȉX\ȉ\e[^]UWVS ]} ȉKɉOCȉGC ȉG CffGfCffGCȉGCȉGCȉGC ȉG C$ȉG$C(ȉG(C,ȉG,C0ȉG01T4ʉT4@uE\TtyLup1TTʉTT 3M1ҋMfQfMffVBu@ uhPP$o ȉ MCTȉEGTCXȉEGXC\ȉG\C`ȉG`CdȉGdshΉwhClȉGlCpȉGpCtȉGtCxȉGxX YYMU tEȉEEȉEθ 3U9$| ʉ@1\TtIMًU4U9~ ʉ@EP1ɋE9~f4Kff4HAe[^_]U11ҋM ʃ=u‰]UWVSU ]u:LABLt ߉։U fCS_fCU ȉBȉCB ȉC fBffCf9Juftf=vfCDGW Y^1e[^_]UWVS]u u1P}u}u EP= XVK _=v1LABLCEȉC ffCRVCP! uuV Y^S~fCe[^_]UEU 19s f3P]UERPZYW|$wUWVS,EӋWEUGW E؉U܋w 1҉j EPS EЉUԋU t5zt SuhT]$ 1t<16 1Ƀ 1Ƀ 1ɅtuRhsj1ɋuЋ} t1M_ 8"t$M tM9uM9t Suh맋E9ƉU}7=)tuuWVSuhS uuWVSuh?9u؋E}<=)tuuWVSuh uuWVSuhj'e[^_]g_UVS,f =)tPhhp&ؼ hPh hp&込 hp&hJ iG XZ=) ttsh9hp&} j, =)u UP UWV=LH&uHH׉=T)t&ɉ HffJ=LH&u f@ffB^_]UWVSƉ˃=)t/=)t 1}mQ)X)Pu8i Pס)RPSu5)k9t  0PWVhf趸 j"- e[^_]ÅtUWRPR Y_}Ã=)UWVSSƉˋ )=)tSu X)Qh S׉ș։ЉEMRPSu5)j9t n 0 PWVh j$| e[^_]Ã=)2W|$wUWVS#Å=Դ)uд)BB4)Դ) ) ;))ؙ=д);|*9Դ)_1)։ؙ5)pؙQ Y JtRz!9t !9t ҋ1҉ؙ=)Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ д)A Id t15))X=T)t)5д)PPV )xU thF{X)H xU t@\M؋]ȋM؃=T)t)5д)PP д)A Id t15)д)̴)JH,1X9M؋}ruuh` д)\E1ҍMQRPuuVlj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuuWXK` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05)д)_\T)@xRPuuVÃ=T)tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu; %ClRPuu.VÃ=T)t]Su,XZ1EtttpM Y_DpTtF u1EM Y_Fu @ߋu %CPд)H05)EЋUpXe[^_]g_UWVSQEӃ=D)1}=LH&tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Shhp&ʴ ]W|$wUWVSLEUȋ д)A Id t15)yY=T)t)5д)PP )xU th1҉U؉U܃xh}_1E؉Eд)X`u؋}܉ tu}}zU tStX~KM< Ʌд)@8EU܋)J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh8hp& Nt% tSt1\uWEahUÍ Í ? # Shhp&萲 д)$~?)EE1uԋEЋUEUClM )EHд)̴)EHesE@E=LH&nKdu؋} t1RPWV5W}WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV0UMQuuRPSEыEȉEEeƉϋMUeuuRPTEȋ}EЉEeЉƉϋRPWVU}f E9C0u'=T))5д)PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋) д)9A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 д)A Id t15)$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1󫡠)=LH&t@fxfDžA© x‰|fDž I&=LH&tK&д)@40u 1ۉ,д)@DJL!ȉ!؉ pZ4JdQyt@f fDžA质 ‰P(,iKL04H81Ɖ׋ȋʋRPWV=9sv Dž19s H11WVRPBKRPAȃȻ)щWVRP =F 041~ H`9))HRPSQ@1ɉ+<؋Fȃ1~H`F9}Sh G д)C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=LH&(C|HL!ЉjjjhjC4PjF £̴)uj'Ǐ д)H41д)H)̴)ȴ)H4 ډĴ))ʉ)@`#PL ~ PhHH&P<h)PXd)P\t)1҉PTX Hfǀƀ д)%ƃC4D8<KC,ș)׋C)ȋ1)׉C8HK` tƉ׋Й)׉!lj!׉11ҋ!~ ) 1҃1)׉@D04=LH&>C s(H1@)t ǃ^F=)s0Kd t1RP߭ڍlVV$h輒 д) ؙy8PۅI4WW$q,h:w  д)A0= @ ))=)u\Tu kУ)jjjhj5)jA £)u)9)uhtj&` )1=)L))9|RPh謑 ))5) )H [t?t  Lș)FOu뺸2=D)t?jj5H)S$=)STb )uPؙVpjV uؙ=)VY)д)Xlj=T)t PRXZд)x)\=)~ h1XDž=)~ д)A,XÉƉ׋ǁ\TtA!A1׋AId t1RPhjjF f&&ftRhht@P* DžPu ft)=)tu1'1=д)1w,1д);x, h&dk д)1҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h(_д)1=))CU C )C5д)$~N`Cp=LH&u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=D)uCh|{lN`Cd9sh"%P[)д)P t+)lj1ɉ1xU u@\€ )H xU u@\€ )H ?xU u@`¡д)@`д)$~%)Bl5)Fд)=LH&~!{8)9rKd1VT~U uVT~U t PFXƋP1~FKd1111f3д)@8P!tx ))D4)Љ)9s?zU tR`ك 2)B$C1ҋ9r)д)H`艅 д))BY89&zU tR`A`д)$~%)Bl5)Fд)=LH&Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rNд)5)$.Nh񉍸Flx1Dž1҉)D4);xsxU t@` )@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹ȴ)Bȴ);Ĵ)u^=T)t)s4PP )@)д)Z4Jd15))ȴ)д)H41[д)Z0 } )؋5)=T)t5д))P5)4 д)X05)ދvxx д)\t4TuU %FlC %CPO붡))𙋝ڋÉƉ߁TtAЋ!A1׋AId t1д)Y\Tt=)]s8)){0ƉK`Cx1񉅰69s)9s) %Cl뀡))9rߋ д)A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==)j.莂 X܋ д)𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1guWVRh@͂ 9]=)Dд)P,t,=)t hL耂 X1j 聁 X1b~j ] X=)tjtx|m_u=)thIv5д)04=LH&0FF4+=_w hajXI)X󥋅`1=T)tR5д)蘾[^)=)t ǃ\8 5д)x\󪡄)RP)SMY=T)t̴)д)r4PP蔽 д)X4HdLH t15̴))Z;ȴ)sE=T)tд)r4PP8 )@)д)Z4Jd15)X5)5) д)@4P5̴) eY[^_]aÃUWVSu]tVH_uVhM&jG`1ɉPhd@u k tGRhedAu -x @u!譒 8tuhd& XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(hnƹ ߋSh|&VnCPh&Vp C Ph&V|pCPh&VmpCPh&V^pCC,$C,Ph&VFpC0Ph&V7ptPM X}!uhzd@u v @RhedAu v @uuh&jE41}󫍅PuS ^_@4ȋ9襠9t(Ћ}1ۉ1E1ɉ [Eƀ*P̏j PEPw 1e[^_]UWVS4}jhPjW̚tGjPjVWV&+u$U ʋMQ؍e[^_]UVS]u VSYZu Shj_D;/t"Sh XZu E e[^]ے e[^]ÅtUWRPr Y_}UWVSuuuuÉ֋EU)jj`RPNju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8CUWVSƉ׉ˋ )%)RPSu5\)(9tWVh0 h*j>e[^_]Ã=)uPUWVSƉ׉ˋ )%)RPSu5X)^(9tWVh hIj=e[^_]Ã=)UWVS==T)u14)$)T) )11;))4))9r(9T)1)Ӊ5d*pPY@ JtTz!9t !9t ҋ1҉15)1ҍQXe[^_]W|$wUWVS$E։ϡ$)EP9EYuh hij%<H) 1RPjj P)f|uPjj h hj;B 8)1uME@Ztjj h h^UBP)@ 8)1u $)P)fK 0)XH)<)19։rWVh hjB;P)1ҍMQRPWV5؉EءD)RPuu]؋K1ӋE؋@(1҉¸ڋ 8) t1E؉Uu $)D)RPWVbM&؋EÃ=l)t x)ߋuEfEf%f=u0 Cdu $)E؋UouϪe[^_]g_ÍC(u(UWVSQU=P)f to$)9reSXtX 8)1V@)_9r)u $8u@)t%1ɸAuV*[1uˉ8كsh hjm9 P) 8)1V $)aVéP)fH ZYesf@ ,)4)؍e[^_]UWVSj8P E \)EX)5)F[_tVh)C!؉t Sh8j8 )9s QShcwhVhj8v hVh9t SVhסM&=M&f uft Whu @$8) <)5$)$()F0)4)أ,)sË f)É$8)D)14)x$1ۡ))9׃}SQRPh]jW7$ t$$)D81lj 1=) w ) i;)s))1 1XOt t \Nj)‰ 9sCÉ$11  D1ȋ )$5$) ) <)@)1H)M&ƻd1()@)D) H)1ɉ L)8tDž111 P)T)X)S\) `)d)N1=h)l)|)))j fp)Dfr)t) fM&fx),PDSXZ,t hSh)m)Y^t&SMt Zv h\jSh)g ) )1))l)@)|)5@)$)$)+4)1 v1ҍN11WVSQD19sȋ)Ë H‹ )9s؅u|)f))QO£P)Xҋu h1@))|))fH)f fӡ4)|119 t4tu )HtHKC H9u )fC tfCfCF@<,)0)=)$Ɖ5)5)5)$)й1PVuhi @) 5H)P)P hri @)@$)`*jjjhjPj £d*u ht `*1=)up5)=)9| WVhORR ) ^St1޸ =)~ hf諯[Dž =)~/ H@)4)1RPhjjg f&&ft0Rhht@P` DžPu2ft)=)tu1ɉ$1҉1 1$$9 h&3D X=l)t)t$] )$fz)$@)14) d*$) <)5P)5`*)֋$ @)4)ȋ 8)15)1SX$)`)1׋<)H9$u^@)$)+4)$)ȍX9s`)@)‰э`)1ۋ$~9s ƃ`)C$_9sك`)C׋$P)8 8)1h`)H)`)1߉$))Ѱ_$t;P)D0 8)1h`)~`) $)1^1T1`)@ u렡P)| 8)1h`) $)F[;5H)s"1;=D)sM&| Ŀ)G=)'$=l)t)t$~==)gj.c Y܋$@)4)1ҹguRP Qh@2d 9[=)B$<)t,=)t hLc Z1j b X1$~j b X=)l=l)8|)u )"'O&/P&V1fDžT` fV8\`d;flfDžn$)Ɖ׉1҃ $((ˉ$ʃv)uh hXU| 11EET$Euh h 8)$)S_uh hPS$Yt @)1h hC'91҉C4)D1;<)19 r )$1 8)1$} 8)CX)=$) @)9 9GPh hy{)tЉtF 9rh h@)‹ȋ$ 8)GB 9s11ɉ *\T&h&1 hp&1 *,*g XZe[^_]W|$wUWSøth+hJ%T XZ5x*hgT 5p*hT h+t PhS _Xx*t?p*9} hS [()hMMEuQQ$hS j R p*Z1\+h+EEH*ۃH~-@*]PP$sRR$SP*QQ$SEWW$S hT&PP$ShR <\+**!]**Ezuٞzu=p*\$=x*$h_R e[_]g_1UjjeZ XZ1=p*PK U=`T&u =p*ujhr+uZ x*ZY9*~*\+ueUSá**xFأ***wr\T&y1]Y]W|$wUWVS*x*ff"*t* *=0*9=$*u ;,**f *f*]f*1Ej]Sjj5H+#4yhJ[jh+jjh*5H+jy\+t hkF _EjSjj5H+3y hjvh *jGC[^*t*f *\+ s$ ,*ɡ4*ȉ $*(*s$*,*+}f*Bf**4fpjh(+jVP5L+kÃ9t:y h@ YSVh+h,f hp& , Z1`T&x*% x* +x*@x**,** * *u*,*,*,**Av.}fE fEm]mE* *5X*=\* * **`*U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}* * *,**H؉ * * * *E**=ɚ;~ * *-ʚ;*h*rW X*\* * * * *`***=ɚ;~ * *-ʚ;*\+t ;\+te[^_]g_UWVS<ÉUM\+tUUEčs}uyMăA}9}fE؍t E;t*uJ1 *$*u5}t4\+u+JEPuhNL Ѝe[^_]W|$wUWVSEU܉M7C]\+MQURuhK t hK XWhK \+Y_t,%E RR$PhK ]+t"uCp&e[^_]g_Z@u6'V>XuX }u MU1 +U1EDe[^_]UST&tuPtG ZYtC]UPu*fxu#@Phmhh +:  + Htu DPRPPZU}uE ҃' huh RRhjPPh{: UEt#t#tPhRh0: XZUVS$` E׉Íu 9stMtJ@Sh]: XZe[^]UVSU#tYE uLjjEP~ à uU1j.0M Y^ƅth +@PE YZuUuRYZhPh +S4 +e[^]UUE Pjjhh +PR %thhmh +D +UVSE UMYt @ȅu˅t6t1R )˅t8u3jS\NZYt%u#hPh +3 VShhh +7 mVPRhhh +k7 DσVQPRhhh +F7 VSQPRhhh +%7 +e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uh#h +M [^vthM YEPjjhVPP)"t hmVM XZSVhhh +H5  +e[^_]UVSMQ +Q!+يۊ@ BZ@ XÃ@.)օ~=+uC +[^]UWVS uE Eԃ=4V&tL1ɉ 4V&hh + [_u(j.h + _Zth@Ph +C0  +uhh#h +0 F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP[^uԍEPmZY6e[^_]VPFPhhh +3  +e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPhhh +@3  +]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV_XUЅҋEtuu SVZY SPV }yE Ee[^_]3 tEEԉE EAe[^_]3 EEԉEE E0e[^_]3 UWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]Sbpyho)Euh SzXe[^_]PcXu jj(jjVWjSpyh݋EEh zXE9^CU!‹M9A}tSyM9,sxEt  Cy;8V&t8V&PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h*h*h21 &H &$yh&j *7 XZ&P& }e[^_]iUUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һ;~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(US PhBhp&2 Shhp&2 Shhp&2 $Shhp&2 Shhp&2 Shhp&t2 $Shhp&a2 Shhp&Q2 ShChp&A2 $j( UVSƃ=$+u@Tjj hEЋU RPjuV@'jj hEȋU+EU RPj}Wޟ@WVSh!! M]u؉uEȋU+EU WVRPPuEЋU WVRPPuWVM]SQPhN]! W}MMȋ] }m]m]jj hSQj]S@jj hEЋU RPjuVٞ@jj hEȋU+EU RPj}W覞@Eu QQ$WVSuhuh|M]u؉Eu RR$EȋU+EU WVRPzPEЋU WVRP`PWVM]SQMPuhuh $uVXXeY[^_]aU Phhp&" jC UWVSƉUσ=d+u'jhd+`+ZYuh5 [`+Xi d+}u)VUP'+ ZYUub`VUP* ZYUu9Rhh`+$ƒ `+uPhjK k1e[^_]UVSƻ@V&tPV* ZYt%Vh)5P,]! x, OC St8tPRhz Rh!zZYuj 3h , C,,묍e[^]Uj蒷X=$,t%P,fPftjhPV jh+~UWVS=,5,ÉDžu¿<RWhJ5P,e 5P,2 PhPh&5$y'1=0,Sh[5P,  &fDHfn,f?trfauH,Shk5P, (fptfqt#1҉,5P,hWY[C10,Sh 5P,y &SSh5P,\ e[^_]Ã=0,tO=$,tFUVS5,,,1ɉ ,1U5,,u1҉0,[^]10,U+jtZ=,uj}X,t,jbjh+|UWVSxEUtk1ut=tu&DSt1@֋]څu$EE%@ &t &fBuӃ}tgh@," [ƋE]tC1ۊT,t8u9s&H@, CuݍHȋ])=~ E봉EE} %Uй 1]1@,trtl$t\uF8PuQ@@x0~-H8tWDЉ\C8tu\:u;81ɉLЋEǸ@,:[tL\t$ HWыu)@,-x$uvX&DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2&DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5&D^tS@0uU tZBGOu)~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuP\ EE5P,hjEEXZ‹Ee[^_]USEU t~M譣g@V&P,tRQh!P9 s Phޤx,ZY/t!h ,h5P, 1x, B]R]UVS]5 ,u9,twE ,u1 ,@V&8t 9XtShj@u= ,th ,Phs Ph!sZYu,5 ,e[^]U}u膢x,]ø]U}uax,]øՔ]fU}u<x,]ø]AU}th`,h5P, x,U}th,h5P,z x,U}t诡h,h5P,F x,UWVS1}uEE PPEu THt}6hJE PEP uhUE PEP t}E pXE Pu F4, 0,t!tVWjVjjhRSySA X x,e[^_]U}u]U}u ǖhhh)5P,V 1x,UWVSE]uu1҅‰uTpuCE xhWFZYu u0HhWFZYu1t/* uPVh95P, e[^_]UhAh,u uIx,U}u͕x,= ,tP,E EK]]Uhh̢,u ux,UVSE] u1=Ȣ,Ȣ,u{yt KshVEZYtBhVEZYu 1Ȣ,4V۾^sh5P, 맣Ģ,Ȣ,노Ph5P,y =Ȣ,t5Ģ,h5P,W 5P,hȢ,Y[t1҉L,x,e[^]Uhh ,u ux,Uhh,u ux,UhhL,u ux,=L,t1Ȣ,Uh h,u uMx,UVSE] t~ Ɠ1=,,u=shV"DZYu,hVDZYu1,9s>,^hsh+ ,+, A ,,8uQPRhS5P, ,x,e[^]á,t8u5P,h.1,ZYƋ ,Uhvh,u ux,Uhh|,u ux,UVSE] u NuoshVBZYu,,,_hVBZYu1ɉ ,,,HV軻Zy$sh5P, 1=,,,,t  1,,PQh5P,9 1=,x,e[^]UEu\x,HuhE PEP tЋE ph {aYZu9=x,uJ= ,t5P,h`XZE ph =aZYu,,1,USUE x,u +Pt ]鐐pYtePZ@u Sh @ض=,t"h,h#5P, 1ɉ x, 5P,h<蕑XZ]]j<]UEt~x,=HuhUE PEPM tӋE pha%`ZYu ,USSEu觏x,HuhE PEP t0,h_jE[Xjh+cXYE tE ;u1ɉ 0,jju 蚯à uu=0,tڋtShaS_[Zu ,E =0,u=$,t,,1ҋt0,,tuj(XZ1ɉ 0,]UEu}x,}Ht}6hiE PEP追 uhsE PEP褽 t}E ph{v^ZYu!E ph_^ZYu ,UWVSUU] 3E=$,t5,,1ҋE _¡0,t@0,5,ujΗZY1ۉ0,EM9t EPr6Xe[^_]UWVS}u <jj耗 ÉXZS5CYujjPh# à uRj/S_ZڅtPhRW =,t65P,SيP,HQPY^y Pj  Y^ J }~j5h,hWS? jWS? Sh} x,ji ~P_Z9uWjo[^WjcZYt1 hY} Xx,e[^_]UWVSPEEu蛈x,%Hh"E PEP EwɋE ph+X^_t 5P,h3褉Y[}hBݪZu ]E XShM_XS 1 t뙃}hU蓪Xu ]E X Sh_XSE 1 t-U}u"E X Sh_WS 1 ,/e[^_]Ux,}tF=,t =,u#í=,uP,E Eg|h,h5P, 1x, Ux,}t׆=,u#<=,uP,E E<h,h5P,D 1x, UEuvx,{HuhE PEP tӋE phVYZu9=x,u<= ,t5P,h}XZE phZVZYu ,UEuمx,{HuhE PEP# tӋE ph$UYZu9=x,u<= ,t5P,hXZE ph#UZYu ,UWVSu huS 9}1hE4Sn F 9~hhgST GSh?UY[Hu jNZ,e[^_]UEu资x,/Huh+E PEP tu uh- UEuix,/Huh@E PEP賳 tu uhZ UEux,[Ht}6hE PEP_ uhUE PEPD t}E pph`T USE ,u螃x,2 ,Hu hqSYE ph|SXZ ,]USE ,PvAx,2 ,Hu hxSYE pheSXZ ,]USE ,ux,2 ,Hu hSYE ph SXZ ,]UE} tu萂x,=,thRXU} t}uTx,Ã=,t jjXZj`Y=,t jjuXZj} Ujjjj UWSREEux,=uE Xh{Xu]Sh_RS7 1 e[_]UVSEu0Hu$ZYthV-$Y[t뷻wGZtt(,t$,5$,5(,h5P, 1x,e[^_]UWVSPU} uRUyZUuUE 0P,Ee[^_] Ë@t P31ɉKXWħCZ= ,ttP3hF5P,c e[^_]USEU x,t tt<]rV&t8CuPRj h]5P, jrr 1x,]UVSu x,}t e[^] rvxXuvh05P, ,Ct P*1҉SY3hf5P,r 1x, e[^]US ,}uqx,<=̘,uP,E Ew]r ,hA ,X]USEU  ,Hv4qx,P=Ԙ,uP,E E]rr ,Hu hJAYrh:AXZ ,]USMU  ,Avpx,Y=̘,uP,E E]q ,BuPh@XZrPh@  ,]UWVS @Eu} t.px,AHh E PEPu tЋ5 ,} 19~j k,Pw t*Cu%whX5P,p x, h@hP,P 1ؿk,X 9Xr&DP@tCP,<$t<\CFC &K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP,)PE 4V E 43߿iu6CDžؿ9}~),)PE 4V E 4 ƃF;r<,0oXu 5P,hu!5P,hyox,^X~ t=,u 5P,h΃= ,t:5P,hP,3oP,HQPYYy Pj  YX J j 6R <,P58,V =,t3~t-P,HQPy;P| J Pj XZh@PhP, q8,E<,E 9XCؿt G9}ce[^_]USËt P1XCt P1ɉKXCt P1CZ]USd+jyX=$,t>V Phojd]S ~!P,fJftPSRy jh +@USdjlyX=$,t> Phjd]S ~!P,fJftPSR jh +@UWVSƉӋ:j:WԳ YZuWhV豦 :W耠PәYZtj%W衳 YZtWhV{WC uf{P Huf{tCPhZVI h=V;XZe[^_]UWVS ERU ZEE0U;OwuCuRS uCEÊ u w)tu C;OvE1e[^_]UWVSË@t P1s_stV Y1Ct P1CZe[^_]UWVSljӋu,u<MP^wEPMQSW螪jFw>yFE8 u@EuhfXZ,HEHwuE1e[^_]Å8UWVSH%Pt=&ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u hjpljjhPУ uW1ɉK fCPjhW詣 uWC fCjhW胣 u WC _t36v CvCF C FfC (Wuh Ef: j/RU ^ZEUu R蛜8)ЉUHQM!ƋMQURP { uEubCYj@V药 ZYt_{ u1҉,Mq@P2j:EpZ t@PMAYE@E@tu[uvVj]RU YZEtH:UttWuVh)PERVߊ MVu WuVh>tEx:u-u%p/Uj:V蠮 YZUt>t3 3ׄtK3Gpj EPV >tU:u PvWuVhc/fC*C tt5,u5,tVњCZ{u]{ t\P豚CX1e[^_]USZKJy ;J| t Y RP XZ]UWVSP1ۉDžfDž1jhPi jPCZY@tt8tt8uVhruDž8tj;P![_ÅthP4ZYtChS#Y_t>hS_Zuh[gVShDž DžsDžVÉj@P: t1҉,@PYj: ^_@P輘[H8?u1;u11ۃ/j/SںZY9u$uHsjh\S cu)uR,1ۅ%pu'j,u911ۃ=,Džt*1;t%hS ZY11u @11ɉ>t+hV՘ _Z1ɉ=,=,t jjvXZ=, hPWc 1 t1ɉ,1҉,QPp,,YZu u*)4#Hu9z uWh u Pj踾Pj艾Y_t ;1$j/S _Zu Jx;hhܝR 1ɉ ,Pj=,u/; =x,hp&h$aXZt>ut>uGt>t݃t3hSSg hh\SN hVSB $hhS0 1 tL5,1ɉ ,=,t hh hhS Wj;5,F,uj/V貶[ZtP1ɉ=,t WjWjXZx,-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh +92ZYu PY[@S]^K<$7Zffu0t#;thZS ZYt hd3t$?t?u+u =,uhYW衑Y,,,t <,j/P_Zt@,P[Z PHY, t 8uthc1=0,=4,8,<,DžtDžx=,t0 tRPYQ ZYu0,4,D,,hށPA^_44u ,4Pחt$PP Y[u/tx8,<,50,=4, t14Pu1҉$WVP y,Ph= ,u=$,<$,-,Ph5P,X 0,4, P, u5P,j I[^RPhQ hSh + Ș, + ^Y<,058,qXZ G뮋[ PtP1PXTtS _1󪋅TtP1ɉT[XtS Z1󪋅XtP1XXLtP/[yh* hj{aZY,u<P$a$P覐[^44@P_Xj`X,u<P`Y= ,u 4uvhC5P, Ӌ ,t+PhVhR5P, h^V 4hpV hVڍ_XhV͍XZ=+twhV賍 ?4, 0,tP5P,hVSY[54,50,hVv54,50,h5P, =,u&4h Zt6PhV% = 4<t)PR_XhhhVt64u1VO1U94uVuuUu@= ,t;Rh5P, Ch4V) u&eh4V t== ,t%Rh5P,y Wh.V͋ Wh.V輋 t= ,t5P,h\Q[^4h=P艋XZ4PY@uhHD 1$]j][<415]&覄É`h$ ]&ڋ_ucj S ZY@`j lRPG lt&DB@`舄_2t1SDžDžDžDžDžDž1ɉ\P ]&ڋZ\d]dt:j `Pd 8,<,`8tmdiƅ$ dOud8*u@j pVPX >p8-/@dj VP" 9pd8/Pdx*u,j pPR pd84, 0,Gh|d+tXH ׉dR(s^_Džh8HR, Ytxdtd軁2dt]dth.Xrd`ujh ^_p@9/d'tCdƅu IdutPMYVZt<oZu&J4, 0,h[!_t 8uhڡX+PX+~ h^} ,1uQu2P7ZYu SiXh XtSхtXSJXOtS1Xt _t [uRh)DžDžDžDžDžDž 9,u h*P ZYu Dž8&\ 8|uQjj VY[ hF@P5^_88u @PhDž0I860,4, !At9Nj}3uNuE8, <,!F9= ,X5P,hHIXZAu t=8,=<,9u 9t PhVo h hFP˾ ^_88u Ph yDž0whjU_Zh:jTY[+t9$,tK+tP^$,tЁ~=}+P{[+1ɉ @, D,Ģ,@tPjWTXZDžjT_4P5+5+ u h 10jP5+2> ƃ +9u h 8"ty-v "+R)Ph: ( u @;t+h= Y[t$hAt@ uƅ= ,u ,șu+1jPcO XZ؉|tL𙋍|9Ή| ||=Ȣ,S|19=+|19lj||Nj4PWj5+9ǃ1@,D,|)ډ|8+@DžftSd uQw tڃ#tՋ9 PhF8 [^4Pj_h)u뮃=L,P,9@,D,|#Ģ,R YU)Y= ,tYjP?M XZ++y @B19|@B)Rb X맋VN1u%Y4P5+5+J ujP$h=5+\ ^_th "ft=Ȣ,u 4P~[t`h- 6 =L,u׋ @,D,19}ċP,Ģ,9|P, \뛸#PjO8$w Y0=wxu tjSK XZtx1ɉ08R18 $PŌ_Z@u*tP $'g$h: 5P, 1;@,D,|8, <,y )jEHX0,4,@,D,9؉|1=@,=D,1@u @u"PjNNY[㋅Pj j>=x,t ujOY+X!ȅ!Ѓ„tt jZ+!ȅ!Ѓ„tt jXF(#e[^_]UVSu=+uh) #x,[11ۉ+hXj<ÍE PV5+ 5+h=05+ 4, hV ^ZPƋ+Y!ȅ„t tjYSjk<XZe[^]UWVSDžXp,++jj+PM + yhU # ,,tjXRjhP腅+<t <=,=,5 ,=,u  ,hP WÉ5 ,_~It,=,t#x,-wQ5P,h} ./Y[=h+h95P,X =,x,-v+,h Z=,=,=,5 ,=,u  ,hP xÉ5 ,_~It,=,t#x,-wM5P,h} O.[^9h+h95P,y =,x,-vtP,hK Y=,u9 =l,t 5+P5P,h yP  K uhK S _Zx,$ w=t5P,hj ,+<t <flpRPdPRRRP`P\Ph h@+B, \`dtk=+x,$ lpRPRRRPh h@+贚 #+1f+ Ћ Ћ ȣ+lp ff+9+YlpRPdPPPPPPPPPPPPPPPPS`P\Ph h@+荙\t-5P,h D+5+0L+ \u`u dt 5P,h 붺+1f++@ulp ff+jh+h+q 5P,hJ F5P,h 6hP S˨ [^^1ɉlx,-w 5P,h} ERpRRRPh h@+Et5P,h )XZ:u:u:u˿++󥋅pff+j+Ph+5+YXy/+=l,wPtJX+1p,>=+%h+j5+&[_Zy hz _ ^+=,<<+<+P+P+P+P+P+Ph Ã=,^=,Q1҉,++=,t f++tPWI_jj+PE + y"hU e ^ ,=,u#jXRjhP}@uh $+Ph+5+w y%h-  Y5+H+x,,tjXPjh5+S}Džh+1󫍅hPR5+ @hL x=,,,=, ,t$=,=,\t+<u1ɉj j WhStPtP蔄5 ,=,u  ,WS\h aÉ5 ,~5t=,t,7h+h95P,t =,u Iu<t=,+P+Pj+P+P+P+P+P+P+P+P+P+P+P+P+P+P+P+Pjjh HÃX1st ,<uBDžXjXPjj5+z5+E+X1=&5P,h e[^_]UWVSD}+=p,tWPHjjP6Eƃ HPj5+E @-+EfEjEP, M]ġ,ZZ<ډEUjEP, M+M̋EZ[+Ey@Biy1QjEPV  8t趩 8#thE +EEPEP5+Dà ty5+D+VjS%D@t?}uEjEPjjS2yW5+8 Y[Quh wX5+5D+Z1( 8\ 8#Nh( 6 뽍e[^_]UWVSu1ɉ +h$j/E[_t=,u`++=,W+`+5,,,Ș,thPBUPn UBCȘ, ++ 󥍺++󥡬+<<++@@+,DD,,HH,4,LL4,,PP,,TT,,XX,,\\,jhT,`UP6 j`PhT,# jh@,U썂qP $jqPh@, ,U쉂,hh@,Pȍ hPh@,貍 $hh@,UˆR薍 hÈSh@,耍 uj,+ t1+EEe[^_]e[^_]UWVSQ}j/WAv[^t#9u jh\jW XZ/jhhb Y^y Whf  nhWh`+܌ a+ƀ`+. d1.F9t@BUUjh`+萗 XZx9U0t8u-Ou5P,hx XZ10jh`+W YXy`+F<.u1F@F0볍e[^_]UWVSu+u/h OX=D+t x,1Ee[^_]<fDžƅfPftjjWP< t h  Xhh 5+ 5+m +Ã(t h  X=D+t x,jZ<Xt(t#fVfthWP > jYu=x,(ujtZjlXe[^_]US E1ۉ]hu1 ZYt E;=,t@E,u=Ę,t=,ۃ9,u%h kYt!5P,h fPjSxXZjOX=,u)5P,h4[Xj,Xx, 9,uh@+h1ZYt}jSWx[Xjh`+ZY!h<j(Y[E0,4, uuuh( Hu.RPh9 tԋEPj(XZjxXbj$_XE@E0,4, uuEu Ph(# Huv@+j1$1$vE$j"(XZjY1ۉ@+uu hC5P, RPh9 sjh+Y[hj'XZ1ɉ @+hu֙ [Z¡,tt =4,tSjtjUXEt1=,P9X=4,t(MEu Ph( Hu\j[뼋Eu(Eu Ph( Hu/=4,tjY1=,PZ=4,tCjX=4,tqj]g 1ҡ+~j1$X=,u06u=D+tx, hYy XjD8Xj9Yj1[=D+t x,EPj3&XZ]UWVS1X`Ģ,pt,(1\@,D,8,<,L,H= ,t}u=,tTuu u E 8-u}tuhM5P,藎 u hv5P, ʡ,9,u:1ɉdDžhDžlDžLFjh+[^u#jPLtXZ뺃=4, j9Xhj$XZhj$Y[hh*u ^_uDžT&1L,E 8|u]jj $Y[lE XhށS^_TTuShh XZi1=L,DždIhށu 輍 [^TTu u h yDždwTfzt T@xRPJo ZYxE%=tu h5P,ތ EЋUԣ8,<,?jh+^_o50,=4, h;u葕 ZYthEu~ ZY,twCTfxu TjWVPT@jWVP6 yu h Y[X54,50,h9 6DžL}tEuuh(a H ,LZ\\uOuh^_뽡+t9(,tK+tPY(,tЁ~=}+PHZ+j)"_l@ujj !Y^l=Ȣ,t=L,t =<,y Ģ,1ۡ,8\fxt \PTfyt T@S5,5+ +F uu h ; XZњ 8 @,D,P ta\`RPP)G @\@ @@,D,TXRPFPY^@uzt[pt95@,D,|@P,#.5P,Nc _ptĢ,pt륋\`RPj mF @uu!P\@ @u@,D,pt P,9@,D,|P, T@ @t,ʸ#sT Xu h  XZ\@ @t", `Ihj XGjXdtdTR^1T\P~ 1ɉ\ $Z[zhPjXZDžh=4,u x,c+xP3X+\t\Pf~ ^1\j[x,1;@,D,}jYh@u l@u"hPj\XZ㋅lPj J^_+xP3[+du \u)TtꋅdTRY؋\P} XHL,1҉0,4,@,D,e[^_]UWVS1,4(0Ģ,PT,1=@,=D,L8,<,L, |,huj ZYDDu =,uVu= ,t}t}u&E 8-u}tuhM5P, 뺋E Phv5P, ɋDtE uPu 1ۉ8Dž<Dž@1=t,uDHjh+IZYt=4,tzjXhj/Y[hj!^_<}tWE jP͇ [^E j/PeZY蠕 8tN薕 8 tDE Phf  [^x,. E h*P _ZE 8|uuU \t,hb%E 9u jh\E jP' ^_/ jP Y[n=,t 8 uW@ 8 u"E hP3_ZyE Ph6=,t 뽃=,tE P}YE D,uJugtWjjiXZ,9u(ju/^_8,<,x,=ujPiY[@ujh+U$_ZbDu}u-k0,4, tRPh9 ͋E8t8Puh( Hehށ^00uuhY[ȃ}E h*Pߋ _ZuDž(&15L,5|,E 8|uXjj v_Z@E hF@PY[((u E @PhA15L,5|,Dž8I=E uP襂 Y[((uE Ph y XZDž8w(fzt (@xRP(d ^_@tE%=t1ۉL,|,+t9$,tK+tPBY$,tЁ~=}+PD?Z+j|X=Ȣ,t=L,t =<,yĢ,$1$,Dt@0,4, t/(f{t (IjRPQv 5 ,+ +(fxt (P0ft 0@$VSW u0 8 u@,D,h,^ڃD4, 0, (jjjP11y4E PhY[1,RP<[Zt׃ t;50,4,(|jjjP!떃 @,D,$@,D,04RP<XZ tl(,RPj Y< @tz(@ @unz04RP;^_tA UL@L Hu (,RPS; @uq$u{PT9ȉP,#5P,?X YPTĢ,ډPT@,D,띃@,D,PT P,95@,D,|P, 0@ @tJʸ#g 4Z 8 u@,D, hY݋(@ @t! ,E PhF`XZjX8t8(R^1(0Ps 1ɉ0 $T[Lu@,D,y3`LPh5P,| 5P,hXZ뾋D$ u=|,uj6 _苅8=wju)[^X\Bu@j`S ^_X\lp1tE SPPZY@XP k $L+‹E $Ph/5P,| `jh+ZYt$x,1;@,D,}4jX Y*hj^_=4,0P+[벋<@u @@u"hRW} ZYEt ue[^_]o2ø=,trPhz5P,Mt W&t$=,t~ tPg2PS92 SQ%YE ]e[^_]xQMZƒMuQWh5P,s KSu QWhދ}u#Uj PMQ^k MMEPjUR rPj h]5P,{s 릍e[^_]UVS`P, @,,$t!uItJuB,h,1,P`P,]&8!]& u @ u,tJt ,1&,h, tGtBB@"u\uXu@!@B؀"@tՈButB@,`P,:@,`P,,tHt ,1,1h,[^]US`P,P,@,`,1ɉ ,<,1ۉX18,{P5<,/XZt8,@ڋ]UVS P,=$,t,SPb$^Z8tPh5P,q 5P,RK jh@hP,h&\)y}uB5P,ht.=$,t P,Hy Pj s Y[ J Rx=8,?<,0ZÃu 5P,h+u 5P,hx t =,u5P,hi[^1ɉ ,j 3uVIh <,0P58,S =,t3{t-P,HQPy;P| J Pjs XZ{ qh(jh;)j e[^]UEt]1]US]u h j5SZu Sh1j4@]U=]&u ]&P,fPftPY%Z9]&ÍL$qUWVSQ@ , L, jPt +,,_[+ ,y @Bxڽ߭ݕ @,D,=,19}a؞v3߭ٽf f٭߽٭؉ʃ. u1.WPSQhbhP(j ٽf f݅٭۝٭Q~:Qֺt.RPhu)PPi Ãօt Phh)PPi Ã<RPh)PPTi ؉1ɋ9ϋ}'t' @Ńu4 %%y)Džkdd%1 P%1҉ RPh)PPg 8@,D,19݅8,<,t50,=4,9H)߭߭ٽf f٭۝٭h)PPf à t!Whh)VPf Ã<RPh)PPtf Ë+,,Ɖ׃,9}19},h)PPf à h)PPe ؃ uP,fJftPVR\ eY[^_]aUSEz 1;@,D,}6=$,t%P,fPftjhP jXy ]UWVEE왉U1E}ujEPj? e^_]U0E E1EԉE؉E܉EEEPEPup ƒ xEÍL$qUWVSQ@@u5jh,,,0,4,,,XZjP0,4,@,D,+,,_X,9},9=,,sB,󥋵5,=,1w~s9؋}g WPhhSqc P,fJftPSRjjj-jh,f=L,uhjjujjj =L,l%_hrPz(,Y[tPhhPb x8,<,19߭y|ݝ݅ h߭ٽf f٭۝٭y1d~dVh)P=Pa NjH,~-(,t Pj Z)Å~:ùdh)Sh Ph)P=Pa ǃ119ʉst @u4 SQh)P=P%a +,,+ ,y @Bxڽ߭ @,D,19ظw ȉ߭s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4 %11d PVSh)PP_ á8,<,9lj@,D,)ލ 9lj݅99Ћ}h2VQ^ à +0,4,߭߭ٽf f٭۝٭?~~h%rtPhhVQ^ ÃhgVQ] à <ЙRPh?)PP] Ãuh)PP] à P,fPftSVP  eY[^_]aUSr jq X]á$,@ `t1US$,HyPY Yu1ZJ,ƒ uɍPv"u|,$,HyPX ZuJ"\u%$,HyPX ZuJCC$,uhextY,,$,HyPOX Zu ZJ, „t@Pv8\u"$,HyPX Yu JCC$,uq]&=,th,Ph ZYuC ߸ ]UWVSQƉUh,P蜙[_tHj.V1 [_1ۅt6uPvZYÅu#)Wh,V$ u1ۀ,1ۉ؍e[^_]À=+tUWVShށh+_ $,^_u"o 8th+h~Y[1$hS= _ZyƅEj.SJ0 [^pu Džp1btH uuzG uҋpȘ,uSpEƅt1;4 3*%u_3uGE uh,7} h,Pf ZYtE thPf [_tB$,fPfttRP? ZYx|?thqqhw$xAE85h,}X $,fPfttRPk? [_x"|?thphpE8h,}z=,t5$,PT Yt u $,Hy t u5P,hJɋ ,u5P,hXk,,,$,HyPT Zu@J&DB@uGG9u u ,u3,+=$,HyPS YuJkPk,B,k,,$,HyPoS ZuJ< u6 ,k,9,u@ , {u@ ,KZCh,hio_X$,@tRQ [5P,hXZ5$,Q Y 5P,h9ۍe[^_]1US]&uhS蜔ZYuИ,DB@tCjhS u Ԙ,UhSUZYu ؘ,8hS8ZYu ܘ,hSZYu ,]USZKJy ;J|< t Y RP\ ZY]UWVS ,=,u  ,hi^tIhh+TP ZYƺ9¸} +.uh+Vh5P,iY jhh+ 5,tjhh+ uSt , Ę,1,j hh ,P t\h ,h5P,X Bt 1,1Ę,t*j hh+a u5P,hZ^_̘,И,Ԙ,ؘ,ܘ,,+%hY1u<̘,u 1҉̘,@u̘,1+ ,e[^_]U塨+tPN X1+,Ę,,=,u1,+1,,,tPKY1҉,=,u1 ,U+j X=$,t%P,fPftjhP jh,eUVS]g 0jX=,tf+t-fPftjP5+M 1+ +x jP5++ 1,jrX=,t>+t-fPftjP=5+M 1+ 1ɉ ,1,jPZt ShAjcf 0e[^]UWVS],=0,t =,u$u 1ۉ,,Pu7=,uE,,P,@1ɉ ,=,h5,VIM /thh\V# hh[V V~ yVhi2XZ1pP= ,Xأ ,5Ȣ,L,1Ȣ,L,} t1=,P襼XFEEt!jjRPPhҡx,-cvt+} t1=,P;X= ,5Ȣ,L,hށVT ,VM =,uuhh^5,hh,h u5,J 1ۉ,j h,U% ZYu,e[^_]UVSQQMq ,=,u  ,=ܘ,ut95P,h?PhYZuBj h+$ ^Zuj UR@PfM te5&DN@tVu=x,u=ܘ,u1ɉ ܘ,t=,u5P,h+P, XZz ,eY[^]UWVSQ4MY= ,}=x,}=,u  ,=И,u}5P,h*fPh ^_j h+# ZYtj.h+# ^_th+W Y+uKjhVZZ u7Vh5P,Q f+20h+hP5P,Q + 1}VV ZtVhc5P,Q EPh{V*A tEEPC _uu ,u\] ,gu=x,u=И,u1ɉ И,t+=,u"5P,h+P, XZE ,Ex,eY[^_]Uuhj2h@,u hj@,UWVSP}u jjOhjAWhV"@ƒu&WhV @ƒ uWhV?ƒ USjEe[^_]Uhh,uZYu,UWVS,5 ,x,=,u  ,hT荩_uSj h+C! ZYtA8tW uڊ/ e[^_]UWVS}GE119]t4S Z9sCVUH,9r1uƍD31EkE1E]9]E1E9ut{Mu!;_s EEًP, G5P,RUYX;_s؋URR ZE9sM܋P, MEae[^_]USC^ P,fPfuURhht@PC ƒ PBt fUft£H,] ]UEtt'[ ,t , ,,tK,/ ,t,9~)У ,,t ,9~)У, Ph@j+UPE&DJt`j URPM tFtyu= &fTQfkt fgt"ftfbfmt yUS]=(,~/jh(,hhS,@u5(,hjYX=$,~/jh$,hhS,@u5$,hXZ]UWVS11} wu}ߊu;E E;]„Ut@t<"~! t\u M9s@\Cu;E XZ[^_]UWVS}1ۋE4t<%t!M Q9rSSEEE@EEHȉMct?&/-3%MmnN=,u E=,u=,tE,E}.t }c1ɉMt @/uE1҉UMy0u MEMQJπv MIM10EM)щM8/tH9ErtHJu8/uM9€})؋u ^ 9BL*=,t Ș,u*)ًE X<.u }m9BDظ*=,t,)؋u ^ tU9s{BLE H9S%6M I9S%49sGS} M Q9rڋE@EI}.u99S.49r [^_]ÍS.49s.9zS/49sǍS<4} ~9sS949sS+9sS]049sZ>hUWS$]؍U1EEEEPShu\ƒ1uuu\Xe[_]UWVSu] }VuSs\ u1N tutfN lSL ZHˀ; uLUJ9uD Đ&y h&i? Y&H & t@u҅tff t1҉e[^_]UVSQuhP,L [áP,?vPhj~uhPG CƃP, 1҉UUR@)RP,Ph&yhuh5P,F j8,19<, U e[^]UWVSD]} Sj j VhRuW. t&hh)4R= j h)4V= ,tzW9Vt vuvvS\  @uTV 8jjjhSvvw.thh)4Sp= DV 8ShY[4jjSƃ u(PPh'h+WPjS @uPPhXfDž=,~"jPF,XZuWS @zU 8$}ufU 8A^PPh* >jP+‹Y_+y@Biy1fDžRjP uYT 8u=,~{T 8#tLVjS_ƒ 1BPPhnuqT < tQDžPPhhSD$@uT T e[^_]UVS]u SXu ]e[^]pUWVS]} KyCS; Xu?C u8@t4S 8ufc S 8#tt~S  P0e[^_]UWVSu }EÃu3F u,@t(7S 8uff &S 8#tt S [^_]US] h~SzK YZ¸t,hSbK YZt;uEuhXZ]US]S2oZu ShjP]UEu hj3US] SuFZY@u Shj]UEu h"jP Zu hHjUWVShuE ]E1҉UUUt PEXt SE_=,tIEt Pv1ɉM[hnEEZt Pv1EXh#PGE[_EPEPEPVy$x,5+ ZEU+P,t\RVhrP@ 1ɉMEPjP]Sh&}yh6uh5P,f@ x,1VhPF@ Sj=,tTRU E É4$E |<$WURP7 WhbS WVS E(tPu_]uh+}[^t^}u-hBYu]SESD 1XZuhM1ËuV^D 1 tts;}u-hU`_u]SESD 1[^E8uhSYPh_蹘ËuVC 1 EtPh_茘_Zuu,,^ux,5 ,9~Lk,Ph+G ZYu0h@h$hP,46 W<,058,jWC,1,Et Ps1EX]tSC _1Et Ps1ɉM[]tSB Z1EtPsXe[^_]UEux,=,t%5Ș,h5P,= x,gHhE PEP6 EPw=,t,uE P ,U u#J,t8u hj>RPQrZY=,t"= ,t5,h5P,< ,j hՔh ,~4 ,,j h h,Y4 ,j h=h`,>4 @,$j hh, 4 ,j hh ,4 ,=,tjjE p UWVS0u=,uue[^_];]ȹ 1SjhV6u}uVhmOSS 1E0ES9XZEče[^_]UWVS,EPu EP?Uȃ u L ỦEЋE0ufEjEP|,EUXZ1ۃ=,~yjEPXE+E‹E__+Ey@Biy1RjEP upK 8tfK 8#tuVK <_FK 1҉jEPV u *K yK 8E K 8#7ËU9} )‰UEuoX؍e[^_]UE]UE@(]UPEx$tEjURjj01USju[Zxj0j"kZYu SY11҉P$]UVSPuEj0jjZYt,0@$jjVjEPhhV ؍e[^]US]t&S13 snsnSn1]UWVS(]=,~jEPM,EU_XEE E̋C t 9EsẺEЋs})C C)E}1u)EEЃ}uW3G u=;I 8-I 8#I C(I 8u5C}9{r:T}|D@^uC,H 8#uPtjZYCEЉC{uMEЉC 1{UfE؃=,~;jEPE+E‹EY^+Ey@Biy1:H 1҉VjEPY u H 8tH 8#t H C(9 5,Ph5P,I7 G <C(<1EЍe[^_]UWVSQ} ]{uhdCZC{({,CS 9Sts C)9G1s sSjjEPlu{(uS{,t{uE KSBCEC9Cu3pVshZYuF C(1E&Cs} {s}MC Ee[^_]UWVSSu] }VuS u-~,tut1ɉN(YS: ZHˀ; u9UJ9u1VjjEPXt} ut1ɉN(t1҉e[^_]UE Pu迻j, UE Pu詻XZ=,u ,UE PuKXZ=,u ,UWVSSƉ׉ˉʁv )…tRUWV^ tUu ؍e[^_]W|$wUWVS|xˋ7GEGEhaE_u h?hjaEYtU 1u]EEEĉu1EEEEE11E11҉UUU}u}tp}tj}u^WuuK EE)PEW|I u hM\XI1ɅMEEU1EEEEu4}uhb8_XEE$$ U:tJ1u9u}uh}[^}h,YEEUBUHEjjjE ]U tt hOBUHEU:t h+BUHExU2uBUHEXFE7U2BUHEU  BUHEujEu U:u$ Eu U:u BU"u u NEHEj8hjEPYuu dh7TjEPvE_ZwV$d Eȅtu}%)NhYEEZhh)h?uhW+MȉXZu~+Mȉt] QtuuEtUx 9tthx'[}UM}uEP踖[EEE8v9U];t h EUu}ugw}u EhU];t hEU}x1h v EPYu.eu&eXZ}tuEUVEUe[^_]g_W|$wUWVS\EUMhN\hB\EZYtu h?U1󫾄  }Ej8hjjjj5^&R t(huZdSTd 1}}djjjE 1uu11}u/ڋEw=EU]E}uKhuu y hX9qtvPEuu9EMș׋EEM jEP+ZYdKM)ىMڋEt;M9u41MU]E}tJjEPEZYvhAhFu%cSc EEEPYt%h 0ubSb PPPPEPEPEPEPh2hS( ,ڋEthn_EUu@bS:bXZ]EUSe[^_]g_UWVSEU܉M=^&t hCpY1҉^&jjjub" Bu11@tGjEPu uu hv thvX1M1SQM]uuh) E1EUM]Ή)׉u}u܋} ߃1 tL}xA19ʉ}u}u}1 tiE1-Phj]S,' LLD.Shh&+ uhP( $e[^_]UWVSǍxPW. ^ZyhQ[1E%1=uUЋ]ulSWYlu hb2=,t1hTځvRhQlW tht l)u)Ӄu hZ/w hhpPSG V_Xe[^_]UWVSÃ=,jPXZySh=d[_PV ZYtV6Sh0 %1=u ThSP P. ǡ ^&9},)ǍW5^&2 ZYu5^&W =Y_, ,uSh(jPVa t@uSh tShbljjjV =,u[=,uThh PGǃ ujVj XZuPh=[_g=,t1ɍP3Sjj1ɉUVt h YtWZt h4 |X,u,u#u Pn _ShJ n[^jjWDƃ u Wh` xPV ZYtWh V9u9t2RPh VPm Sm VDVjPZY@uSh=c=,5^&Sh!hRm" =v ^&)A5^&=,u:hh R ƃ uRh h& Ix_=,uVY@u h4 ZSl Xe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL Muj RPM/F 5,5,hq"j؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh,M t Džh,)ȋDPS4F hY[< u5,5,h%Ph1hn))=w(SXZDžh,Phh,S 5,5,h=%1_1ss C1C1҃u\hPj I wӋuu@kHPT JkHЋ8Nj󤋅B$(׉XZDJ@t Cu<;t<}75,5,h&CC Le[^_]UWVSi1ۉ1ҡ,l1,t2;{ uCp5,5,h8'$SCFYFu|,tk P,Zx,@Pt,Xe[^_]UVSƉj pX1҉_&_&Ye[^]USj1҉P|_&|_&Y]UVS5h,vtQhށ6R YXtKyS Zt# PSPqwSK  S; X1e[^]UWVSu]X,Ct1l,u t1ɉ 1҉,PtJtHhށp T,Y_l,uphj^@,X,qph,jh4, vh5(hL,"XZ,4,l,@0, 5T,u V%#ƒ tD,@,Hu>#u~nu ,T,@ fl,l,5T, _1+0,=,u8#uxnu ,M 1M I t0,,t]Ut @uKf 0,-t0,1ɉ X,=l,;G l,,t1BJM pЍe[^_]U ,@ t=\,t/=`,t@HyP# YuԋJ5 ,PtXZ1UWVS|u= ,uQh,8u==\,t h;(j ,&,\,&,),, ,tQHyPq Zt@ J5 ,P#t5 ,h$,h(,ÃYB ,=&u 1~1P [=`,tdh`,S h`,5,豹 t $ |,9,r|,kP5,,XZ=,k 5,1,15,{u5,s踌Y[ =,uuu =,z ,t5,CPj V( u,H @))Ӊ,SPV Ij5,5,h,;jjhh,j5,5,h,Fj5,5,h,\ jjhh,Aj5,5,h,) 5,s蠋,<,@=,&uX=_&u[h9 Zt8tPR__&X9TPhht@j uVft_&_&<=_&u _&t 11<tR<@PP7Ht%tv$@P 1DžHP u?F;5_&r5,h4c^_5,j$5,j 1.W6YtKWN8ǍZ;_&r5,h4^X15,Hj@ tfWz6YtZPh  _ZNj_&,t;_&r5,h4UXZ1@HЉ0,Ph(5,f,B 90uH@)< F;5_&r5,h4߈Y^5,j$+5,j ,@ @ ¸:ts P$;P5,h#j, ,u45,5,j5, =,t5,j XZjh,g^_1ɉ ,jjhh,rjh,,@=,5,5,j5,\ =,5,j XZ=,r,=,BHPj W% ƅt*,4),,H85,5,jW =,t5,j iY_8,4,, ,u45,5,j5,b =,t5,j XZj|,9,r|,kP5,9,^_=,k 5,CFPv YFG=,%=,CH@u. ,t$P9Qs@,R5,Ph)jZ5,j1ɉ@9^Z"1ɉ ,,1҉HLC0tZt,uH 9Hu;Ptj0Wh,CP Qt,pP @9u9t)HL1LH9L}jjQh,t,PHσ)HLL'Hj@$YZ"L HjHWh,9Q tUAQ )HLLHj@YZ t,QNu9AuAQ 똋 ,j)ȋ5t,PQh,~CP t,P @@DjH+@P@Ph,8 t,,,,,,t󥡼,,Cxt45,5,j5, =,t5,j XZsF uq=,u~uhh PF @t"5,5,Cp迡 ;,t Cp jhCp藡 Ht1 ,=,1,[=,h{uhh s聢C @t5,5,s$ ;,tshj轼jhs Hփ=,ujjhh,o\,,,,,,\=,,Hw{5,=P&t 1,,,9IFTu@1*jjTPkH<9Hs B@9u[0QPVu 0uՋ@9s3<jp$(Ph,.<jjVh, )H*t,,,,,,t󥡤,,5,h5,` $, ,u45,5,j5, =,t5,j / [^?Cv1s ,ue[^_]U塠,txt1҉P x{u@jjhh,US];] ttCtE8t[ K 1:"u#C@؍e[^]USPYt@Uv‹EBu Shu)j|]UVS_&tt2JughVPà `jh!jhVPsÃDh&hV|à u h)j*j PO ZYth)jtS!hjVr ؍e[^]UWVS Ӻ*_&uRPh*hVUƋ{sCsCV <$jjjhRWPVs ssJPtPh,*ZY1@QRBPBCV $jV*q hjRq $V:'Xe[^_]UWVS։Ϻ*_&uRPh*hSFËNvBvBS ZuQQRPSGPP+tL8tߍURP9jjPEu׃UtEuSh[- EuR3:XZ1e[^_]UWVSxjj@EPjV.uVhe!h_XIDž||PhF8S @uSkh-jVh?EUY^ uh-_h`RP~. tPhY^0E  1WV%1RPh-s=,t_EPhYXZ=,vFuh-Auh-4Uz-t-tPh ^_ &yh&j xZY&P& SMXe[^_]UWVS vFt Yhe#rYu(he#h-j耮{ jh-W} tVyZu 1҉SjPRj ;uWh-Y[뭉Y 8uዅs Cn]V X1e[^_]UWVS E׉M=,vQRPh-EE1E}G ut`P8Ëw(,XtJ9G$tR G(ErUf9Y9EUurUa8PS UuŋZP$ w83jjV;XZE|jEXijw7hށP|] uh.VPE:Y^Uu h.j@R_ZtPh-.jSPhK. +jj8‹G$Uw v6UBZ,B tJ H,B,1B Uԋw,G$uEV7EV7S7ES7]܃SVu؃VPuu,Uthu.u/Uuu6u ۋUu% Ph.^_}t u7[1ɉM1}t EBE}t uS7XZ0]{Ee[^_]UWVS u V0ZtP)_uVh.^Y[K SjECP6Es6 =vh.hв hNXC1E<GPƍGEPVSu79th!/hв hh.:E D>EPuEh&juV Ht hejh&g $&fZe[^_]UWVSu }th2/hܲ hh.Ew*vhW1à uWh,XZ6}uhPV VFSh?PS<e[^_]UWVS)uFv}hP/phP+jhPjE 0Ãt^DžPhF8Sc @t5 t'E 0he/&S DžPcSҎ_E phS L uSh,u(hLS S軲P. E p-[uuPz,XP"P tX$YX&Zuh~/E_"X@_&t$t Ӄt t@0DžP1\E T@X@tP3[XH PE @\SUXGYWLT0ZX@HH$  jjh ST_y h/PS`P pP=Tsq=8 f=T[=TPStURPh PTՐy h!^=h/X= 8=T똃uXX1u!s1CV1ڸ/XLt%t [0us1{V1js1ɉKVx1jڸ/aXZVWg1ZYHW0s0s[0^_HDjjh PT譏yh/5fUjjh PTvyh/;]DžH4`jh?`P^ tHuhu僽l\u1p`BJ13@ 9u@th/XTIu\@@싅TT\Xu PuE6؋[H!ʅuP tHJHPX1҅uӅth0Xh90_X@ T蜉[^X# TXZ1ɉPPe[^_]UWVS(,,50,uE}9s_ t f t!UEE =~ `  9u B뚀}tU ,u5,[^_]ËD,<,B4,B0,,,8,UPh9hp&j}UWVS<,u3j <,_u <21ۉ@,15D,B@,S9D,r14VP<,ZYtT01@,e[^_]UVS]g<,tD,49u>u"8t 0,8,J 4,JD,$,[^]US]t5<,tD,;u1҉{t s7X]]*]UEt?1҉PPPBPP@1ɉH,<,t D,;u]0]UWVSÉ 8S3C(<,Zt D,;t C 1ɉK$1tfVftPļ ZCa 8e[^_]UVSu j0Yu m2Ép VCZtCUC؍e[^]UVS]<,t D,<u'D,<,4h@5,rXZ<,t D,e[^]UWVS =,,,,=(,u (,=,u ,&=,u ,&<,t D,<u'D,<,h@5,XZf=0,8,(,}E f t"U؉}E ~ `  9u Gf` u}tEأ ,Eܣ, u=, , u5,),8,=0, $@ 8,=, ,5,$7L,X,L,,P,,L,,P,,L,,P,,L,,P,,L,,P,d,L,,P,F,L,,P, (,L,,P,  ,L,,P, ,L,,P, ,L,,P, ,L,,P,,L,,P,t,L,,P,V,L,,P,8,L,,P,,L,,P,,L,,P,5,5,%L,_XY(,b%,5,5,Z%P5,/&,L,L,15,(,a,T5,j5,5, "+,HE8,D,<,4x,uP4,,@,P 4,M0, ,MM9rz}Elj=0,if t ,=,` Y 9t   5,u=GYML 9s 2M)ˉ]x(u K|EHE1M9s ]@x,uH1ۉ4,XmZ u؉B UԃPQyUԉB[Zt2]أ0,]X u"J0,)ȉEzu1ɉJ2 v 1ztd,HyP YuEJ <, D,tJʋMDF9uMH1 F54,l 1҉5,SjD,<,upV4,u4,@ @t) 8t 2+ 10,f` 띡4, D,<,B1ۉ]u7}u5,`YED,<,@,E4,Uڋ D,<,4A9Q s4MӉUSPMAYZxUu 3nX 4,@@D@,}t$}tm}lj=0,e5,uN1҉$,t ,0,(,H>=$,Z5,MXID,<,4,Bǣ0,¡,EH31,@ @=e[^_]UWVS]tU<,t/D,G j@VSO j PS O $SPO j@jVF hjSF E v }}Dž )E j jPFF 1e[^_]UWVS0Dž*4 *󤍅4Dž 󥍅Dž DžDžfDžDžR" R󤍅"Dž 󥍅DžP 󥍅Dž*^ *󤍅^Dž @ 󥍅1ssss RtWu RsWD u 9ue[^_]UWVSE ƒ} W}M1dkP]_1pd9p}$phkp]lEXSb‰NjuM󤋅hȋ}:Y1hhtVSR`uuhG;`th@4h` jZhW4_tl`jVl `th1h;E ]R7pX1e[^_]UVS$É1XPj{ jVj@Pj@PSP4(u1EPjG E+Xi@BE+` e[^]UWVS hp&h~4ME Y[E EEEUE0hp&j.XZ0u]]ՋMEe ʉSQRP`cɋE‹E )Й1)9~Nuhp&hsLXZhp&hOLY[e[^_]UWVSƉωӅ~ Vj KXZuWh4Ve[^_]US ÉUMEt8Ph?EP @MUu jjuu9XZ]UWVSÉU}E PmEPEP@ E ~USj ]UJYXWhS1W Mt1ƃ19}~G2~(Sh4KXZ~USj UJXYUSE8PGUBYXSh4KXZEEe[^_]\e[^_]UWVSNjA tX΃y$wPPPhSh4WwF$4 hSh4WY,v,h.1҉XZe[^_]Uj )1҉PP@ @1ɉHHHUWVSP]{uC{uh-OC_{ t1StJPP^1k$_&WRU ZYUuG C Fu3Ph4r e[^_]U9U]U*UP]UUP ]U UP]UWVS}WPhc, uCVh ZYuCVh" ZYuCVh 5 ZYuCVhz ZYuCVh& ZYuCW8Y{u Vh5dXZ؍e[^_]U-UP]UUP]Uj4>1҉@@@ @1ɉHHHH H$@(1҉P,P0US]t?sss s s,s0]]X]US]t&3M sE s CE]뀋]US]H{$l uhO5 {uhy5(X1{ uh5{uh5ك{t h5X{t h6X{Wh=6uha6띃{t h6X{u h6|{h6u h 7\{t h>7yX{u hm7;{h7t h7HY{u h7 {t h8'Z{h?8Kt hd8 X{t h8X{t h8X{t h8X{ tLh 9X?t h69Y{t hb9Z{t h9X{u h9V[0]UWVS]uh9GP Ǿ_&XVWp ZYt $t`&u3 Ph9# Cuh :[1e[^_]P Y15,tW4  YZtFWh:XZ{ uh@:몋CEe[^_]EUltU]UVS]u H$ CjhCC PCPCPhFPRjhChFP;Cu(hW:jVbCZYuhx:X [0S1e[^]USM1ҋt8u X0P0H0ЉU[]UVS]؅tsQw$ h:h:tYx th:@0u C C$C(jh C,u[0tFjuV>eYZ@u h;7돍EPEPV_E tPh ;XZf1e[^]US]؅t\Qw$ h:h:X:x uh;@0ƒ;ts, jh C, [0u1]UVS]u utFPwCFPwCF PwC FPwCFt PCPM XZFt PCP: YXFt PCPXZF t PC PYXF$t C$F(C(F,t PC,PXZ؍e[^]UWVS}6WPh1; uVhk:k ZYuVh:;T ZYuVhM;= ZYuVh:& ZYuVhL; ZYuVhW; ZYuW~Y;u Vha;XZ؍e[^_]US]u ZE ]]$U@UP]U0UP]U UP]UUP ]UUP]UUM t‹@0uJ0 ]UVS]u uÅtet PSYXFt PCPXZF tC FtCFtCvsLCvCPiVI؍e[^]UGUP]U7UP]UVS%u Ph;p uC$C({$u Vh;XZEC EC,؍e[^]USu5ZtF@t?xu@SP0xtj!CSJH1ɉJP0XC1C؋]UWVS]hށS Y^DžuDƀ;/t0Sh;h*hSjhށSִǃu Sh;C2W4Wݪ XZe[^_]UVSu]NSh;>YZP$ Sh;>vh|*1ɺUSh <Sh<>Sh<y>v!<U v#U v ,<U vU vh7M 1҉ U Sh8<uSh<<ShL<=v!<U ;vh7M 1҉{U YSh8<= Pha<XZv01e[^]US]3LP91ҋE s4P<1ҋE s <1ҋE s11ҋE CPwQ$ hc!hh"h 5 hzh&<1ҋE Yu js Ph<XZ]UVSu] &t;thFSJYZtE ue[^]Sh</XZe[^]UWVS uE 1҉1ۀ>1E E@tZt u t tEBPXV轼ƉE_X1hlEPXYt(UPhl蚂 ZYUuGR}DY1VE MZ؍e[^_]US1;] }E4{CX]USEU M9t0@B[]Uj褼1҉PUWVSu} j舼ÉxGW|KC؍e[^_]UEp0US]t3X]]]US]3E X]UWVSjËE @UBC@PU2JB} 7OC؍e[^_]UWVP}u VWEWPVJEe^_]US]Sk $S]UE]USj^uhyPpC;u jjt؋]UE ujp0老 UWVSu} jÉ8WCJ؍e[^_]UE0pUS]ts^X]]Q]US]3E X]UE@]UE]UWVSM] 1;u&9tqC8u B1҉[^_]UWVSu} j$ËY9sЉPjWCXZ19sʃ9sVO2K@׉؍e[^_]UWVP}u VWEWVEe^_]UWVSPu~W莹WP6~uh<a6h =Uʍ 9sPRh=8S1RCPES Ee[^_]UVPuVkEVEuUWVSutiPERUԸËUUEPEȉCvNjMuuURS{uu0S*XZ1 PuESu Ee[^_]UVPuVMEVtEuUVSu j(É0VCuj QRP輩Ht S*X1ۉ؍e[^]UVShށuFZYtu PSX ؍e[^]UUo=} uU E]UVSuu PVE ]e[^] UWVS@EEEEjjEPEPjEPtE@tEȉEEE1uԉuEjjEPEPjEP-11@tEPj?@Mȋ]̋EԋU9u9u u9u~ 9ȉ|~)ڋ]9]}]419|uGv ]hp&hO^3u9u1EE8EUe[^_]Ph=jmh=jzmh >jmUMU tt&1u.1>t%R>9>tJ>1;tA>]UWVS0]u SzYwzK0<C,9s1S8U1҉UȋS(U}ԉEE܉MC4u9sMSuV _ZuVYuEVSXZEče[^_]UWVSLuE}(u(Q_EEE(EEEEEEEE E1EĉEȉẺEЋEEԋE E؉u܉u1҉UUUE8Eu4EPEY^u[}$t }$ދM(},tE}0t?u4EPu0u,"t&u(Ssu0u,hSEu(SMS Ee[^_]Ujju,u(u$ju uuuuu uUjjjju(u$u uuuuu uUjju,u(u$ju uuuuu ucUjjjju(u$u uuuuu u6Ujju,u(u$ju uuuuu uUjjjju(u$u uuuuu uUju"UjuUjuUWVS]uSZYu&s;119t]  2 AJxe[^_]UWVSLuV芩 ÉEE$ljESEZYtOtKE EEEuVuVG 1ۅu0]uh‰EXtuSV- 1ۉEuuS Ee[^_]Ujuu u-Ujuu uUjuu uUju uUju uUju uUE#Z>#w@ ]UWVSjuZYP> [u!u u Ǎ\3u u j ؍e[^_]U E D$D$E$^" ]UVSÉ1ɍU@EEU T uXZ[^]UWE }_]UWVu }^_]UVS]u 1ɋ΋T11TAu[^]US] Ee…u)҅uURqEtH))H11)1E}t E@ƉEE1ڋM1SQRP?e[^_]UWVSUt_ztY1;BsP1ɉM1;Zs8EE܉]EE1uuRU^3CE܋UE}u@1e[^_]UVSU/:#zJ zutAJzu JzutAJ$z utAZ,vwKwgJ049rTz(tIt@w3J4t'wB@z<t [^]UWVS}u 1;^sj1ɉO@_DjHWhPF G@jHWhP F@ ChPXZe[^_]UWVS} r}hj@SG0jVS#GjVSG, jVSG(jVSG8jVSE$jVSG jVSGt%w PS GDtw w1G XZGjVSpG t wPS\ GjVSGG t%wPS3 GDtww?1GZYG$jVSG t w$PS j@uSE e[^_]UWVSH]} tKtG{(hs SWƃu1s W}W0jEPSWjHW$e[^_]UWVS$1ҍ$h3$h[$l$h$luNj$󥋄$PD@@5т歁RQ$$$PL@H5l>+h$$$PT@P5kAك$$$P\@X5y!~[D$pT$t$h$l$$$$$p$t$$$$$$$x$|$$$$$$$$D$xT$|$$D$hT$l DŽ$6_DŽ$:ODŽ$+DŽ$rn<DŽ$;ʄDŽ$gDŽ$ɼDŽ$g j$$$$3$3$\$`L$d$$T$`L$d$$ˉ11ΉP$$$$3L$`3\$dL$ \$$$$T$ L$$$$ˉ11L$\$P$$$$$$3$3$\$XL$\$$\$Xt$\$$$13$P $$$$3L$X3\$\L$\$$$T$L$$$ˉ11L$\$ P$$$$$$3$3$\$PL$T$$t$P|$T$$3$3$P$$$$3L$P3\$T $\$$$$L$$$ˉ11$$PL$h\$lL$x\$|$$3L$p3\$t\$HL$L$$t$H|$L$$3t$h3|$lP$$$$3L$H3\$L$$$$$$$$ˉ11L$x\$|P $$L$\$ Ή3$3$|$@t$D$$t$@|$D$$3t$3|$ P$$$3L$@3\$DL$p\$t$$T$pL$t$$ˉ11$$P($$$$Ή3t$ 3|$$|$8t$<$$t$8|$<$$3$3$P,$$3L$83\$<$$$$$$$$ˉ11$$P0$$L$x\$|Ή3t$3|$|$0t$4$$t$0|$4$$3t$x3|$|P4$$3L$03\$4$$$$$$$$ˉ11L$h\$lP8$$L$\$Ή34$3|$|$(t$,$$t$(|$,$$3t$3|$P<L$x\$|3L$(3\$,$$$$$$$$ˉ11Ή@= $$$h$lD$pT$t$$$$$$$$$$$$$p$t$$$$$$$$$$$$$$$x$|$$$$$$$$D$hT$l$$D$xT$|$$$$$$$$$$$$1ɋ$T3h3l3̨3̬$ωTAue[^_]UShP2XZtCXC\CPCT]UWVSU] tPtLr@+1  1uIMu}141|@u1ZY[^_]UWVSD]E tP?v 4PEE1EEEEUu1MuԹ1uRSZYe[^_]UWVS]u U73+KT KPM<})D`uC@SDC@SD19Ms11sH{LS`1EE؋EEEE܃m䀋E}})=vKC@SDEUC@SD1E9Es11sH{LU܉s뗋E-kU‹u)ƋD`lj1[^_]UWVSUM tA?vREH?w}t߈4]5Dž61ɉ:>B4F߹󪉍0T1󫍝dVRU[^U`t ߋ0ߋuMhSRhS1e[^_]ÍL$qUWVSQHAEQ1E}1};ST SP1C@SDC@SD1CHSLtCXC\CPCT)T3`1S`Uo}E}j@PhURj@S1eY[^_]aUWVS] u}UEu tlK?w}tut@wޅtPRSPSPZYxWVV xSuVbà hP؍e[^_]UWVSt]uE @wRPW5ZY1jPW VSW u uW j@WZYjPWH VSW5 j@VW| }E XEE )؉@Ǎv4jjj@Pj@P3xC jjj@PSPx󤉅hR|e[^_]UVSXp@J!ȉ!ȍJG!! ȍJA! у>у+?҃/ [^]UWVS É׉ιE1EtuEE9}saEE11E9t/FFǃщU?6CCUwʅt)щ?CEE [^_]UWVSEU1EE1KSz) ЍS!кZ) ! ЍKк9) ҃! +҃>/у? ‰ъA! сt>FEȉEEHwMKG];;s.U}G}ك}wMЅEuE81[^_]UVS100 wwk r@9t90uA9u1[^]UWVS]u {CEjuYXd>$u}FRU $EURV u\MC8jh*BV uFU<ƅt+EC8jh.BVՍ uFUƅu EC,jh2BV蠍 u܍FUƅtˋEC(jh6BVu uFUtUS0S48$uH}CUw{US8$lHEEUMƅOEC1CCC C$Ce[^_]UWVS,]} juuEЃ f$CE̍_V _9H}U)Ãv$v=BE̍SUȋEp8hv-]SSĈ U9sIH}̉M)ƒv3$m=AẼUȋEp,hv-SS{ U9r EH}̉M)ƒv,t=AẼUȋEp(hv-S.S& U9sH]֋}̉M)ƒv,p=AẼUȋEp0hv-SSڇ U9[H}̉])ƒAf$CrEHpY)ƃf$VC}weZ@EЍe[^_]UE1tu@]USE vA1[]UWVS ÉRPuSP~PPU}tPPXZp x$P`d`ҋ`dډX\3C`3SdSDC@`d`ҋ`dӉ`d11߉XҋX\ډ33`ҋ`dډ11Ép(x,P @`d`ҋ`dډX\3Ch3SlSLCH`d`ҋ`dӉ`d11߉XҋX\ډ 33`ҋ`dډ11É $p0x4P@`d`ҋ`dډX\3Cp3StSTCP`d`ҋ`dӉ`d11߉XҋX\ډ(,33040`ҋ`d04ډ@D11É8$(j jʍ YXCE1҉} }}33 PQE PSs 0 {0u}jXXG;{n 0t001҉1RP!} yjte[^_]UWVS]hL,2Z@ t@@,@,D,L,@,h@,hlW S^ y hL,2XhP,K2_@ t#hP,h@W@S|^ y h:Bj-hT,2^@ t"hT,h[W@SH^ y hT,(2Yh,,1Z@ t, ,h ,hRW S ^ y h,,1_h ,1^@ t,,h,hRW S] t h ,1Yh,j1Z@ t,,h,hRW S] t h,q1Xh,-1_@ t^EPhYW@S_] h,;1h,11h,'1h,1h,1h, 1h,0^@ uh,0Y@ uh,0Z@ kh,0_@ Vh,r0^@ AdEܣ,tEࣸ,E䣴,,,E裰,tE죬,E,,,h,/Y@ t/h,hWW @S(\ y)h,0h,/_Xh,/Z@ uh,/^@ tvE 5,V,YtAh,hfW S[ ǃ t;8v 8#u5,31,ZMuyE,e[^_]b/e[^_]UVS]hL, /^@ t6hL,hPWS=[ yhLBEhL,.hP/ hT,.Y@ t;hT,h\WSZ y h^Bj&*hT,.hP. h,,y.Z@ t@ ,h ,hSW SZ yhrBh,,@.hP. h ,(.^@ tC,h,hSW SOZ y hBTh ,-hP,. h,-Y@ tC,h,hSW SY y hBh,-hP- h,-Z@ t9h,h]WSY y hBh,N-hP- h,6-^@ t9h,h^WSgY y hBlh,-hPD- h,,Y@ t uVhYW@SY ydhB#h,,Z@ uh,,^@ uh,,Y@ uh,,Z@ uh,w,^@ uOh,a,Y@ t ,Eh,H,hP, Etbh,*,Z@ t ,Eh,,hPQ, h,+Y@ t ,Eh,+hP , h,+Z@ t ,Eh,+hP+ Etbh,+Y@ t ,Eh,x+hP+ h,`+Z@ t ,Eh,G+hP+ VhZWSuW y hCz1ɉ ,h, +^@ t ,h,*Z@ t , =,tch,hXW SW y hC,th,*hP* ,th,*hP* e[^]UWVS]h.\*^@ t!h.hW@SV y hCh`,**Y@ th`,hW@S[V 1=.h.)Z@ t .h.)^@ t .h.)Y@ t . =.t#h.hW@SU y h Dj%1=.h.)Z@ t .h.h)^@ t .h.P)Y@ t . =.th.hW@SoU yhDhc&)Z@ t<c&hc&h WS6U y h2DDn-,(15,h,(_@ t ,h,(Y@ t , =,t!h,hW @ST y hAD1=x,h|,V(Z@ t x,h,>(^@ t x, =x,thx,hW @S]T xhh,(Y@ t!hh,h W@S5T y hVDChd,'Z@ t!hd,hW@ST y hfDh.'_@ th.hW@SS 1ɉ l,hp,t'^@ t l,ht,\'Z@ t l, =l,t1hl,hW @S{S @un 8t hzD1c&e[^_]UVS]h`,&Y@ t9h`,hWS)S y hDh`,&hP' 1.h.&Z@ t .h.&^@ t .h.w&Y@ t . =.teh.hWSR y hDj!.th.(&hPh& .th.&hPG& .th.%hP&& 15.h.%Z@ t .h.%Y@ t .h.%Z@ t . =.tch.hWSQ y hD.th.I%hP% .th.(%hPh% .th.%hPG% hc&$^@ hc&hWSQ y hDhc&$Y@ c&k c& 19tef0f9,uQfpf9,uDfpf9,u7fpf9,u*fpf9,uff@f@f@f@ hc&-$hDhc&$hP\$ 15,h,#Z@ t ,h,#Y@ t , =,tch,hW SP y hDh,th,#hP# ,th,v#hP# 15x,h|,V#Z@ t x,h,>#Y@ t x, =x,tchx,h W S]O y hDx,th|,"hP1# x,th,"hP# hh,"Z@ t9hh,h WSN y hENhh,"hP" hd,n"^@ t9hd,hWSN y hEhd,<"hP|" h.$"Y@ t9h.hWSUN y h,Eh.!hP2" =c&15l,hp,!Z@ t l,ht,!Y@ t l,l,thp,!hP! l,tht,k!hP! =l,t.HfJfBfJH5.PfVPfVfFPcfFY.HfJHfJHfJfBl) v 'SO0EEEPZxf.4Mx .1. tʁw9 u 4 4@ ;.s-.P.p.P..P$uɸ4Bt 5..؍e[^_]UWVS..5.uE}9s] t f tUEE ~x @  9u B뜀}tU.u5.[^_]Ë..B.B... .UPh9hp&dNjEUWVS.u3j^{._u <21ۉ.15.B.S9.r14VP@.ZYtT01.e[^_]UVS]g.t.49u7u"1t . .J .J.[^][^]US]t5.t.;u1҉{t s܂X]]ς]UEt?1҉PPPBPP@1ɉH,.t .;u]7]UWVSÉe] 8S3C(.Zt .;t C 1ɉK$1tfVftPi. ZC] 8e[^_]UVSu j0oyYu m2Ép VRyCZtCUC؍e[^]UVS].t .<u'..4h@5.rXZ.t .e[^]UWVS =..=.u .=.u .&=.u .&.t .<u'..h@5.^_m=. ..}E f tU܉}E ~x @  9u Gf@ &u}tEܣ.Eأ. u=.. u5.). .=. $   .=..뎸5.[u5.h7Sf.o%=tс p5.>.YU.J^w RhHSjtPhgS5.j5.5. 1+.HE ...4x,uP..@,P .M. .MM9rx}Elj=.^f t .=.@ Y  9t   5.uGGML 9s 2M)ˉ]x(u K|EHE1]9s ]@x,uH1҉.PmZ u؉B UԃPQ zUԉBY[t2]أ.]X u"J.)ȉEzu1r26 v 1ztd.HyP}lj=.\5.uN...H 9...Bǣ. ¡.EH3=.@ @ie[^_]UWVS]tO.t/.jWV^C 8,ukpjWVAC 8,uNpjWV$C 8,u1jW@P C p <:tu _>t50.hSjPh$W2 y hSjh@.%_@ th@.hPT hD.^@ thD.hP+ hH.[@ thH.hP hL.Y@ thL.hP h0.Z@ th0.phP e[^_]US]h\.FZ@ t!h\.h W@Sw1 y hTh@.Y@ t sDhD.Z@ uhH.Y@ uhL.Z@ uh0.Y@ uh .Z@ tEPh'W@S0 yChT5h$.Y@ uh(.wZ@ uh,.fY@ ukjh .LZ@ tE .h$.3Y@ tE$.h(.Z@ tE(.h,.Y@ tE,.hd.Z@ t ؋]ph`.Y@ uhh.Z@ uӋ]UVS]hX.^@ t=X.EEPh!WS/ yh(TLhX.dhP hT.LY@ tBT.EEPh#WSv/ y h7TjhT.hPQ h@.Z@ t DhD.^@ uhH.Y@ uhL.Z@ uh0.^@ uh .Y@ t uVh'W@S. yBhTRh$.jZ@ uh(.Y^@ uh,.HY@ u%h .2Z@ t .Eh$.Y@ t$.Eh(.Z@ t(.Eh,.Y@ t,.EVh(WS. y hGTh .Z@ th .hP h$.^@ th$.whP h(._Y@ th(.NhP h,.6Z@ th,.%hPe hd. ^@ t 4"h`.Y@ uhh.Z@ uՍe[^]UWVSSƉӍ<9t]Vs@ ZYUue[^_]US 9tZ9uBPhHFjhl.2l.]UE.E .]UWVSS=.5.19~uu6~? ZYtCuhjkEe[^_]UVS ..19~Xu9ptBhJUj.e[^]UuZH UWVS ]E tP3h!3 CiQd%,tnC0h,|fswZ$ C0hyU==h=C @t&C0hx&LPh`2Y[aC8u hc'1۸tugSRh2 1C u x&댹Dv&뀋%u&Ph1C0XZ1۸!t t&Ph1_XC u1;>k ^f;u$f{uf{uf{u f{j m0WhtUA1 f=tP8Ph=$1 CP Ph= 1C f9Cu f;Cuf;CtQPPh=0C f9Cu fKf9Kt)PPh=0CPPh=0GDž`C#t.t&Ou\yPRh!T0 1`utIdVCp Y[t hm0Zj 1/V PhUjj /Xe[^_]UWVS}] uGhL(t<tQ=a=iEPhS+ Ht ShsGUEPhyS* Hu؋GUtslwS_Xhp_j1u1:tqUCB 1ɉj EPUR轲 Et ShUjMB 8"Mu w؃~QhUѸ ƋU: uB7j.S ^ZƅtFu&EuShU끋Wj.Vh ZYÅtC t&Eu VhUVe[^_]UVSÅtVPhZhp&P/SSSSh"Zhp&:/j% t tu@UWVSljiBؙ~ËF ؙ~ E苇E썟1EU9U~[C9FuKC9FuCiECUЙ{EC Mș{ M9u kE, E,1[^_]UWVS195 ~ k,h WX7 ZYu@ F1e[^_]UWVSTӊHu1u1 u 1 ƒ4ʃ@ttk t< E @E PD@ 1f;Wu$Uju 7ۦ Uu k H  F u1u ~}tjPW E @C ȋu ~4}Ph_jW"E @$C} GLCGHCGFCGGCGPCGQCGRSdtBdu FSCFTCS i fFxCS i fFzCS i fF|CS i fF~CS i fCS  i fCS! i fCS" i fC~FU1҉fC#EEEMt>Eċ ƅt)E k,}  BE Mă}uC&EčC6EuȉEt7E u)E k,M  BE Eu9uuC;EčE]CS Su{ ak ECK %K ȉCM[ ˉ]EEHE% ME@M %MI ȋMĊIU։u؋uUЋuUԉ]؉EU0 ؉EU0 Mƒt‰ЃtЃEuȉE n…t E E k, E CE NEĊPB<$  }uE @CE P$1 E @XE} fG\E@fG^E@fG`E@fGb ]ĉcfGd{GhCfGlCfGnEf@ fGpEĊ@ EfGtE@ fGre }uVE u)E k,}  BE Eă 9tuȉt몃E]9]EEEE $E 119~k,u 9}BM yXtQd9}fAd} fGdEEe[^_]UWVS,UEEЃEtE @E EE1Ut}E 1]{}E܋CEE ]}48E1 JM1SQRPiM1)ډӉ11WVRP}Ɖ׉E@EiE@B1ډMȉ]WVRPG‹E]E ]ЉEiEEMȋ]́Ƥ~WVSQM1ӋE1RPSQ։щʋM1Ӌu1WVSQEU1}t}E1}E܋EH @]S)iU1҉UCMejh@BRPDӉƉ+u}؁EԋU)ڋMeʉWVRPHE܍4EUEUE}G ƻd1)‹EPH p}xE%E ]C}lj߉C؋]_ } xi@B1jhuuajhuuHRPWV<]e[^_]U$EEEEE&EXE(EEujEPuu uUVSÉыS t%[+Y$<$+Q$T$,$e[^]UWVSÉ׉1t )E1XJ~D>PheYX؃t w t u F17tA9MuuUM7Ph7XZUM΃`Ѝe[^_]Uhp&he聧j{4.(.t9W|$wUWVSH.1B(.1@y&% 0f0 s fL..s fL.P s1fL.f .f N.X.t0 1sI.L. ut/H.8. <.P. T.fP.1=Xy&OfH.@.ffL.fN.=.tjV裮EȣP.EȣT.ZYXy&X.l0.U1EH.]5..jh.5H0ƃ x9u hpfԘXVS5D.hxf0HujhTy&jO .... .u...5Dy&=Hy&u؉}mrqLy&E؉ .. ..E . .=ɚ;~ ..-ʚ; ...we[^_]g_UWVS4ƉU)'hfY>^ hf]FfVRVRPWSPhf j.]SFPjkauj.h)4S Shfqj.SFPj;auj.h)4S SY]F^(ZU)ڃ<,wJ<w1tR<CSPSPhg<+hf"<:tI<<tG<T@8PhkP $ <uT@<w*$D hjBh k;h3k4h-h@&PhXk,T@t <uhhkG^ PhkY[THLhkZT@Z<t%w uhk<uhlhk)_hlPh?l[^T@8PhMlTHmh_lhllhwlhlhlhlhlhlvhllhlFj.STPj7Juj.h)4S Shm=j.STPjJuj.h)4S Shmh#mhUT@f8fZYfw2$X h:mhKmhYmhTmhfjhsm}9Huh}mnhmhmvS1ɋHU t Shhm&uj.VSjHhm[hmhUT@fHfZYfw-$l h&j!h:mhKmhYm hTmhfjX0t-T@<m4D h^RPhOp^_0 0uh& [g v狝t݃{)!C2t!#t1 hm3thmC YhmC HC SRRPC PhmHǃxPhnXZ h+nXCPh>noY^19~gVHYZuVhGnJXZCj.RPj Guj.h)4R PVhVn F땋L 9؋4.0.t9~0 4t490. =0.PUWVS]u#0tP3^1ۉ00S 0@$ +0Yu{ U1҉05&t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSUtWB<:u1<2E 028uFut<@t*}:u<:t"u}:t;EuݍG1ɀ@t1ɉ[^_]UE`y&]USE] u:À|u%u@C8t9EsHt:t @|u1[]UWVS4}!}u[=0tQu Wn[^u<50Pi)YtHWPXD3XZh5)^1u? Dž)Etw}xjjju !jh@PbE xDž1ɉ1ދ9rqhQuΥƒ ?tuȦZ 0S0 0HЀ u%V1It 1:u4:ut75Dž\t&Dž t t11҉V9r)ډ)ށVSj,ZYu"S/^u该[Ɖ‰,1i<#au SZYNFS;/XDž`y&K1j=hȝS Ɗt F:uFHX)ىMQRPu[Ë tK}t u菤XWt.^tCu F:^DžBDžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QWU*ZYu:W-Xt u蘣Xx-h _<ljljƉlj )PVQ SRդ ,Ymt uТ^)؍P9s&PS:)ZYuS,w XË Dže[^_]UPjujM UEU0tP1҉0Y10001UWVS1=0uE 0=0uYh)000^_u=`P50|`Y[t?Duz1=00t=0u00u@ @uP6100P0@Zu 1Uh)PAڋ &f\Yf:u#t =0t|0\L0E|0\u 0N1ɍt:uf:Y\tAߍP50A_Y^u'0tB @R=10ZD돁NJ|Äu :t@PFjWjM EÍ@ wCe[^_]UVS]u uu ][^]UWVSj=u uj Pjd ^Edu!Q l4uEdUz}<:<^uFC<:{Mu])CdPV%ZYuV([{<\ůCt}<:tyHЀw1GOD9t0v뛍{1e[^_]UPEPhh 0h@0uƒ1uEUWVS} uHu7uuW1ɋUà =$0u u1Ɖ>1e[^_]UPEPhh 0h@0uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ3߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס0EС0E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU^ $URjWJ $WjV9 $Vjސ$S% ZE] Ee[^_]黐UVS@ÉjjjQjRP tN9tLtHVPe ZY@u:v j@]S0n hShsPdy&=0t 1e[^]UWVSSÃ=0tO1t 0<!j,ơ0!0)Y9sRU,0Z9Uu)@uÅu,0!1ɉ1ƅtÉ5001e[^_]USX?090r0É0 4t1[]À=|0UVShhhhsdy&hhh htdy&dy& =}0tWM=~0tJ`=0tQRPh#tӋ5dy&=x0ts.=y0t=z0ts={0tTSQRP֋dy&U0hhPhhhhtPdy&=0t 00e[^_]UVS0;0s4>ubC[^]á0uÀ=0>UWVS 0DžDžDžjjPh0jSu@u 0 0P01 @H0hSht` tƄ181ƅGht Xt' uʊt͍B<9;$ 0R0F}0:}0.~0"~0hy&0B9Hhy&@hy&|0|0py&Hpy&0J9@py&ly&Hly&0J9~}@ly&u{0l{0cz0Zz0Qy0Hy0?x06x0-ƅwhtRhtPdy&Ct0n3 0=|0t h6Ypy&9ly&}ly&=ly&‰0 0 0s5000)I 00H 0tH 0 hy&0X0 0Ɖ5050#0tA 050)0={0t*1҉j Phb  h h0 j@$000h h0 1100}ã0u&0 1t01e[^_]1À=0u1á0u 0UWVS@É;0;0jk#¡0_9u739u0PN#Y;0u;0)00jVS蟡 19Z;P 0PPh0 =0XZVSJ[ Y_@u: j@}W0ٟuhWhsPdy&=0tE 950u"tX 0PPh0u XZe[^_]UWVSEЉʋ0!Ë 0)){ MA L>D=}0tMjRP莠 M950sxu@)lj|| >;0Fs"J| u| | DT>| T 9Ss$EExSW ED CSW ;sss{uISC Pf XZ=}0uE@,t 0EX,0؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC 0‰ى[^_]UWVS¡0!9t> 0)su܋tu 9t)D @!u܋D UEPh0H @ZYe[^_]UWVSQӋ0!‹ 0)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋0!9_C E؋ 0E)puЋ|~0Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w ? w)? w 1;SsS |C@C;Fu ;u1ɉHt SFP XZN]H9t9sxt PFP Y_SV XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPh0; Ph0f =~0t KZ{ SC 00e[^_]UWVS90t09kjjh0 ǃ t؋_ jWh0 EWh0 0=0;0r;0rw1ɉ Åuj}먋 01ÅuP=0@u1j|Nj0!‰)[9tP\0Y9uō30t]EPh0O XZt>G 9r7 39s0jWh0 EWh0 0=0}뾉؍e[^_]UWVSÉU 0EC1t}9xts@Ƌuzơ0EF}}1U9sK)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=P&H9s?MjB,@Pr(ܮ Mu e[^_]C(S,z{,f P{<t[F &01=P&H9s &29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)Ey&HuVQM t uMQ^ ZU9ufG}uf 1e[^_]UVSË@9r{uC0C0KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uC0C0[^]èu'B &fAf'f` ЃðUS1u4ݠ!| ZYuCC u1]UUE ft҉UŜ!]1]UWVS É1=P&H9s33C8C,E &E&E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjhvV肽 u 1ɺjhvVe u1ɺmS j@B@Pr > u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3K&9)BC9S9{uC0C0S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uC0C0{uC0C08Dz@U׉DRO^fE11=P&H9}"uQMBZYMt UGjE@$E@PEp  u j}G W$JO$f4PY{uC0C0EH9G8:>x]49r{uC0C0<]t<-u{uC0C0=ȋUC9r{uC0C0S9sH9s8=ux]u {C~8-P9x]x-t  -f9=P&f9~0{uC 0C0f9UG1=P&H9|f9jE@4E@PEp0Ӧ u MA0Q4f8fpBQ4EV~{uC 0C01E, U%Gu48-u@-U;Cr{uC P8]u 0C0{ Ex8tC @tEHP&E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0tEp i1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF &f tNt & t< &ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uC0C0Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC 0C0{ 0щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6J&DJt%9~{uC 0C0PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC 0C0 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uC0C02SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $p!^[m\p{|;{r{uC0C0S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)u0C0 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uC0C0Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx &Dyu@<,t<{uC C0 0}{uC 0}~{u9C 0@}t{tE0C0+uN+ue0C0-0C0C 0C0+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJ&DJt%9~{uC 0C0PSY9s8}u @48}t#@9r{uC 0C0 {9s9r։v!?t{u#P9sP&DPt o1e[^_]UWVS} U0E tEp9) W裨 [jLYt3SUUw$@@EjP|1҉UYZuSX ]lp1tEEU1}EuDžh}1 11h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9Y&EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ&DJ<_&9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,&DJu _9wu G9w NDJ_9< u AЋ &DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hxNC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVu uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tP&1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡ&f}UfMQPf_tIf}tAf}uf})E@&Buf}_uڻzf}&EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY &E@Af}_ fE@Af}_ 8uY8E&DBuf}_f}u7E&DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} &1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y&EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ&DJ<_&9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,&DJu _9wu G9w NDJ_9< u AЋ &DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hxNC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT&1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU6 tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} &fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT&1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRUZ tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} &fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y&EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ&DJ<_&9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,&DJu _9wu G9w NDJ_9< u AЋ &DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hxNC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=P&lt1ۉ]tMEAEWo YE}M9M) N,F4EF8EtwF}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$5U6DžDžDžDžDžUE@fE@fMIL$D$ ̶D$D$$Ht$ D$D$ 4$fHEDžDžDžUE@MIMI Ɖ ȉ } Dž UE$^D$D$Ɖ$qC D$:4$ Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%KwҋP;V9s%u9sF?V?4 r9i_oJjNN9sVu鋽D$ OD$D$$EV9sNu鋽E@D$ D$D$$E^V9sNu鋽*N9sVu鋽jNN9sVujNN9sVu=Ex( @<ዕt9jNN9sVujNN9sVu yjNV9sFu鋽Dž6pSjNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ `D$D$ $~BȄLN9sVu鋽AD$AD$AD$D$ D D$D$ $AlBD$D$hBD$D$  멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ D$D$ $@dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ 0!D$D$ $@N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ D$D$ $,?N9sVuA D$A D$AD$ wD$D$$>{V9sNu7@D$ D$D$ $;>N9sVuD$ D$D$ $=N9sVuZD$D$D$D$ D$T$U$*"N9sVuEDžDžDžD$D$ D$D$ D$L$U$U)tN9sVu*})mUE@D$ nD$D$$<EDžDžDžDž DžUyzUWVSt~ CU11 rEEEEEEEEEH>U DEED$ED$$U}ĉ|$T$E$G ƃtdE$E ƃt'D$ED$$1҃ډjO MD$|$E$F IO M?O 8D$ED$$aO 8t[^_] O UVS p} խ ; D$D$ $3t@ $ ǃ $ǃ ƃ 1 [^]fN 0ǃ $kǃ ƃ t2N 0ǃ $0ǃ ƃ M UWVS<T| ùuD$/4$ D$@4$ƃ%D$T$$qkM 4$zƄ=D$D$D$D$ D$D$ D$$ tVuw: ul<[^_]À uMsƉt$(D$ D$D$4$7=L ? uL UVSz 9u 3D$/4$ " t$ $D  D$D$ $ 0BD$ D$D$ $01 !Ѓ D$D$ $1[^]Y RD$D$%@4$r D$t$ $.2 Ɖt$(D$ D$D$4$-6=J ?)1S$b4tƃ YJ 8#tJ 0ztJ 04$ƃt\J UE$]fffUWVS x E@ E։υEE y ]]U ] }ED$D$ $D$ЉM;MM }$UM T$L$ U$D$ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSP$w ÉD$T$|$$|$D$$7'D$,H*)R)L$L$|$}<$&teEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8Cv Ǡ}܉E؉Uȋ&8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,} &UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$]9 1E܍'D$D$EЉ$]M< t#tWuՉD$EЉ$]< u݋FV }؉WF2}S1}؉}+E܍}̉D$EЉ$]< tu}܍D$EЉ$\< KD$EЉ$]6< Hu݋E܍}ȉD$EЉ$]; u݋}Љ<$]7 |?sE܍D$EЉ$]; uE}u8}DGt.E܍,D$EЉ$]t; u1ۋEЉ t.u}.E}Q} auD$EЉ$]: usu̅u#D$EЉ$]: uݸUWVSp Ƌ'<'wwEVN)щȉMEED$$cct_FMȉFD$F$>ct:F]؉F>FDF 1[^_]ÿ'E {UWVSo D$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PID$LD$T>,K\$XD$Xtt$T=qw 9=D$Lt$Xtt$T=qw 9=tD|$P\$XL$HD$TD$dU ID$Tb\$XL$HrCMT$X)Ћ$‹RD$\T$`F3W<D$|t$xt$X$1=\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$Ad$$2dD$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$N0lPT$|@A$D$\T$`AQ T$TeD$T!,K\$XL$XD$|)ЉD$|$)ى$NiItсqw 9=lL;$rD$DD$|PT$|X$A$D$\T$`AQ LD$T\$XL$HƉL$HD$|;$rD$DaD$|CPT$|X$P$T$dL$hPH LD$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$NE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$KC^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$XCD$|PT$|t$Xp$B$\$dt$hZr D$XLD$Pa,KD$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$P:# $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P=D$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$P WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$<t ] 1uUT$$]=tFuɿ [^_]UWVSB sДt:̔>t M1uU T$$N=tFu̿[^_]UWVSLB ñr0t:,>t M1uU T$$t M1uUT$$+UWVS'? ÌoE D$E$P D$ED$4$NjE8tBV 8"tn˜E uOt$ E D$lD$$҉[^_] 8"u썇vE뱋 t[^_]ÍvҋE D$XD$$@UVS*> ÏnuF$4F $44$4[^]UWVS= SnE 1t 8u$+E]M $胦NjExlD$4$/MA XEU PMhEED$<$ Dž?nED$=<$HE u M D$<$7uM+E UR V tMV}9~t!Љ1OMV}9~u oSEK1ɋE g t&}G$2<$21ɉME[^_]É|$OD$$<$2̉<$2E$2ffUWVS8; clur D$D$4$HuD$:4$DžD$D$4$hF$H $p)D$$D$D$|$ D$D$O4$>6$(AD$D$|$ D$D$4$5w|$$Hƅ>d~kD$E D$ ED$D$4$_tWD$D$zd@ $  $袦D$$ |$$ƅOD$E D$ ED$D$$$+D$E$PtD$$`}$/$/ 8[^_]À>/uEt$D$<$t'D$<$贤^g 8E D$t$E$l}8[^_]ËE D$q3D$E$@E D$D$D$ ED$D$O$3BE D$t$E$Ϲg E D$D$E$Dž1D$ D$E D$E$Dž1`9 E D$D$E$910$% t$ D$E D$E$/<$1D$E$}D$/4$ E D$!D$E$DžDžkD E D$K-% E D$K-US(}6 fEEED$D$ED$ ED$D$E$a1x E([]øUS(6 vfEE>ED$D$ED$ ED$D$E$0x E([]øUS(5 fD$ D$$?D$D$D$D$D$ D$D$D$D$ $0x D$([]øUS,5 ÑeED$D$ ED$ED$Ɣ$bx E[]øUS4 8eE$mU4 eUt ]Í]UWVS4 d}|$E D$E$9s [^_] ?|$ t$!D$$[^_]UWVS4 td}|$E D$E$荵9s [^_]] ?|$ t$("D$$[^_]US 3 dE$ct []ÉEؔT$$EUS Z3 ÿcE D$E$蓛t []ÉEؔT$$EUVS 3 qcu4$ t[^]ÅtEt$T$$EUWVS2 cu} |$4$$t[^_]ÅttE|$ t$`"T$$EUVS[2 bu t$E$w%t[^]ÅtEt$T$$EUWVS2 hb}|$E D$E$u[^_]ÉS 0|$ E D$"D$$[^_]UVS1 auE D$4$t[^]ÉEt$"T$$E[^]USA1 æaED$E D$E$5uE3T$$E[]US0 SaED$E D$E$w5uE3T$$E[]UWVS$0 `D$ D$EUD$T$EUD$ T$E D$D$E$Ɖ׋D$ u $[^_] L$ EUD$T$EUD$T$E D$ ED$"D$$$[^_]UWVS$/ <`D$ D$EUD$T$EUD$ T$E D$D$E$診Ɖ׋D$ u $[^_] L$ EUD$T$EUD$T$E D$ ED$"D$$$[^_]U/ _U!Oፀ]Í]Í]Í]Í]Í ]Ís]ÍK]Í]Í|]Í]Í]Í]Í(v]Ín]Í7$]Íd]Íg$]Í]Í]Í`]Í]Í!]ÍK]Í[]ÍU]Í]Íb]Í.]ÍR]ÍM]ÍH]Í@S]Í]Í]ffffUWVSP X$Hp)9s L H 9r,P 9s P P P$@(@,[^_]Ë #p VpUWVSl- ]ƉUx HEU D$ T$ED$9s)L$><$~F [^_]D$$ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVSXX, \E}C11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<]kE;EriEE؅jEU9s UEUȃE9sv ED#UȅtEDDEX[^_]ËU#EE%ju}čE܉ƉEEU$T$?uẼƉE wt  ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EtUE9U9v UD#Eȃv UDEȅUDzwMaEEEE}πFI:k=b*}wű]u@MEU$T$]jMʉM}uEMũ~uYbO? wűEЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?zw<@lfEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEfCE%#jxE%#joEUEwù}FG8U}1 =FEt'E;Es ]ĈEEU̍Z]u܉ʉME}EMEsEЋU t1҉EU<@PGE̋EixủEFEE;Es U=EũE,UD$EUD$ T$ED$E D$E$]fffffUVS% GVuED$ ED$E D$4$]D$ED$4$U[^]UWVS4% UUEzlj(aED$/<$讷t<|$ D$ED$ ED$ED$4$/4[^_]ËE E|$ED$q3ED$D$ED$ ED$ED$4$u28upED$ |$ED$ED$D$ED$ ED$ED$4$|M8u EL8t ED$|$D$ED$ ED$ED$4$wjUS# rtUWVS! fQD$ED$$Ct{NjE88/tbD$/4$p…tL)JBU=wsG|wdD$}|$M$Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS [P}UtlƍxD$4$_tD%=`u'$U tĄ[^_]O1Ą[^_]1UWVSO ôO}U)tlƍxD$4$^tD%= u'$U tĄ[^_]_O1Ą[^_]E1US( OEEED$D$ED$ ED$D$E$x E([]øfffffffUWVS= ƖNÉUM&ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS(7 ÜMEUM؋ufUވM݋U 1ɋU EEԋ}&Et$$UEx}P$u܀G$Ut}EMU E1‹E Et~MލAf qC\PЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wC\PDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS [KUE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ |t$D$$E[^]ûu111[^]UT J  D$ ED$E D$E$]U  uJ  D$ |D$D$E$]UWVS &JNj2FEF<\<^t{Ѝ\&r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%P& QuJ{E< v^]v.F<&]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS B0t t~9t $sK EED$D$E $`uI tG@t  0  @x [^]É댋E[^]É @uUWVS( BUEtBEE0E}<$OUT$ D$D$<$-u蹵N))LXU܉e)‹M)LXUѸg4 )3,fD$<$EtTH tCp$1҉}܉ 9t-~fuUE܉D$$UuF([^_]1([^_]ËP 30f([^_]UWVS(k @UEtBEE0E܋u4$UT$ D$D$4$,}kLЍB)WUeЍBM)WUѸ>Љ)<; eD$4$E܋tRH t>x$1҉u܉ 9t(nuME܉D$$ZMuՋGy([^_]Ë;e@x([^_]UWVS( |?UEtBEE0E܋pu4$UT$ D$D$4$A+}-?L) RЍ)ЍQGEeE)  IȍE) GE*SRЍ)<;XD$4$&E܋;XAQ tJy$E܉u9t(~suED$$uދF E܃9u؋E܅tЉ)E eD$<$6-VUE}<$UĉT$ D$D$<$r%Mĸ-?L) @)ЍQAE-?LeȋE) @E)AM*SRЍ)XUD$<$VUte}tu}cu }uhFEE30f$z<EEe$J=X$0>렃}u E$R1҉UffffffUWVS 8E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUUƍp@Hπw09}맋E D똉UvUUWVS ;748,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$48C,s0K40u4 8$408 @0@4$48G,_G0Gƅ`%4& Dž,Dž$Dž(Dža`0:~LJwDɋ4TgXKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4gW0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4hE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4}t8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$4N0,OPDŽPUw}7D$$}>D$t$$-‰E$20UtYEE[^_]Í$ƅSE1ҋEEut$#D$$|M$-@ x Utb}ut$ؕD$$Y|EJ#D$$8|$Ex t;MEt$D$${L#D$${ED$D$ht@E$襬tEftUft IA(Q uEt E1:$腛t!D$D$$W7RB(E$RtD$D$$$7RB끃}p#D$$zʕD$$zUVS ,%EtD$ E D$ED$E$ƋEt$Q,[^]fffffffUWVSa $ƉEωD$$ItB4$ƀ?u1)9tXzzt"D$|<$m…uۉ<$Ϲ9t 1[^_]Ét$ED$<$N4[^_]ÉUt$ED$<$(4Uu[^_]UWVS #uEUt E<t] [^_]É΋Ex %1ji˃1҉9rExtftEx(1}fWVu~9Vt"VT$<$]ljFVEptft]CPSD  Ћ]XgËuVf;h{CftMWҍTRӉEf}]}^ Qu F 8vE9uڋE}f8Pf]s} H u yf}uHD$$%]C]C ExD$$!]‹EPn!f8t;Pft2]{u0 ftXHt݉f8pxE;x T@$`|$D$$]芧Ex E@$E11MȍV HnsffvrRPMu v@@1҉P 9rjD$$]]C(11ɍ&mC}G G$t$]G$uyf fE@$$]Ex D$<$] ]C$f$ffs@sU@@Jru9U@}t*JrHUznnJrfM6fy'bUWVS, ZE׉MT$ D$D$  E$蟪=v(6+8,[^_]D$E$ƅtʋE$>UU܉T$}|$ D$ED$4$7tJUMt@:tOE$Eǃu(EPEǃu E䉃 14$( ,[^_]ËE܉D$ |$BD$4$u΋MUD$|$E$LE=D$E$ƅUWVS։Dž)t Pv9s:ut<:t׃u)u͋[^_]ËrtftƄE$txDžiDžUWVS | ǃ $q8/u$ T… ${$4t!4$‹ [^_]Í$t,D$ +D$D$<$藧4$8 [^_]Í$螐TI/@$-Slj($<$uDžD$$Nj$OmtQ<$)4$‹4$|$$)t4$$<$t 눍  wUWVS ^EEE EUUD$$rtƋM‹E1lj4$AtKMUEt8,1ED$E$聲t' uMȃ[^_]ùȃ[^_]Í,HPEEE[^_]US# È蚹Eu[]ÍED$E $胿[]UWVS֋N ufS[^_]Ë~Of JN fJy8VӋ6s!uu [^_]äftuutYyZfUVS4 ÙƋ$F$F$F@$F$F $xF0$m4$e[^]UWVS (}wu G9r [^_]Ått$$tw[^_]É4$|UWVSs U MuR u+ftO؃tXf;0t&nt(suXDu蟷1ۉ[^_]ËEx DC볃UWVS ME 0@ Eu Ct8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVS uNE|F9sXtd|$$tH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$렋}<FUWVS< b E@ EE@ 0t$$sM4$JE@E܋uFX1tftE$u}D$|<$nHM|$E@ $E$xDMED$E@$SM;UBNju`P0@|$E@ $k$E萡Ǎ@ED>D$E@$Uu$EE<[^_]ËMAOMփEtfEtǤ$E܉$EP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$ Ep@@LEMA@AHADALudfx跫111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$E<[^_]px1113u܉4$֨u8uDMUU$EU r}fm몍$E0GU7UWVS ( UJEtB9swt$U$Ut]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$U]EfUWVS uVzF9sHtT|$$t8~VM f FHNMLF [^_]Ëu1[^_]É<$FUWVSX. ED$,E$} D$|$]x_xD$|4$]:iPU4$]莜= t<$w= E$]^= D$$P]ÉE܅F@ t$$<Et E 2t E D$,E$qEN EEE&E̋EE u<.tjDy@u붋}]荣D$ED$4$]ËE8g E E܃x f_EĉUED$ EԉD$E썈*L$E $@EċUڍwEJЀv)ύ)ȍD$4$u [^_]ÿU E=w ]1]UWVS t u4$4UT$ D$D$4$}-?L) RЍ)ЍGEeE)  IȍE) GE*S)ύɍD$4$讒u [^_]ÿUWVS4 ufF(}ȉ|$$kt4[^_]É<$?@1t9lufV(4[^_]UWVS' Ìu 0fV E0 4$@V(EfD$FD$ $UT=UwDE |)ʉM싆t7T$UD$E$U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$0[^_]ËUыU|UVS ButgF$RF$GF$ tqE9D$t$U$Z0Utˋ$g10$X1UDŽ05Euu ;t1< tHv0FIU$s00$d0UDŽ0+UWVS< Ǡ1U11ɍLt6u֔E+<ȁ<[^_]Ã0u@W@0ƃ:uVƅ/lFu,$a\9L$B\(  Ή$.D$.D$D$ oD$D$o4$~{qD$@|$/$9z:tRP:uVpƅz빉1$-Ή$0Ή$-D$-$|-D$0ω$Y-D$G-U$VU$M.$fƅD$/4$b/tY1ɉL$oT$/T$T$ L$D$4$t$D$$0F2(1҉T$oT$ L$D$4$빉ovFUWVS 謿 u}D$:4$Qt!D$q3T$$谈t|$E D$4$+ [^_]ËU t考 [^_]UVS ) ÎuD$:4$qQt!D$q3T$$0tE D$4$m [^]UѾ 2Ew0t ]1]ÃL]UWVSh艾 Eu 1MU1ҍx,U0ED$ D$D$@U$U{UƒE9~ЉLEΉ )t$|$ʉUM$6)MUӉϋʉU$<*uD$-*UD!L}|$t$$(uU+u h[^_]ËEf%UWVS` ÂEM Ǡ1U1ҍp,U0MED$ D$D$@U$UyUD$$ EED$ML$ED$&;EUT$$ u@謂 f!L^ut$L$$&U+uW`[^_]lLU$(ED$(UED]$UWVS`軻 EUǠ1L$\1ɍpwb0tNT$E UD$ T$D$D$@T$$T$:xT$1t>$LuT$ U MT$L$$.rL$\+u`[^_]ø7#UWVS SExw|,M0t_oƃtAkƍLU$:'ED$+'UED [^_]ÃLu$&Ɖ [^_]UWVSpG Ǥ}EU Ơ1uM1ɋ]p3,M0mQm8@E5~Eߺ81xEM}EL )|$t$ʉUM$]$MUЉ΋ʉU$]%}D$%UD{!L\$T$$]o]U+p[^_]ê0f%.t&CD$D$ ]oD$D$@}<$NuGj뉉f>~$E~LSC9u1Uf~7g]腉]+ US IEPw*0tF-[]ÃLu$'[]US菷 EPw*0t-[]ÃLuU T$$vZ[]UVS 2 ×uD$:4$zIt!D$q3T$$9tE D$4$ [^][- [^]UVS 躶 uD$:4$It!D$q3T$$tE D$D$4$&" [^]ËE D$D$4$ [^]US 4 ÙEMPw*0t蓇- []ÃLuL$U T$$$" []USѵ 6UBw0t1[]ÃLu$pX[]UVS 艵 uD$:4$Gt!D$q3T$$~tE D$4$} [^]貆- [^]fffffffUWVS f}E1EL xt=1}t ƒu@u[^_]UWVSĀ莴 }E|1xƋE 1L: EL* E|1E]ELB Eƒx  EB A ǁE9uʋE%u ͦ EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËUL 1ۍUL @t?Et鸓$I )9uu1믋}L: E1ۍEL* EEEu1}}}8tDAuEƃ@E}t,ى%I$))9D E9u }u _]uE,^@]l1҃DD [ u̓E9uEL& a:!@t$E,Du۸@u܋}L ƇL lE}8,L8L 0u}̤L ], ]Ec M{ }~Et M  ЋU 1ҋMDŽ,  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹Et 1itEUEEt @FEǀ ] UWVSXۮ <uE EM1ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EEL& EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHE EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋL ]3L ]3L ]3L 3L 3L 3L ]3L 1EEԋL ]3L ]3L ]3L! 3L" 3L# 3L$ ]3L% 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}uL u3L u1E䋼L u3L E1ljE3L 3L 3L 3L! 3L 3L" 3L 3L# 3L 3L$ 3L E3L% }m1]E%MɁ ȉEE%MɁ ȉE1E1L EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËME$ 4UWVSP褪  E̋uM M1EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍˗}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍ΗdEEEEEyD$ D$$<$]D9tD$ )D$|$E؉$δf}2ae}sha1f}1 }argo}argo}argo}n2d}M̈, _ȍ0 , MẸE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍1 MEṂ̍M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍, MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍D $,EfM ȃ?9̣K?9̣K ?9̣K8̣EfM ȃ?9̣K?9̣K ?9̣K8̣CEf?9̣K ?9̣K 8̣CC EEԉD$4$I2}n2i] UWVS虥 EǠ1EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë]n UWVS,! E؋U1ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø] UWVSD= U uU1‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$臞 @D$$ @D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$1D$$(D$$RP489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$QtD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1BUWVS [Eu 1‹E1D$D$LB $DžDž4$[8$u  t$4$kƉ$eDžD$$k8vu[x=uUT$$ D$$8k DžDžDž DžDžh|$4$j3ptjtmt2$衔1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$EN$UguDž!t$=N$0gDžID$$iƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$ht*D$ D$D$p$X$踑 4$`|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$D$D$4$D$D$|4$sD$D$p$U$%D$ԗD$&$ZUVS蝙 uv$ʵ‰)Ѓ[^]øh`UWVS4W ÉED$ut$u 4$rbu3D$ ED$$hEE8$E $]3h`)‰UE E h`9tt$u+E E܋E$]r^NjED$ut$u t$u܉t$ D$D$blD E$?ULD t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃D$D$b}<$TU^D$O O ȉD$$9EPU9uD$]^D _D  LD ȉD$$EPU@D$D$4$E4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS腒 9ɍ  dH USHf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂ E $2?ƂE aH E Ƅ E $,T$ T$D$$DG7D4$P`D$HD$T${14U+u{[^_]Íxƅ??tOlEȉDRHUWVSp չu(} 1E14$ O$?$u 1H$9u勅)ȉx  @4$軅$D$(|$4$ЅD$ D$4$超T$|$4$蚅}<$^$D$(L$<$sT$T$<$W$D$(L$<$;|$0, $諆$lj~T$,D$4$Dž0Dž4Dž8Dž<$,D$4$袄t&D$uڋ(D$4$|uڋfǃE $1ƃE $ D$D$E $ ?D$x D$ B$t$,$荅1s$D$(D$<$ ɋ D$,D$<$诃|$,$%B<$Uʉ)Ѹ%I$))Љ)‰ :D$,D$<$! ɋuo$D$(D$<$9$D$(D$<$̂ D$D$<$襂 $D$(D$<$~p D$D$<$W ?E 򉓌E D$06 < ȉD$$E E D$17 = ȉD$$=E E D$28 > ȉD$$E E D$39 ? ȉD$$E E D$4: 5 ȉD$$wE E D$;T$$ME PE @D$D$,$E+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž DžUWVSȂ 1MMUu1ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$-yD$@|$<$KyE D$D$<$2y|$$z<$xD$@t$<$yD$t$<$x|$4$szE+[^_]Éu4$mxUT$L$4$xt$4$zDž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\T fUWVS~ &utJD$ED$4$7NNjE9t.8u) P8"tE 81[^_]Ãu1OUVS_~ EU ]~ÍLу? H9u[^]UVS ~ uEU ]~Íу? H9u[^]ffffffUWVS8} &ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U} }Et t&t1]ËM t6VN]ËE t^N]ËE tMN]Í=K]Í=N]ÍEN]UWVS| u} 4$9uw[^_][^_]UWVSdb| Ǭu}$}(E($EjEEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$qUЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$ZqjfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSw Ku4$xu1҉[^][^]UVSw u4$@u[^][^]UVSsw اu4$u[^]}[^]UWVS7w Ü}u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSXv M $n<ƉEE$dljE4$dƉEE EEEED$ML$}<$1t.1EM $lM $l4$lEX[^_]ËuE$ dEtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSDu é}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSt 8}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVS]t ¤}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úUs RE##+ፂR]Í'q]Íx%]Í%]Í R]ÍDO]Í1O]Í O]ÍO]ÍL$]Í|$]Í$]ÍO]Í$]Í %]Í4%]ÍT%]ÍQ]ÍQ]ÍQ]ÍQ]ÍQ]ÍQ]ÍqQ]Í]Q]ÍJQ]Í3Q]ÍQ]ÍQ]ÍP]ÍP]ÍP]Í$]ÍN]ÍN]ÍN]ÍfN]UWVS r EwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$7tffffUS q HU T$D$U$# []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVSp ,u Ee…t5҅u.URу+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS D tu} FEFED$E$O?$ug$E% D$EUT$<$ u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSXB .s}EE 1UE1D$E$wƋẺ$-E+} f$OME Eĉ4$"U9PMMȃ/MU)ƒ$v=yM}BEŰB8D$=UĉT$ D$D$u҉uȉ4$4$‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$/4$9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$4$|‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$4$‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fE~UMR)уtu]UVSU ṽщcw[^]ffffUWVS< 0m|$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$`,T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSL/ (`uE Ǡ1U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFTUWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVSK, \lj(UE uà1, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(PUWVS\* iZML$} 1D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$"V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$ك\$0[I!D$0M&\$0!D$0XMnك\$0!D$0&_Fك\$0!D$0Tcك\$0k!D$0Tzʘك\$0R#!D$0dFك\$0"D$0`}|}\$0!D$0gtك\$0c!D$0Mك\$01"D$0r7^\$0!D$0B}\$0|!D$0Gك\$0"D$0c}ك\$0b"D$0>טLك\$0%"D$0fgك\$0"D$04_c}:ك\$0V!D$0F!كR!D$0\$0g!D$0\$0M!D$09"D$0z\$]$+ED$]݃$6/!D$0"D$0"D$0"D$0"D$0k"D$0W"D$0C"D$0/!D$0p"D$0\"D$0H!D$04]ك\$0$)t E؋pzt ك\$0>~!D$0 "D$0 a!D$06 C"D$0%!D$0f !D$0H!D$0* !D$0 6!D$06@ !D$0Iq!D$0 S"D$0q5!D$0v, !D$0Xa"D$0:b!D$0!D$0|!D$0g!D$0Nc"D$0E!D$0'!D$0h6 !D$0J!D$0,!D$0!D$0!D$0,s!D$0mU!D$07"D$0x !D$0Z!D$0?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍}WPGX LWTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍-U܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍&U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍(&U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍-U܉BE@Q?}/]ԉU-}E̍ĚEPD@B?} EEUԉu@}E̍]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍U܉BE@Q?EЉEE}U̍M܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}L]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍ݚ]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS + Ð}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$& Eԋuu1E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVS sE}Mx11 rtE xfDU9uEExfG0UofxZUWVS4I Ǧ}̉ÉEЋ@,E܋{t-Ek@^S,sɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVSj Ͼ} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}LDDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$lDdž   9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS  lEuE EM}EEEEE U$o81f8]vEFF ^$}uEEG} }UD$D$F($V ÅUF0@*P@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]A|A13u3 eEKGF$E$GF F( [^_]øCE%@F4$}U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@ CL{DMqD-{uvuju^CMQ+QS $ | 0 E[^_]älfb.t&ft.t&`fV&ft&fu5AfY{8f3f+0f(-f%*$ E1E%讄 ,UWVS8蔄 EȋM }׃}T,uĉU 2A3؃u߉߉UθEEEE]ȍ,ỦuEʋ1E؋u3ruԋM3JMЋ}3z }}3z}܃<EEEEE܋EU U҉3tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9D$U:^NjFD$U$讗tE 8A) [^_]1 [^_]UWVS W }GtUD$U]ƋGD$U$Ht+4$P=yarauE 0( [^_]É4$r1 [^_]UWVS W Å}GtUD$UW]ƋGD$U$˖t+4$Ӥ=tciduE 0O( [^_]É4$1 [^_]UWVSV ED$E D$E$u tSEt4}D<$\ƋED$<$8tE01[^_]'[^_]'[^_]UVSV uut$E D$E$ t.yaraUFƅu [^]K'0[^];'0[^]UVSU ut$E D$E$s t.tcidUƅu [^]&0[^]&0[^]UEU E MMM] UEU E tcidMMM]UVST YE D$E$vƉ$Ǣ=tciduE0[^]1[^]UVST E D$E$EvƉ$w=loobt 1[^]É4$ŊU[^]UWVS KT ðE$ډt,ƉD$E D$E$vlj4$M [^_]1 [^_]USS VE D$E$uUT$$dA[]USS E D$E$YuUT$$A[]USS E D$E$ uUT$$A[]USFS ëE D$E$tUT$$)B[]US S rE D$E$tUT$$WB[]USR 9E D$E$utUT$$`B[]USR E D$E$8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS L /}E$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS gL |E$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS L j|EU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS K |E$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS ?K ä{E$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS J @{E$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS xJ zE$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS J zzEU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS I zE$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS PI õyE$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS H QyE$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS H xE$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS %H ÊxEU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVSG )xE D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS gG wE$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS G qwE$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVSF wE D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS AF ævED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS E DvED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVS}E uE D$E$gƉ$P=gntst 1[^_]É4$$P$U83DžtڋUT$D$4$$t U:[^_]É<$;UVSD XuE D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS D tE$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS ;D àtE$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS C Etut*t$E D$E$%flj4$ [^_]1 [^_]UVSC sE D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS 7C ÜsE$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVSB @sE $jxt%ƉD$E$蟊lj4$[^_]1[^_]USB rE D$E$ˆUT$$/[]USOB ôrE D$E$艈UT$$F0[]USB {rE D$E$PUT$$0[]USA BrE D$E$UT$$0[]USA rE D$E$އUT$$0[]USkA qE D$E$襇UT$$0[]US2A ×qE D$E$lUT$$%1[]US@ ^qE D$E$3UT$$p1[]US@ %qE D$E$UT$$1[]US@ pE D$E$UT$$1[]USN@ ópE D$E$舆UT$$1[]US@ zpE D$E$OUT$$1[]US? ApE D$E$UT$$ 2[]US? pE D$E$݅UT$$ 2[]USj? oE D$E$褅UT$$2[]US1? ÖoE D$E$kUT$$2[]US> ]oE D$E$2UT$$2[]US> $oE D$E$UT$$$2[]US> nE D$E$UT$$12[]USM> ònE D$E$臄UT$$22[]UWVS > wnE$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVS= nE $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS S= ømE$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVS< UmE $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS < lE$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVS2< ×lE $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS ; Et1닋F$ʉ<$1oUWVS $ HUu} D$|$4${u 1 [^_]ËED$4$yt|$4$| [^_]UVS$ T$ sƅt'D$4$(oFF F[^]UWVS+$ ÐTu$ …D$$UnUBB BU4$EE$Ut]NjMs"EtfEtBEB Ѓ[^_]׍D$ 0D$D$/x&$$n1UVS># ãSut4$[^]"D$ D$D$}x&$?UWVS" BSEtw} |$ ED$D$$OƅxEH $M…t1|$ ED$ML$$UU1x[^_]1[^_]ÍD$ D$D$Ux&$U " RUT$ $]UVS! ^Rut4$[^]D$ D$D$}x&$UWVS ! Qutb9uXFt@~ G$q…t>FtAD$$URU [^_]H4$l [^_]1 [^_]ÍUWVS ! nQutJ9u@~ G$…t,Ft/D$$UU [^_]1 [^_]ÍU PEt 9t1]Ë@ ]U PEt9uP@tt ]1҉]Í]US, ÑPEt 9t1[]ËU tH Q9Ur@tD$E $[]ÍU /PEt 9t1]Ë@]UWVS O}t;9u1G $v ƅtGt"D$4$Z[^_]1[^_]ÍU7 ˜OEt9u @t]1]Í]UWVS ]Out 9t 1[^_]ËU tM 9uFtA F EP$U DžtŋE HɋUtOFt@L$D$ -D$T$<$SF~}~ t$s븍UWVS4 ÙNut 9t 1[^_]ËE FtE $F EH $M …tFMtI} |$D$ -D$L$$UFUV}~ t$!o믍D$ D$D$;x&$USL ñMEt 9t1[]ËM tM 9uL$$)mUS jMEt 9t1[]Ë@tU T$$[]ÍUS MEt 9t1[]Ë@tU T$$}[]ÍUS] LEU tG9u=t99 u5Rt@tT$$"[]Í@uፃٸfUS XLEt.9u$@tU T$$[]ÍfUWVS  Lu~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$D DžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ ƅt'D$4$eFF FE 0 [^_]É<$D$D$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]US lJ8D$$!PF $[]US .JPF $ڋ[]UWVS4 JM EpAQAtp͜D$ T$L$D$ uԉ4$.D$,|$E$ipt2t$E$5mt|$E$^q4[^_]Í+14[^_]ÉD$ T$ԜD$D$ uԉ4$y&D$ LD$D$@'$UVS HE 0t$lF $4$1[^]USW üHD$PF $&D$lF $01[]UWVS  rHlj։M}ML$ED$G$,VEU9ErfEG[^_]8"u1UWVS Glj։MML$ED$G$XV!ЃtNEG[^_]8"u1UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS Gƍ8D$$踋PF <$藈t$lF E$t $E4a<$kUЃ[^_]ÉE<$S$ &Ut֍ D$ $M`MAFAFA<$ t$E$Mt+$E`<$M $A UЃ[^_]ÉL$ME$M9uE<$訇UЃ[^_]ÍٜD$ hD$D$M@'$UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS- ÒDut 9u4$^[^]1[^]UE@]UWVS GDEt 9t1[^_]@t9H@1һ9ˉr|9[^_]ËP@Ӂw?Ӂ19ωr-9[^_]ø@[ QU wCEt 9t11]ËP@]U JCEt 9t11]ËP@]U CEt 9t11]ËP@]U BEt 9t11]ËP@]UVS] ¾BEt 9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS :BEt 9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUSX ¹AEt 9t1[]ËHX@uȉwދE []ËHP9ȸsUS RAEt 9t1[]ËHX@uȉwދE []ËHP9ȸsU @Et 9t1]ËHP@txE P]USH ©@Et 9t1[]ËHX@uȉwދE []ËHP9ȸsUVS >@Et 9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVSY º?Et 9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS 9?Et 9t1[]ËHX@uȉwދE []ËHP9ȸsUr >Et 9t1]ËHP@txE P]U0 ‘>Et 9t1]ËPH9иrE ]U L>Et 9t1]ËPH9иrE f]U >Et 9t1]ËHPwE ]Uk =Et 9t1]ËHPwE ]U1 ’=Et 9t1]ËHP@uxE P]U P=Et 9t1]ËHPwE ]U =Et 9t1]ËPH9иrE ]Up <Et 9t1]ËPH9иrE f]U* ‹<Et 9t1]ËHPwE ]U Q<Et 9t1]ËHP@uxE P]US <Et 9t1[]ËM tM 9uL$$[Ug ;Et 9t1]@tHxUxU M3P3H ]U |;Et 9t1]@tHxUxU M3P3H ]US /;Et 9t1[]ËHX@u xExȉ3E 3U []US :Et 9t1[]ËHX@u xExȉ3E 3U []UWVS1 ǎ:]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$@D$$~tU [^_]ù RAu_Uu>fUWVSP Ã9<$eFH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$cH_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS< 74$}cB BBB$BBB(B8O)Bf^.t{BDžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upB SxauZxluTxsuNxeuHxBJB(zZxru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%ޣlXBB(ޣуzc<$N1USEJv[]ÉuUS E ê3E ;Et1 []ÉD$ED$E$C []UWVS e3]u}E E $‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]Bu?/ F(<>tt uHvf~ t{ lqG u\.x$E]D$ D$D$l'$) t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS0 {0EEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE$Sp(r EpD$t$$t}(u GtXtA1(u~u EpENjE$[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVSy)$Rlp$VthD$D$E$dp0xD$p$3$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$HfƋt0<$eplD$T$4$iE D$4$NjtPD$T$p4$oipT$4$7t${Ĭ[^_]ËlЉhdD$D$p|$D$ D$D$$deƋt0<$"dhD$T$p4$hD$D$D$D$ D$lD$p$dptdtAT$4$6t$i1p$hct$F1UD$E$]fffUE 9E]UWVSp&ƅtBD$$xEt E$@;DžMu% $1\$@DžtED$<$@D$G$iEG,w0G4G8G<[^_]US&|F $g[]US%CD$̕$j|F $g[]USLñ%D$|F $gLD$F $%1[]USi%ED$E $[]US<%ED$E $躾[]US %E$hE $zh[]UWVS(q$UM܋p4@,EEGEt@E<E tBD$ lD$D$'$ҵUWVSpuFt09u&x<$@bƉ<$/b[^_]Í(D$ D$D$'$ZUWVS]Ƅt1fƅtptC[^_]ÉUx<$a1ɋU5ƅtpt<$a[^_]Í)D$ PD$D$'$迴US_E xt"D$D$E$C[]ÍPD$ D$D$ '$XUS]UB4tB4R,…t8$ 8[]ÍhD$ D$D$'$/D$ D$D$'$ʳUWVS4hUM@8t 14[^_]ÉƉ׍@E$-`Mt9pE}<$6Ex4$C7E$_4[^_]ÍCD$̕$a|F ljE؉$]UT$F Mԉ $ۜE܅$6<$]V09V4E$`6N4F,E؋U<}Nj2UЉMԃD$E$7MԋU|A)D$|$E؍D$_YEF,}܉8MHF4F<E؉$\E$蛰E܃,}<}ܜ$EMlD$ $I5}|$MA$dEU܉PU؉$t\|$}ԉ<$oE܅$5U؉$G\E@,vu1<$Z0[^_]D$4$=t؋E EtɃF E䍃lE؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$D$4$3~D$4$<4$<U܋T$4$P tEO49H1hEq<$YD$4$>Ɖ0[^_]Ë}4$(<E$5mcD$4$v9n}э&D$ D$D$'$}}E$l5n 4$;EԉD$4$J=D$ D$D$'$UVSE 0t$F $F,v }><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> D$ LD$D$e)$)=2D$ LD$D$,)$ۙUWVS y$kD$$UUBB BE u Ѓ [^_]ËE $UtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS u} tEt=$荿t%T$$EAE@px [^_]11UWVSBçuE u@1$ DžtD$<$GwE G [^_]ËE $tDǃ} s E uE u뛤ƐfE tM E tE o1UWVS u} tEt=$it%T$$EE@px [^_]11UVSÄutG9u=Fu!F D$F$tH[^]É4$[^]1U$Et 9t1]Ë@ ]UEt9u@]1]UWVqEt 9t1^_]ËU tP 9Urptt} suuɤfuufUWVS2EtH9u>P pt0t{$U衼t!NjUs*ut[^_]Åu!1[^_]ftt鍃*D$ D$D$)$聕<*D$ D$D$)$WU`Et9u@]1]US4Et 9t1[]ËM tM 9uL$$US Et 9t1 []ËM9H uU tL$M L$@$  []UWVS +Ðu>t=~(u7Ft=D$ T$VT$$t F$ [^_]ËFD$U$11tՋ}O $M診EtFVT$U$MUK9}D$ۢD$4$I$?ƅD$4$FEF~ E 0%肝D$ED$F $zljEt\UF$F 9:" D$ lD$D$)$E$ [^_]8"uE$$WƅtEE$1 1U(‰Et 9t1]ËM tM 9u9]UVSI t$F $ƃF t$F $~ƃF 1[^]USE xt<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$Buύ&T$ T$D$#d,$Xot][^_]UVS蝧]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍&T$ T$D$Dd,$'nE >][^]UWVS謦]u {uZ~uvDD$$t4u~ tku btXD$$Yu1[^_]D$<$;t6utwD$$u븋vt%u tD$$u댸[^_]Í&T$ T$D$cd,$lD$/$;E >][^_]zUWVS `UEx } $-ƅ$tzFFF E Ft.ED$4$ׄu`$a14$W [^_]Í <D$4$u뵉4$1 [^_]D$ 4$ztFu2|D$4$kD$ 4$ESD$4$-;>@D$|D$4$-D$ 4$Ex UWVS 軣 ED$E$5t>Ɖ$fiE uU4$tU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSFutFwyM MJ]ZMJ [^]$t|] X]XMH ]X뼍 D$ \D$D$A,$yi,D$ \D$D$B,$Oi1fUWVSKUu }t`t`tAtA}tA uutA} $[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍-D$ LD$D$Z,$=hUWVSED$] u}څu59D$}t }GȋT$[^_]9sut E|$8XD$1σL$uT9r9ڋD$)]t}W뗉u 11҉ËD$\$Z D$)‰$ L$t$ ؉։L$T$ ދT$L$T$ÉӉd$ D$T$9rFt>Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9r uhctBu wue[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$mD$L$8D$9\$(O"D$8D$uL$8ǀ-;+=D$D$,C0LD$D$$D$ D$0 D$4D$, 11҉D$8T$<~09L$,xfD$$|$89T$ |$<O|$<1\$81؉ -D$0T$4Ë|$<ߋD$8d$0ډډD$8T$<NyЉ< uA< W9L$,jߋD$8T$e[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(#D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(yJ"D$8D$D$=u4$E9)EE8EE1҉MԉU*}D9FEE>tHED$|$U$0uى<$0-}9EuEEE>uMԋE܅Ex‰ENjp,&t$E8:tED$ED$ $;G910E<-<+<:?eB9FB 9F <;uEy69EB&tE8:tD$W$:91WE<-QEx:T:Fw E؉Gw t01EE4[^_]ËMԋUEE$d+EME8<:y)EEw vSẼuE MЋM؉2&t(E8:t ED$l$9EEЋO191EuEEyU؉:P}:EЋutE $MЉ)E)uK&t$E8:tED$ED$4$891GyuE&8tE8:tt$$8910&tE8:tED$$U8녀z:}9E~} }؉&tE8:ht$$7QG Iu UWVSbTI u$ǃI E ;M8-p$xI -$D$-E$ǃI --|$E$tAx:ǃI >u[^_]Ír$I :u>u t E8:?부xt$됋>uMx:tE9M$E8:t} t|$ D$h-:1I $[^_]O|$ D$D$&$!'E 4뤿:US `DD$ D$E$͢ []US`D$E$]]US }`E D$ED$&X$@ []USF`ëED$ E D$ED$&X$e[]US`mU ED$ 1D$T$E$-[]US_/D$ D$D$E$[]US_U D$ 1D$T$E$[]USP_õED$ D$ E D$E$\[]US _|ED$E D$E$0 []US^KED$ ED$E D$E$蘆[]UWVS^uD$4$nx$P8D$4$[^_]É4$2US Q^öED$E D$E$ []US ^ÅED$ ED$E D$E$[]UWVS,]KEt8uj}ԉ^;(ǟ$u#FFF )t$|$$,[^_]ÉEԉ$0#E؍cEEu}Մw끋,uU]€Ex9(ǟ]Ë,]Í]UWVST\DuE }}Ǡ1}U1҉ tP9utLD$2@D$u4$4$9"PEu5ME+ЃT[^_]Áuqp4$"PEtˉUED$t$E$U뭋@E 7tSED$G$%ut$ L$ 5D$D$2u4$4$u!P7'ffffUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UE@)@3U u@ @]1]USEU ]xuQwLHtCu?HH LZYZYR Q X SP ҍ1[]øUExuxw E ]ø]UExu@ u<.w]ø]UUM zuB u<.w~ 9| D ]1]UEU xu@ u<.wx 9]ø]UEu E D]1]UWVS Y}uU }EuEE 8tr@‹Mϋu sptftuM)ȍx)lj;>M)C E [^_]EE [^_]ø‹Mϋu ru!u)wsyPfUWVS]M}4{ 9)1UD!ЉEUE)‹E1UU֋E M )Q)ʉUEUE)C [^_]1[^_]ÍsmUVSU] z)uGB1w<v5J q 9r#L tH8tP9r P9s[^]ú9r9s)8tP9rP B9[^]UVSU] z)uGB1w<v5J q 9r#L t^8tP9r P9s[^]ú9r9s00;ut.tP9rP9rغB뮉1UUE ttuB]ø]UWVSRFEEEuM<vwwٸu[^_]9rE|0tG)ϋU t9} rˋEtɋUUu_B]ZU [^_]ËE t9} r]tEMDċMnE]D몍BtYZUYM\$D$$]) MUʍBjUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVS]U Et9u4څt89stEt+p9r xD89s2E[^_]ÍCōH9rHD9r밃뫋U U:}7)[^_]UWVS}M UEEt7u2t99st1B9rr9s+E[^_]ÍWĸ9r:]t뫃M1u)UWVS] UЋ}uރstft[^_]uuBfUSO{D$D$ED$ ED$E D$E$![]fffffUWVSPN#Ɖ1E1ƅD$D$D$D$ D$T$4$t1U+P[^_]Í1ɉ  rFDžDžD$ T$D$<$u#utjƅD$D$D$D$ t$GD$G$.ut$$tu<$" $"肵UWVST6MÛ}Ɖ1E1ƃ J ƅD$D$D$D$  J D$T$4$cD$D$D$D$ L$|$4$;DžDžDžDžDžVDžDžDžT$ D$D$$!tjƅD$D$D$D$ t$GD$G$<ut$$thuGtLD$ D$@.D$$5J$ 1U+u)T[^_]Ë묋$c DUWVSJ]{EE uEǠ1E1D$D$ D$D$$!PBD$ D$D$$,Kt6D$ D$D$$3$yD$$3{D$$_$1D$-$+$$舯f$$躵t$袵D$D$$=~U+Ā[^_]Í) @$8fD$<$u D$$hDD$/$Pt4D$4D$"$8PD$D$|$D$ D$T$$CD$ D$$g$%@D$ D$y$6$$ D$`$$@$8u ^D$/$D$|$ T$D$$=D$D$|$D$D$ PD$T$$D$D$|$D$D$ o볋D$ D$3$ D$H$规э D$W$荄 D$i$n$,UWVSzEuElƠ1E1rf|tffDžpD$D$$oDžxkfDžrpD$<$Hx*rflE+u6Ĕ[^_]Ll<$[7lܬUWVSDtEhUƠ1E1pl } t2} /E+Ę[^_]ƅpt BtE qD$D$E $>DžxfDžrlD$<$xIrfhoƅptBxB |BEBEml<$ l莫U D$E D$E$]UWVSCÃsƉtE|E xE1E1DžDžDžDžT$D$$>SDžDžDž&D$FD$${DžD$D$<$9FD$FD$<$cc<$sO80.t&<8=~4$蠋Dž)8#tf$!vD$D$$E+Ĝ[^_]Ãh.$똋F?MƅD$D$D$D$ |$FD$F$|$$0vƅD$D$D$D$ |$FD$F$u!|$D$$D$}D$<$D$}D$<$dA6$=D$ @D$ED$&$i8D$FD$$DžD$$>D$ D$D$4$4$D$t$<$MƋ$9fDžfDž D$D$$D$L$$Ƌ$貪0<<4$D$t$<$D|4$D$t$<$#x4$eD$t$<$D$D$<$ D$D$$D$D$D$D$ D$D$ $u(4$\=4$w\=.$D$D$<$Dž ̢$8{$<$!D$t$$触 tD$t$<$芧tƋt$뉍.$z$ahtD$ $xz뛍.$\趣$DzUWVSlZ;ÿkuEEEEEEEEǠ1E1E fD$ D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$3ukEPt%D$T$,N $U"UEML$ML$M $M'ƋE$E+u1l[^_]É$VD$D$/$GUD$ED$ED$ED$ ED$E D$E$h]UWVSl9#juEEEEEEEEǠ1E1E fD$ D$D$ UЉ$U@EEEEEEM MEEML$ D$UT$$E@t"D$D$,O $UUuD$$ tM 9Ht?ED$ED$E$MEcƋE$ E+uhl[^_]Í$D$ ED$ED$E$ME 8뭉$[ D$D$/$ LUD$ED$ED$ED$ ED$E D$E$ ]UWVS7%hlEdE TEPEX1@E1D$pD$^DžHDžLph&` &\dD$ D$D$h$l D$ h4$l49p< `\?.< t.cЍLDSt< A< u< t< t< u< t< tuh9>uPp<+<-hq<@oHLDD$ D$LD$r$l ؉DžH<+ti<-,t$X$l~PH:f41@U+}[^_]ÉFg<@qs<@PHLDL$ D$D$r$l"DžH hUTd \4$l~ uDF)<@t$X$l; DD$ XD$D$4$lWtthLqUTqUT؉DD$ XD$D$4$lADžHDžL1cUTLUTLƅplUWVS2cE,E(E<Ǡ1E1ǃI U@D$D$ D$DD$<$@D$@ D$4$D$WD$4$膳84@@ $@P T$$l@@$9D$4$0t$D$4$q0|%=I $8$(4$:E+O[^_]þō9D$F$(…tG(D$E]Xω]ߋu1!1߉EyZϋMTω1׋u!u1EyZlju}l1u1u1Ɖ׉]1!1׉u]yZ߉uMu}1|1u1ljMϋ]1!1ωuyZ׋Ul}1x1u1lj1Nj]!ߋ]1߉uyZM]h1ދt1ދ]1މÉƉM1!1Ɖ]M yZΉ]d1ދp1ދ]1މËu11]nƉlh`1NjE1Nj]1lj׋l11ωE]n߉d}1NjE1NjE1ljl11En׉h`|1NjE1Nju1ljϋh11߉ulnljl}x1u1u1ljh11׉unϋlh|t1u1u1lj1׋l1׉|nllxp1u1u1ljhl11ωxn߉Љt}1u1u1ljl11׉thn׉p}1u1|1ljωd11߉plnlj}u1u1x1ljd11׉lnωU}u1U1׋t1׉‰ߋu11ljhd2n}U1׋U1׋p1lj}11ωdn߉M}U1׋M1ϋl1ωNjU11`Un׉}M1ϋ|1ϋh1lj}11߉\nlj]}M1ϋx1ߋd1߉ÉM11׉XM nωU}]1ߋt1׋`1lj}]11ljT2n‹}]1ߋp1Nj\1lj}U11ωP]n߉M}U1׋l1NjX1ljMϋE11LEn׉uE1Ƌh1ƋT1Ɖu11މHnƉ]|1d1P1ÉމM11ӉDMnىMx1ً`1ًL1M щˋM!ˉ! ً];ܼى|t1\1H1M !׉! M}MܼMωuxp1X1D1Ɖuu !! }ܼ։׋tl1ڋT1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋph1ȋP1ȋM1E ؉!! ȉEEMܼEuld1L1u1MM !! u>ܼΉ׋h`1H1u1‰U ֋U!։! uܼӉƋd\1؋D1؋]1E !! ؉EE]ܼEÉM`X1ً]1ً]1MM !! ً];ܼˉى\T1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋXP1É؋]1؋]1E !! ؉|E]ܼ|É|TL1ً]1ً]1M| !! ً];ܼˉىxPH1ڋ]1ڋ]1‰׉‹x ډӋ|!Ӊt‹x!ڋt ډt7ܼӉډLD1؋]1؋]1؉Ɖ Ëx!É! ؉p|ܼÉ΋H]1ً]1ً]1| ։l!! ً|x;ܼˉىD]1ڋ]1ڋt1‰x Ӊh!! ڋxlܼӉƋE]1؋]1؋p1E !! ؉lEhܼlÉlM]1ً]1ً|1Ml !! ً];ܼˉ]}1}1x1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhlh}u1t1u1Ɖ11߉ublUu1p1u1‰֋h11ʉub‰Uu1|1u1‰։ډd11lhbщMu1x1u1΋d11ubˉhEu1]1؋]1Éh11Љ]d3bƉ֋U]1ڋ]1ڋl1‰Ӌh11ʉ];bdUt1ڋM1ʋM1‰щd11‰MhbӉEEp1ȋM1ȋM1hd؋M11hM1bt|1ȋM1ȋM1E11ЉtbӋpx1ʋM1ʋM1‰щh11p]bډ|M1ʋl1ʋM1‰ыh11‰|9b׉}xM1ȋM1ȋt111؉xh9bȉߋE]1؋]1؋p1ËE11Љh3bƉu]1ދ]1ދ|1Ɖ}11Ήd};bM}]1ߋ]1ߋx1lj11lj]M b߉ ;E]1؋]1؋h1ËE11]bЉЉEEl1؋t1Ћd1Љ‰1M1ȉUM bȋMUUEU1Ћp1ЋU1bʉU1ЋU1E1؋|1؋]1bʋE11E]1؋x1؋]1<bʋ]É11؉؋]83uF,lj~@ F 0A41M+u [^_]É$pUE#Eg@@ܺ@ vT2@@@]UWVS UJEˉZs Zȃ?H]Ã?@)É]< u EEuzEJL$$UPE);MU֋} T$4$&ڃ@;Ur)]] E< u sHtft [^_]äfEwu^uDMEMuPuX] uD0Ezfmu KMfUWVS$ s6Eu] 1ENjE1U1Ƀωу| uىUD$}䍇D$$C%=Ut,D$|$$C%=u݋UD$T$$t!1уuuE+u$[^_]Ë]NmUWVS(j5E؋}u 1EԉËE1tX|$}܉<$]o1 F TFuF(}ԋE+u!([^_]$)]~ƅuՋ]lUWVSYþ4EE EEu}1U1ҍ $sD$@$o \19ȋ})׉ 9}PD$T$$n~3D$T$ $319|vUk0$o0t 140$oj0D$ $U+uw[^_]D$ D$L$$裹$o1몍D$$葥tыptvjUD$D$D$D$ E D$E$]UWVSt`2UUEEǠ1M1ɍu4$BM L$UT$4$ED$4$U+ut[^_]iffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVuMMMEM <wE)Ѓ9uEEED$D$|$ ED$D$4$>؃,[^_]x8 uEƀUGffffUWVS# } Ơ1E1D$D$HtHE$|t=ED$D$<$;Es1U+[^_]ø"㍅D$E$tt@D$E$Ku[ED$q3D$<$裔;EsED$|$ H%D$`d$T$U8.t&DCUWVS  D$P \$E$Ɖ؅u [^_]É߬01UWVShIî T ut$$3T @B1E}E1uNjU:ME1uEHt$$xxT @B1Ƌ}E1NjExME1EH D$E$.u(T ]ٸ@B1E1؃h[^_]øh[^_]$'2T UVS "Ç uED$D$D$D$ ED$E D$E$-YU [^]UWVS& D$`DD$E$_uE&@t&tD$E$u܉[^_]D$D$E$^t 1[^_]ËEpD$D$4$^E@<-u?EP&DPtEPD$ ED$$UMU9p9g^My+th)ƍF߃1BD$D$4$]E@t<+ !M?!U€E?w&t u]Ë u@u1]U=EP>w &]1]UWVS( u}܉|$D$4$yxINE uG>wl41EظE! EED$|$4$,([^_]Ã>w241EظE E膨yUWVSEu@D$ toOD$D$T <$艓y)T &t@T [^_]ÍU T$ t$)‰T$$뵍 D$D$T <$fffffUVSX=v^ot.&vnuucts Ƀ E u p}+t}}-t}=uP[^]Ã+t-uuPU #UP[^]ÃXtguu-tH@+؉M @ @+؃밉M 뫃P묃PUWVSEu gt,C-X.t&u!E I@t pguԉ%+t[^_]ÀouuPӃt>Mt }#x!t }#x!t }#x!rt #X t #X ރI#H ΃?lP!փ&EjUWVS\u>;EEEE}|$EԉD$$>$wi$EliD$|$$d>ED$D$Ẻ$MẺE0EU&DPuHщMEE1EEUM]L$\$ $T$](9tu׉EUM]ىeщٸ9и| E ;ED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]D$E D$E$l~9} P[^_]ÍEEEEEEE=uЋ$UWVS ѻ6]NjrEB t =BMU]\$$]赮EUMBEBf~uU)E4$]*uf~*u1f~*@DFP9\XD$lD$ PD$|$\$phd…hfDžHdf8,D$DtrD$$`q`l@ @$TP `T`l@ @D@Tt4p8`$TЅlS t%XYLYL! x . h9pHfKfu9p}H@u5l4d76|%= P\hS89sfC/fXD$lD$4$pd}hfDžPDž@DžHdf8tld[u|%=@tp1ҋf?f[uZp!!f90f[ʃfu‹ffP uO f?ʃFW Ӏ_ Y9t fx*f*ʉك |$|$<$jU+*D[^_]ÍJfzuf[Qy f2f]u답f[!u pf@!Wf]tI׉΍Nf%ff-uGf]HfF-Nf%fF_Wf]uH Af]O9]D$D$ D$D$$K|nP f 99sWfPfu9t.P9fx*P9fx*ʉW 9= T$ D$)L$pP$'72I$R…AD$D$ D$D$$Y@u\1W-f[!ʉfH98MUWVS Ӊ9x)ڍωރ׉HPftPΉ1ff}t[Fftf[tYf{uFfu勝M E1 [^_]ÅtJF뜍~Ff]fu{rZf]tFr^9r1=f[uSf]zfً9@S{f{f,uu91ҋLf fuM A}1xDf5f}4vd!qQf]tyىC)D‹΃s tfFu@ύSً{ fsJfPUWVS[Ɖ׉MB tA PQ wif>{tBEEft>f{uED$E$ZuۋE[^_]f~}uf~uM[^_]NyUWVSU}DžDžDžDžE uGE E G EGG؍uE uM}fH9z مtz\uJtE@̓fH9tiJufE tc[^_]É\@[^_]G4}뫋}UWVSvEPtF@E䍃E7~fu6~fu0NUDJ@uu\ *ƀ8t;>otĀ>ouw~nuqNUDJ@uu]\ ƀ8uŀ}#] >D] D$ 4$3t\ ([^_]D$ED$4${juNUDJ@u;t7D$ED$4$Lju,NUDJ@t\  \ tD$ED$4$ju2NUDJ@tz\    uD$CD$4$iuDNUDJ@\ @k$1f|D$D$4$PiueNUDJ@tQ\  G$6OvƉ\ 8ǃ\ ftD$ED$4$hu NUDJ@t \ tD$!D$4$hu'~=u!D$=4$1] AD$ΠD$4$Jhu~=tUt$] D$ GD$D$$/$sivffD$=4$0] UWVS{}G$D$<$Uht ƅu㋃] t$Uǃ] [^_]UyG$V]USV] u []É$OUǃ] []fffUWVS螝}M |u1t‹E1t E]ƅsM\L$$@uIEL|sxED$D$<$WT|1EEċEEȋEE̋EEЋEEԋEE؋EE܋EEEEEEEEe0fEEĉD$D$$*PIƅrt<$>bD$|$F$||EEdDžhƅxE`ElUEEAdD$D$`$ttu{Gm<r:sDžlmE$(um0lLEDl2D$lD$$xEUJv9|UJv9UJv9JUJu92UJg9UJY9UJv9wUJv9^UJv9UJ9jUJ9aUJ9+UJ9UJx9=UJ9UJv 9h;MExQhEtEEt3ЍLX& DQt &XЈUEt3ЍLX& DQt&XЈUxtOE@u,E tC&DB5DD$D$D$F$EƅxnƅxDžliE\D$D$$KEhihxEs^tE+VĨ[^_]EEEEEEEEEEEƅr|4UEh Qx9rsD$1ɉL$ $DN<$x1EID$@a$EE EƅsuP!hE$1u h0yD$D$F$J$QDž E|ƅxDžll$]g1E`DžhECD$D$F$7E!EEE1ƅsu3ƅxqFTbp~EL$X<$b…EhxhXM >l/hHhωxD$xD$F$%sދhEDžhEeY1lrs2lƅxrhu"E ?ƅxDžlƒhE`D$T$F$RE<Džl|DžlmDžl^sƅx1l31lEƅx1lEUD$D$D$ ED$E D$E$[]UVS^ ] t<] D$D$D$ t$D$E$ t2[^]$FBƉ] t$萀 ] u] [^]UWVS g,] (] $] ,] (] $] R9rVt $薈 (] 4$$] t } |$t$$ ‰,] u1҉Ѓ [^_]ËEЃ [^_]ËE D$|$ $D$D$$赘,] "UWVSe`<$vD] t%0] u1<$Y[^_]Í0] D$0] $(x ǃD] 뵉<$1UWVSG`4$D] tL0] <$V9E s"4$[^_]Åt10] } 9r1D$0] <$S(x ǃD] a84$hUS5ÚE$&ǃD] []UWVS8hD$$D$D$D$$D$ |$(|$D$$tIM w:E t(D$411\$t$l$Uƒ9r؋E e[^_]ùE ffffUWVS Qö $^5tƀ8u^UD$L$ aD$D$H] 4$KUE tE 8 [^_]D$ ED$4$xT}untHuG<&wt$1$PcD$G$:ct$$(cH] Wu@9|w뵍?9,s@뽍GЉED$G $bEEUD$G $jbMEbffffUWVS8nӽ1E11҉la rl] x/_a D$ D$D$$aa T$$ xD$\|$4$bA08t߉la 8#mD$\|$4$2At8t㉃pa D$\|$4$At8t㉃ta D$\|$4$@8t߉xa ǃa ǃa D$\|$4$@t>8t$苫a D$\|$4$@t8t$`a D$xa D$4$:DhD$\D$$@ƅ8tщ4$Quċ|t| >t|$$Uuቻ|a ?xuxu U+8[^_]Í|D$\|$4$`?.8t߉la 8#kD$\|$4$0?t8t㉃pa D$\|$4$ ?8t߉|a 8xuxxu x xa 8sxwxta D$\|$4$>tM8t$|a D$\|$4$w>t"8t$Qa |a uea D$D$n$K^Qǃla B{T1mǃxa ǃ|a l0T$$ SuUVS na tutKla [^]ǃa 9D$/_4$Ja ut$"$|1[^]UWVS莈uǃa a t-$`t$la $VRtEu1>9D$/_<$Ia uщ|$"$1la [^_]UWVSUuǃa a t-$I`t$pa $QtE/u1>9D$/_<$Ha uщ|$"$I1la [^_]UVSSøǃa a t$_[^]Í9D$/_4$cHa u҉t$"$1USFa t$J>ǃa []fffffUVS袆Eu tt# X[^]Åt u 1[^]Íx$"[^]UWVS2×}u D$<$Pt*xD$<$Ou t1[^_]ÅtWWUWVS8跅1‹E1D$ D$ED$E$KE…uZDžDž${${E+0Ё8[^_]É$s T$ D$ED$E$ƒ$rnEDžDž9~&t$$wt$|$ D$ML$U$HƃD$|$ D$ED$E $Y9D89trtftƄD$D$ D$ED$E$rƃT1҃8-DžDž1Dž$1UWVS@Ȃ-UE 1ƋE1D$ D$ED$$-Q…uZDžDž$x$xE+<Ё@[^_]É$ pT$ D$ED$$ƒ$owBDžDž9~&t$$tt$|$ D$ML$$$ƃD$|$ D$ED$$29D89trtftƄD$D$ D$ED$$HƃQ1҃8-DžDž1Dž1vUWVS@#UE 1ƋE1D$ D$ED$$Q…uZDžDž$u$uE+<Ё@[^_]É$lT$ D$ED$$[ƒ$lwBDžDž9~&t$$~qt$|$ D$ML$$ƃD$|$ D$ED$$9D89trtftƄD$D$ D$ED$$ƃN1҃8-DžDž1Dž1vUWVS |}"D$E D$<$ututf [^_]UWVS W|ü}"D$E D$<$SutuFtf [^_]UWVS {\}"D$E D$<$ututf [^_]US {1D$E D$E$ []UWVSa{ƫ}U Ơ1E1EteMyu )čD$UPtMP}y:u}D$<${U+ue[^_]ø UWVSz'EEM Ơ1E1EtgEǺu )ԍT$ MJtJx9uD$T$E$(wU+ue[^_]úEdUSzÂED$ ED$E D$E$襮US yPED$E D$E$Z<US y%ED$E D$E$<fUWVS yƉUt/ t"D$4$0uM) [^_]&DPu 1 [^_]É4$Ә [^_]U!y‚Et8t 1]ø]UWVSXxQ1EEED$D$Ẻ$la }e1󫍃a EЋM̍a |t:tEЃ9s EЄua t$D$Ẻ$qFD$D$Ẻ$pEЉED$D$Ẻ$px,uЍ$D$4$Ab 4$fnD$:WD$Ẻ$L`tb EԉEȉD$)WD$Ẻ$sDEԉa EȉD$fD$Ẻ$st Eԉa EȉD$D$Ẻ$rst Eԉa EȉD$:+D$Ẻ$Hst Eԉa ED$Yt$Ẻ$o  E1fa EЉ$KmEȉD$fD$Ẻ$r^Eԉa EȉD$]pD$Ẻ$rLEԉa EȉD$D$Ẻ$~rEfa EȉD$]5D$Ẻ$Nr*Efa EȉD$D$Ẻ$rEfa EȉD$4D$Ẻ$qEfa EȉD$OD$Ẻ$qEԉa EȉD$NUD$Ẻ$qLEԉb EȉD$XCD$Ẻ$bqEԉ8b EȉD$=!D$Ẻ$4qEԉt}4$D7T9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vLc 9u(ƄLc [^_]Éր>/t>trLc ǃstftƄLc [^_]ÉڍhffffUWVSpE$a6}|L&DB &fkfbfg@AD$ ED$E$]DEUE8E9t8u|lA8"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs @[^_]þUSEoêD$ E$m[]fffUWVSov}tz?tu<$4D9u p9ti8/t9t`sc~/t9u)=vLg ׃rtftƄLg Ѓ[^_]øtr€8/t Ƹ봸hUSUS lE D$D$E$J []ffT$D$Ít&T$D$.&&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  .&&T$D$L$  .&&.&&D$ffff̀rS[Ô[Ḯ̀rS[t[ḭ̀rS[T[̀ffff̀ffff/̀ffff^̀rS[[̀rS[[Ḥ̀rS[Ě[<̀rS[ä[̀rS[Ä[ḇ̀rS[d[̀rS[D[ḓ̀rS[$[̀rS[[`̀rS[[R̀rS[ę[2̀rS[ä[ḩ̀rS[Ä[P̀rS[d[ḷ̀rS[D[Ḷ̀rS[$[ḉ̀rS[[̀rS[[Ḛ̀rS[Ę[̀rS[ä[Ḩ̀rS[Ä[1̀rS[d[Ḍ̀rS[D[òrS[$[ìrS[[l̀rS[[t̀rS[ė[s̀rS[ä[r̀rS[Ä[p̀rS[d[j̀rS[D[m̀rS[$[̀rS[[Z̀rS[[ ̀rS[Ė[S[î[.&f*̀r׋L$Q1fffffỲrJ!Q[7UWVSeQLk Pk D$$WPk Xk +Tk \k s$uu[^_]ä[^_]ft뻋Tk PPk D$D$D$D$ D$ D$$Lk 31Lk D$$D$$M$a-Gf?USdPk E)9Lk t$Z[]à T$$8[]USEdêD$ $@`k u !$k[]fffffffUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVSjcϓEU1U9} t?E $M )ƉD$ED$M $uˋE8E[^_]ËUt E1UWVS$bNƉà1E16&ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $:Džtҋ0F D$<$F$F(<$]떋UWVSXa+E؋}E }o EEEE]&]wu8EX]E]܋DJ@u.<%uEUMYC ,i)\P(\1= ףR}؋,E@9R}؍,ʃ;}EPMMԃuEXQ))Ѓu.,i)\P(\1= ףIEP@}+,}G MEE@E܍k%y |Q))Í))эI P$I )Ѝ))ыEH )Ѝ))ыEHMEp8hE}1E   E $M]/$ljD$ED$M $uĉ}Ep4u}ЅtMuuMEFE}1E # E $M]#ljD$ED$M $6uĉ}Ep4uEЅMqUMEDJ@tDZ@uMEЅu6MEP $=ƉEE{MM߈]] u}Ѝ~}ƉEE}GEЅoMMU$5ƉEMwu?%1}Ѕ&^MEU$ ƉEE}GErMUЅEP$ mƉEEx @uMEЅM E؍uЅnEMEЅTE؍M$=1ɋUƉEEMEP$1ɉƉEE MU$ƉEM踓$I )؍))ыEHEMPЀ cEMEEЅZMEP$;1 MEP$ EEЃ} uG`MEP$1ɉƉEE UMEƍ@DJujMU$c1ɉQƉE$MElU$'1ɉ*ƉEE-l}G}ZMME MU$c1ɉƉEEȅEHQ)ȍEE}GMEM MEЅE؍; ]ЅE }}4E@E܋E@k%y DEԸQ։)Ѝ)ËEԍ)֍)эIP$I)Ѝ)‰)؋u̍\)Ѝ)‰)Ћ]čTE)؍D)UBEԃ}}}Dy@V؃DY@u]utU܋DB@UЃ@)aFUDBfvME)붋EEUЃA룉YD$1$E؍lډct"UB M)i]D$1<$E$&ډM]K U¤1sUbO&D$ ED$E D$E$j]UWVSD,OÑEu lk 9PMP M܋HP UPUPUElS *H/T$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$6 9D[^_]ÍMP MMIH??? F??? F?? ?F ?:??F:?? F????fF c늍h/9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ /D$|$4$G 9T1D[^_]UEFt$8V tQFtB1ɉωMT:0$_8V T:($P8V D: $A8M;NV r$+8F,t$8F4t -$8F8t$74$7[^_]UVSOAôq4$`k D$E$LJ4$C[^]UVS Aoq4$k $3J4$[^]UWVS@0q<$ܲk D$$NƉ<$轲[^_]UWVS @puED$@$$lED$E $l…t?t$U$= Ut'zu Ńtt$$ uUEHutU$tEUЃ [^_]UVS?5p4$ l D$E$fk4$ı[^]UVS?o4$蜱 l $k4$膱[^]UWVSL?ño<$] l D$$kƉ<$>[^_]UWVS >foU&E܍uu<0 )E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruuTM؋ut}u9tvwn<.uQy<0#BÃ߀XtXtbEf)Ǎ|&uԄIEDX@; [^_]BuԍE9t1 1UWVS d=m聧D$OD$&<$$E tED$E D$<$hD$$ E$US<RmdUT$ U T$D$E$qqffUWS<mLl 1󫋃Tn t D$ D$D$$H[_]UWS]<lLl 1󫋃Tn t$ǃTn ǃPn [_]UWVS<mlTn tELl D$ D$D$4$x;Č[^_]ÍۤD$4$Tn ($SxT$$pTn E Et[T$ D$D$Ll 4$uLl utmp Tn $1Č[^_]ÍLl fǃm Ll Pl Sl T$ D$D$4${Rl 0Tn n n  n $n ߤD$4$Tn 9D$4$Tn t:ǃPn Pl xfm _Ll Ll UWVS9>jufFt%=Ll FftFfwfu1[^_]f9t'wufwwF 9ll uٍLl UWVSX9ýi5Ll E$Epl FwD$ ED$<$Wtũ[^_]ÍG܃[^_]UWVS88Jiu1‹E1D$$󥋳Tn O$D$ D$D$Tn $D'DžTn D$ D$D$$C1t7Tn $D$D$ D$$hE+I8[^_]LqTn t7Pn mLl $ǃTn ǃPn Tn tPn 1]Tn $Ll NjLl 󫋃Tn t D$ D$D$$C$ƅTn $GD$D$ D$$ >D$ D$D$Tn $B<DžTn t"Pn uhD$ @D$t$<$"tcD$T$$j}ԃ iLl 2芝1D$ |$D$ $/6$UWVS 5{e}D$@<$辠t=D$E D$4$`4$o؃ [^_]D$D$!@<$dƃtqLl 1fǃm Ll Pl Sl D$T$4$˞K84$Ӡ8^UWVS 4xdu4$=w|xt 1 [^_]D$t$$vLl 1󫋃Tn t$.ǃTn ǃPn  [^_]UVSUE HJH J$J(HrDprHprLpZPXH X$[^]UWSEU H H JJ$HJ(xzDxzHxzLXZPH X$ǂP1u>uDtftǂDǂHǂL[_]êtfUWVS(u2bD$D$ D$D$@E$+E EED$ ED$ED$$UR Uu^}uGEtR}u츬u`umtftu$R([^_]4OU1މU$EUu11ExfUVS$Q1öaD$D$ D$D$"@E$tKÍE EEEEED$ ED$ED$$S$S$[^]þfffffUWVS0a}Et5[^_]à M M E} #>E11} ;cg,EEE}u#Ћu0}91dtt<u|7u9tȋ}*E T&U &DPttE 7] Ј} #} U &DPTu Vɨ=E bE 0<KE] DЋuQ} -} ^E nLE T&3E 0EEu } \JEt } %EEt } &=Et } =]E E+E} ?gU  Ћu9E T&7E 0] E } = ]E E 0<E] DЋuuE } ;U &DP"EDBE ]=&u DpuE /E 0uE E EEEE\EoE zE iE XE G}d}uf3EcmduE 0 E P] &WE &W ti1WL AUWVS,* [} EEEP]tsMM؍MM܉UE< )؉EED$ E؉D$ED$E܉$wAMEE@uEYYυtl+E,[^_]ÉMAt>U9t-ECR uEyt E됉/UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$^]UWVS)zYutn />3)Ѝ)Ѝ:~ 9w$&|n um"U$Ѓ|n U4$Ѕt?w$WD$ D$$U UЃ[^_]É4$uw$Wt$ =D$D$ $UE Ut1҉Ѓ[^_]Ë|n t;U$(NjU4$CЃ[^_]Ëǃ|n 뫋U tuW3ǃ|n dn ^D$$=tn Jǃdn 1+1UWVS'Wupn ))Љ):~ 9w$&xn um"U$Ѓxn U4$Ѕt?w$WD$ D$$UUЃ[^_]É4$uw$Wt$ =D$D$ $UE Ut1҉Ѓ[^_]Ëxn t;U$(NjU4$CЃ[^_]Ëǃxn 뫋U tuW3ǃxn `n ^D$$pn Iǃ`n 1+1UWVS%ÃU}E$Džln fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$MAF$U 1[^_]Ë|n VD$ ED$$E$@F$맋|n u$Ѓ|n $(ƉuE$@O|n at $Ѓ|n @~u㋳\n uED$$=Ɖln lǃ\n ǃ|n IUWVS#ÄS}E$Džhn gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$MAF$U 1[^_]Ëxn VD$ ED$$E$ @F$맋xn u$Ѓxn $(ƉuE$ @Oxn at $Ѓxn @~u㋳Xn uED$$Ɖhn kǃXn ǃxn IUWVS!ÄQUEtЋtn t'Ǎt$d9uǃtn ǃdn ln t'Ǎt$)9uǃln ǃ\n ǃ|n EE EE1[^_]øUWVS4 ÙPUEtЋpn t'Ǎt$y9uǃpn ǃ`n hn t'Ǎt$>9uǃhn ǃXn ǃxn EE E E1[^_]øffffUVS$BçOM EEEUEUfE4tvu} fUUT$D$E$"$[^]ÃuMfEED$D$E$t3f}t u9u61$[^]ú땺l#fffffUWVS:NpUE DžXE/tBD$E $p8%E $uv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p ])%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $p-Dž`&$`psD=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5pM?t9E tX$p&1nىf t~uf.륃8/utщ$p-E tE XfE pXE /t/tpp?p>1UWVS2×I}E ttrD$<$c xX[^_]Et$<$} DžMtAt$$# ymt E8"tƉ<$C1[^_])1fffffUWVSH}<$9n $[n ǃn 7ty&E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ën t$+ǃn ǃn  yEUVSE] :tu1҉[^] 8ut$8tù@tσ}:t$ u}:t;MuPx@t[^]Ät:u‰[^]UEGU]UWVS}u 8u u|t1:t,t(9s:t|tu[^_]1UWVSlgF] 1‹E1}! Mu$n t\$4$,$Dž  DžUD$ rD$D$4$DD$D$ D$D$@4$$D$D$@$ЀE<DžDžƉ1ҋ9slpȀ ':Dž\1҃ t t DžO9ϋ9rD$D$E$@؉؍pȀ Mx@<#D$$ߍAbDžԭD$=D$<$… <:<uz)ED$T$E$qƋtg<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $膀T$t$<$p$y@E<$*Dž:ύO9))|$$b)ljx1kO1tCȋ)Љ)Ћ))ӉL$$ÉNjÉC:{DžtE$|)P9rg8E+l[^_]D$ D$D$E$DžD$<$xn $MDžqt$$"DcƋD0<$E50Džu*$E$zËE$zjnƉ<$$D$ \$|$4$V tBt(Pu2Dž4$VDž$UH $qDžL$T$${4$Vf18Dž<$ptE$iy? <$1! 4$Vċ$u/$ {tE$xUUD$ED$$M E]US X<n t$\ǃn ǃn ǃn ǃn 1[]UWVS, ;EE 1E1Džn n &9n tn D$n $j6D0Dq@:#n ux|\u ǃn ׍:\tWut$n $5lDҀ|\tǃn ǃn n $AƋn $^ǃn n Pn @L$$n dǃn ǃn ǃn f:wu<:tAt<|uD$t$$ƍ@E+/,[^_]Ën $uhn $*ǃn +n n 09D$n $n Kn t$贿ǃn ǃn ǃn ǃn ǃn Zǃn ǃn ǃn -$?ǃn oUWVS8u} n t$ǃn ǃn ǃn ǃn } u[^_]UWVS 6Û7]D$=E D$E$$dDž<:}dUN<\Έmt>}<:tk_]J<^uF<:mu‹]U)ӉߍCdD$$],ljEEd<:uU_F<:PЀvH2Mɋ]PFE1U]ND9ut 0vU] :U]؋})ptD$<$]EtcE] [^_]ËU }1볾ʋE$]뵋] <$]UWVS]5]D$=E D$E$e$dƅ<:d <:t?Ytru)Cd]D$4$]Mtƺd<:uȉƍX)ˍ{t7Ή\$4$]fu 4$]@ȉ)ˍ{uɋE[^_]1밿4$]lы]R UVS D$#E D$E$6tv80tP 1F<w1F9~ƒ1F< w9E1 [^]ÍF<wF@ctftƄ//DžDž)S$J9>:7, 81Ƀ4uA )čD$^pxr󥋵t$D$$lD$xD$$j|$t$$xjD$D$$Zjudurtr1trrBvBDžfzngU $/1D$E D$E$]UWVSX/}U Ơ1E1EtqMyu )čD$UPtMP}y:u}1T$D$<$jU+ue[^_]øffffUSCè.D$$Lr D$ $kHr []UWVSHV.u} }ԋEE1EЉE1LD$,$rr u}MfMUT$U܉T$ D$ UT$$buM vU܋9Eo} ur t%9r t1uЋE+H[^_]Á} u r uD$D$$UE؅tEċE؉$YKfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$UDžuED$UȃT$Ẻ$;EsE؉$X % ЉD$D$ D$ED$Ẻ$߸;E1B9EBf9EwB U؍yM|$D$Eȉ$ EċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$7W3")UuuB r EfFcUSd+D$n \$ ED$EU $T$u؃[]1[]ffffffUVS<+M uEEEQEUAEt8MEȉD$L$E$9uUȋM̉NU܃V<[^]ÍuD$t$E$<[^]ÅuUS,[*EEEEE܍ED$E܉D$$|duE,[]US,*EEEEE܍ED$E܉D$$(duE,[]USNó)EEEEEE$c[]ffffff=̀rS[d)[ḽ̀rS[D)[̀rS[$)[(̀rS[)[L$S[(@&[t'L$̀rS[(@&[ US 8Ý(D$E D$E$^ []US k(D$E D$E$Gl []US9(D$ ED$E D$E$][]1UWVS'}E 4M0M( 1E1,hEED$E$iD$h8$ihdžPdžTdžXfDžD8H<$裼L$8<$褔L$8l9t$LbYD$<`T$0E[^]UVS&$ ML$ML$ M L$ML$@$R4u E[^]Éў0E[^]UWVS$=ǚ]Est M$ UT$Ut$D$ D$D$@$QU싀$ T$t$UT$UT$ U T$]\$$QHƅuE$[^_]ÍU븉0E$[^_]Ë$ 1UUQ&D$ED$ED$ ED$E D$E$]UVSsE$ ML$ M L$ML$@$R8u E[^]ÉF0E[^]UVS&$ ML$ M L$ML$@$R8u E[^]É0E[^]UWVSDéa5D$OD$&<$Et8ED$ED$<$|$ D$D$c$!^E $D$ID$$螋E$QUSD$ ED$E D$E$$[]fffffffUWVS8MÉEċ}u t$E$0Eȅuu}EEEE̍Eԉ t1 E U]M!ىˋuM! u t뷋]u!M܉!щME܋UM t1҉EԉU؉ƋM̅t_Mx+Mw&EEԍHwq{E@N4$]tEԃ0<Eȅu tEtJM\Eԉ0҉Q0A0q AEЃEЃ8[^_]E@uU\UƀtUMƍBEЉ4$]賿tU@^GE@uQ4$]贿uT tOFvGE Fv5 *-UЉrBEBE&DptGEЉ7EЃ8[^_]ËEԍPE&PUȅE\@sEU\B0E0<UE\@aEE\@nEpE\@vEUE\@fE:E\@rEE\@bEE\@tEE@0@ 0E^?iE\pEUWVSh}U EEuEE tu$UUtT t! tT$Ux$x,Ut==GG W[^_]ÍB߃]wʃ=uËEEuEEU }[^_]SUWVS }u EEEEEE4$kuI.h v.%GG  O[^_]ÍN߸?tċEEEEEEu }[^_]_uUWVSZʋEE1ËE1}}P EuD$$裶( D$<$k) vDžE %@  1)tru䋅D$ v D$T$<$`x9 ru1ɸ)u)lj9usu$ɈD$$ p 1󫋅t# 9uE t *H uE t ',H uE t E t E t E t "E @u \E E [< wT$ L$ M L$KL$$ׅu͋ג$÷$起$觷$虷E+Ĕ[^_]Džu%fČ (fqX1U11҉#UVSں3EEà1EE EEEMED$ UT$UT$$1{xEU+u [^]1"UWVS_ƸEEà1EEEEEMU ED$ }|$}|$$xEU+u [^_]1"UVS׹<u t44$D$ UT$UT$$1ҍE[^]1UVS腹ut54$AU D$ ML$ML$$ED[^]1UD$ ED$ED$E$M 1ҍE ]UU D$ ED$ED$E$ME]UU E D$ ED$ED$E$ME]UVS蘸EEƠ1EE EEEMED$ T$UT$$1BxEU+u [^]1e UWVSÁEEƠ1EEEEEMU ED$ |$}|$$xEU+u [^_]1UVS蟷u t74$[}D$ T$UT$$1ҍE\[^]1UVSJïut84$}U D$ L$ML$$E[^]1UWVSX}u t74$|D$ T$UT$$1҉[^_]1U蓶D$ D$ED$E$M 1ҍE`]USU D$ D$ED$E$ME]U{U ML$ D$ED$E$ME]US յ:EEEEED$E$!E []UWVS$菵DžE = tIƍ͔D$D$ t$|$$ tyDž 9AD$E$~uƋI} t9rcJ 8 uv9t<$$aDž9t4$觪Ё$[^_]ÉUE D$E$K]fffUWVSѳ6ƃ ‰ ‰ ‰ ‰ z|$F$ƦtF~1[^_]øUWVSi9H rn~t PRuF$D$ D$L$M<$=^ڋM΃tyE:BGuETB[^_]ÉUy(MbED$|$F$cpM>Uu ~ MLЃ[^_]ÉUWVS色ljօxlxD$$UtE3G4U3W0 u|3Gt9z |1tft Č[^_]fx t~B8z<~ ^z0Z4FB@zT.BpDp@PDH41ًP01 uH<1t3P8 uҋpx9t<|1tftFČ[^_]3 nČ[^_]ÀzUtBT%=.;8tm fg{Pfh{QUWVST]ƉUUċ@(%D$B$E܅}F(ƒ3EE]܋M1ɋEEЅEԅEfHJ]~EEEċH(MQ@|/-EEF(EF])؉E؋Eċ@DEEEEEEUЅ]ԅ'MtF(WTCGGG,D$T$E$] F(1ɉfGHUԅ~PffGEExE}E܉$]-ÅV( u { .oC ǍK F}<$DžM9MEȉGDEMȉG(GC <fOJEЅ]ԅt MF(GGfGH GE0}.ҋMċI@M)щME]܋EċX(]S@|/EEEԅu fGHEċ@GFE؋EUT_FU9tF(tQUЉEEFM)ȉE{]f{.|MEЉG vGTE뵉WmEEUEEEFX]/E܉$] EF(tfE9FEtWU̅rEt\}uVV(EċxDu@EEEE^@EU̅@F$t Ẽ-ET[^_]Ë] {E<$ Et}$]uE܉$] z]Ef@HN(EET[^_]ËEEU]zEE}E̅7V(Eċ@Du}aF$]o}v!]#zUĉB }EEEUT[^_]Eċ@U썊ZxFNtPXT9t+PʉPH@uUЋzDyЋXDPXT9t+PʉPHPu׋@ԃ}ufFH]0yF m@Et)}V(EċXD!>}/Ef@H!V(EċHDhUWVS$'E} bD$,$](ƅ EF$~(E }1҉u׉$]l9sǃuuV(F$}}܉Eq@DEE1}EC]E  $M]kÅMV(F$ÅP@DECCTCF(fufCHEwCMEX]E e}}UtEv NjV(F$MtKxf@H F(E$[^_]Ë}]v$]苛uE$]yF$]k4$]`1뤃&]]-v1s}D$D$@]tr$9F6N(-E$]%V(F$M71EUWVSz}tH@JHDy$uVDxpup$ZVDy4$Kwtv$7uGt$$G$G(t&<$ 1[^_]Ë@$$dG$ ƃtG$뻉ttEG$<$誙EttUUWVSa}7QG(EVLfFLNHtlfv$)VDFLf97tȍ D$ 4D$D$$iQffu@tUV8N<3O3W tEFJ Gt uƉv$蘘uuGfFHuE[^_]ËOMt+tKG(uΉv$OuuGEGu0G)tE뛨uNjGEGGMIQ(rI|/u/uV,UT$VTT$$7E[^_]Ã1ɉCfFHpu$w~DWMA(AD]uFJF$G(u$F$$6 My fAHG(uG$F,F(NTD$ML$G$D$/M $At;9EP$Ue@MD$UT$E$XMN,GFFF8Ve[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(Mh"D$8D$EEE@ EEUPUE)‹EPE@U UԉP $] 18[^_]ËUЅAE$]ՄD$ D$D$E $6Em@뫉}UE܉BB$]{UB tqE@@eBE $]`D$@E$mE EUP ]_uu1]^uUWVSQö}G $ʃwt6$跃uG[^_]US pE D$E $V[]UVS8֌;ut&/== =ED$E܉D$E؉D$ T$E D$E$=t3w lEf>@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]ffff̀rS[[UWVS E<؉EUt`ME9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu [^_]UE]UWVSTފGEU }+ &E EẺ׉U }G$]xEȅU Eȍ 8MЃƃЃ)UӋMщMԋUT$U$M‹EUȍD]Љ]\$EED$]$U1ɅMM9MXEEUȉUEEE؉E܉}ĉuEM4u}ԉ9du E9s#ED$ED$4$U9Etщu؃9M؋]U+uED$T$U4$U}9NjUt +EMC6ˉUE‹E9r]U}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ċu]9.EEE}}čGU9 Eщ}U܉EA‹M)ʋ}č M9~ȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅?U!ED$\$<$UU9~]E9rՋE9M̅qU܋E 9r}G9C)EE܋M܋E}89uM܉E}9}M9M M]E̅{U܋E}Ћ029r}GU9IЃ)E܋}EԉE9JEԉEG׋E9EEĉ$],}1T[^_]ËED$E$MEEЉEȉEċEE뱉ˋ}M 9sWEƉ}Q+ME }uڋEE‰]M؉EE HZ9Eu]M9r}M3E}ljMU]XJM9uˉM]9sMˋMUzUuދM9U]ۍuM9ƋED$t$<$UM9Ӊً]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Yu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}ZM]U9UU̅U܋E}ԋ029rUB}9G)WUE9}܋u9rUB9)]E؉ËuEߤ9uu]]U+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE'}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UlEЉE}ċuEMЉvE؋MuuEU)ЉE؉ڋE]XJ9u]uE}9EŃ}tu|$}ȉ|$$] }SU~UT$DD$ ED$E D$E$c]UWVS =EuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]nt"N^HXVP MF [^_]ÃUWVS谀u91uu[^_]=F$$4$*NjF$$[^_]UWVSTù}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$ 7GWG1D$<$tG9F [^_]fffUWVSu%Q8F}9FiF FD$ D$D$$t6FVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_][P1}IP81F u1UWVS~ }91t2G$$D$<$ƋG$$[^_]D$<$Ɖ[^_]UWVS 7~ÜOEO910E@$$#D$E$,ƅ@ ‹} >HE@$$OtlEM 1 [^_]D$E$ƅt[P } uuuFNuN}8눋E@$$'NuJtN}8E Y]NIf뱤&fvft*N [^_]E xDE xfffffff̀rS[Ô[ḃ̀rS[t[UWVS${VEEE ETM8D$D$ED$ ED$D$E$vt 1$[^_]É M8 uL8USm{ҫEy "9~)ML$&D$E $31[]ÉD$ 8D$ED$E $)A1[]UVSz]Ey ";}.D$@&D$r 4$b3[^]ÉD$ 8D$D$@r 4$@[^]UWVSxzݪEU MtF &;4ut/M9t(\_rtwf9t)[^_]1[^_]fffK̀rS[d[UVSyJtu,imNA90%[^]Ë40(9r,40[^]9r싋,UWVSmyʩ},p^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓l40419|[^_]Ë]싃l40u޾ UVSPxõ 4$atu,U4$D[^]ËE4$-[^]UWVS wX,E 4$t,@}C}wSǃtǃpǃlE ,(E MH1} 4$E [^_]Ã}?vB}<6,0)ȉЉAUtplE P,щU쉋(EU0U)Љ?}҃?}}}Ƀခr4$EUWVSIvî,EẺEыE)ȉE䍃 E$*tɋU,@tplEH,t)̋Eʉ014(E$E[^_]Ë,0)ȉGfUWVS?uä <$P7Ɖ<$A[^_]US ukED$E D$E$ []USt:E$g[]fffffffUWVStƍ\ Dh̀rS[[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS .cÓu}F9r+)F|$E D$F $a~  [^_]1 [^_]UWVS b=u}F9r+)F|$F D$E $ ~  [^_]1 [^_]USbEU ]tHPP UP[]Í fUWVSAbæ}u t$<$t t&t 1[^_]Ãt$<$À[^_]ÍFD$<$}t̃t$<$l}[^_]UWVSa&}u t$<$ku 1[^_]D$ FD$FD$<$ntԍF D$<$,tF t6u$FD$<$|tt$<$|듸[^_]ËFE }F[^_]UWVSak}u t$<$u[^_]D$ FD$t$<$赀[^_]US `D$E D$E$ []UWVS|`}u t$<${u 1[^_]ÍFD$<$ t~uD$0D$ F D$t$<$tUWVS`j}u FFt 1[^_]Ét$<$d{tFD$<$~~tӍFD$<$>{tF D$<$+{tt$<${USx_ݏUE JttH[]ËJuL[]ËJ t't@H[]RP[]JHRP[]ÃwJX JHR P[] | q f[@HFfffffffìrS[[v̀rS[Ď[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^UWVSEu MtXMX89t=JuMtBu {U tr9uu 1ۉ[^_]ÉCu1[^_]1fffffUWVS(.]ÓƉ1NjE1D$ |$T$$er<$"@9EZUT$|$$LFu1U+([^_]E @NteulN u`L$$j '$!HN tD$ D$D$ $4t9urD΃sztft%D D$ D$D$ $ _u-ujFfUWVSZƉЉU Ǡ1M1Ʌt=~t3E+ȁĈ[^_]ù۹Dž9Ff tvEtoEfD$ D$D$<$<$9EXED$|$$6Vu5F~uN uF=tu ~tMEEcED$ t$|$$a4$9ExED$t$$V1@FȉC:9<W<DžEuL$ L$D$$8<$9EED$|$$t$ a+D$D$D$D$ D$؍ DD$<$Stk0$`ED$E$F <tt oEu̓t,ED$ D$|$$_t14ED$E$B1襾UWVS<\VuU EEMEE܋EE؋E E1E8}1wc~w]FvIE܅t }؅tFu f~V~Ή}U+<[^_]ËE}+8EԉEE؉EE܉E MM<[^_]vE܅t U؅Et1댋E܅t E؅FfVT$D$ ̶D$L$M܋E$DžM9FF ftV ffuu҉T$D$ D$ȉM)D$4$rMx 9=EtEȃiviD$t$E$ 1T D8D$ D$L$M܋E$M܅x9E4FD$ 뻋EYQEE@DEԋ}1E؍E܍IEЋE؉M؉u E8EЉT$D$ E܉D$t$ $M+MH9@)ƃu1q҉Ű}UT1E؍E܍IEЋE؉M؉u ET8EЉT$D$ E܉D$t$ $M9M)ƃ9}u1MFD$ D$D$}<$C<$-M9L$|$E܉$ MUU܉D$ yD$ȉM)D$$M}9nD$T$ ̶D$L$M܋E$MUWVS@Qlj΋E1EG uY$Yto|$$Zt9wuҋtD$G $#u1ffh$@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$/kO9Aff9't0G9T$D$G$Mt$ |$D$$"[u8u Dž11fB获UVS FOëut$F $QXE $MUYF t [^]ÉE4$-WE [^]fff̀rS[D[UWVSN&}E$]xkUtD֐6t;F txu@9uD$FD$E $Uu 11$d8[^_]1[^_]UWVS$NÉ~}D$<$GftD$<$"[^_]þfffffffUE.߃At..t!.t+vPЃ v-u2-.u…uҸ]ÀvPЃ v_u_1]UWVS UE Hzu;9]苰uυ0qD9sDw]Y}D9~D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}ND9OD<]][D9^DυYDM9YDM}B4^D9_D(뮅f"f 9DupR?UWVS$E@dtfɍ<ʉ}ЍMԉu7APWЅt#xuPR#l;htՉNj@u݋F9]uAEF$[^_]ÍMUSOJôzPt@uQPtuHuX uHuxu t1[]PtCu[]g/[]@ FtPtC1M]\$ ]\$D$$>t@M똸$$$$11 rFFtGGFEN]1ɀ.уu9`d9@ HDPDDžDžDžDž<$p38=R7\3G u$1ҋ$`{[$*$*1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$)$)U+Rp[^_]Ë넅tJPd9\.$1ҋD$ D$D$$Hu~d@}뎃1@<tE12Dž$1ҋ Yu@ WY81.늋$1ҋ^Y@u2u9,XGHDPDLE%$'X1)UWVS0BaEhpPt%={DžthE11҉ rMd11҉`d r`VtA<$WWt[^_]ËhMEEdUMEE$lu`11 rU؅tkhd<$hE[^_]ËhMEE뀋hMEEd<$xЉd|diX\P}`1}dX  r| LOTdDpPHXLƋX9H`D$ PD$D$L$$hL$P T$ D$HD$l$&3xWE11҉ rlUEE!$\Xvl$O$9T#X\dwc\$U`U؉h<$h(‹dG뎋DA‹@uDFEu11 rE@t`EEEE<$ML$ML$D$ |$D$E$ttwEЅUp[^_]É<$MML$UUT$D$ |$D$E$uD$F $tP PH p[^]UWVS@%Ê>ljE1EG ut$kt$$gtӋD$$tD$F ${ue$1@=wI$ ‰@=wЋЉ==1U+@[^_]Ë~D$<$tu狵1DžЍtftȍtftD$D$ GD$D$@$&9OtD9AD$D$G$Lt<0L9_YB 9@3t9'9uۉD$D$ $zKut$ D$D$$A+u9u [u3fvfvBrUVS A æ:ut$F $LE $MUF t [^]ÉE4$(E [^]fUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPEE);UEމE} ]7Et@9rE)uu U<u sCtft[^_]äftu^uE[uOuW] ]u\3]|fu SfUWVS =â1EE} Ơ1E1WEEG?7w}8)‰T$ D$<$D$ED$<$EX1u4u:tftE+u& [^_]úx)끪WtfhUWVS$ZǷ0}Ћ]E E1EƋE13&8}DGt`EE؉<01E 1҉M܉MLAt;}t^}׍T3y1]E+$[^_]Ã}u-t( fɃa) 3믍NȀw볋M܉<.u9twQ3ЋEDP{<0#s߀XtXEE1҉3)AtstEt)Eԅʉ s1EE EM M 뗁EM tEF]Ds@9o]VfU ED$E$u ]ËE]ø ̀rS[D.[UWVS0&.uE 1M̋U1xu1 t8t)űU+u0[^_]ÍMЉM11ɉEċEȉ rEč, ۃTЃut( tۃ\"u|1w eUWVS9-E4M 0u,}Ơ1E1hEED$E$anD$h8$-ohǀPǀTǀXDžDB$$8HDž@DžL|$ ,|$0L$8$ǃt>8GD$H$t4E+u=[^_]ËHt$4 cUI+UT$ U T$&D$E$@]UED$ ED$E D$E$]UQ+UT$ U T$&D$E$]UWVS$+u4$ruE荓UEEEEED$&xX<$jE؉D$<$pD$<$r $[^_]UWVS*EX1TE1D$D$$+cƍ`$1D$XD$$PDPT$D$i4$u4$t'fpTU+İ[^_]e\$c\t~։P6tN~ tu틅XD$F$uԋPGX$XcP$vA1A$X`UVS(uF tF 1[^]ËF0$F0F($F(F,F$FFN D$Ǭ$:FtF 뇍9D$ܬ$Dt F ^YUVS+(uF uu,F [^]ËF$FF F tԋ$F F [^]UVSVû'uF uetaF0$F0F u9D$D$ D$D$$ F0[^]Ë$ef 뷸US] $)1U C []UVS 'u4$F$FFF0$F0F($F(F,[^]UWVS>ã&E@0} xML$$vop< t< tD$4$v?x4$pfM Ay EpE pED$<$XvtbP1tJ< t`< t\E@H9tTE xFE7ED$$vtgPuuE @4E [^_]Ã됉U }OD$G$1DžUtBExE xzt7@ D$$ ƋEp/0E$01jUWVS$$EuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]ED$UT$E܉$躰MuTMEHE Hb@ ]lD$D$ E$gE]30E$E@$#E@@@0$E@0@($E@(@,01$[^_]ÉT$<$]hDžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVS"u F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]fffffffUWVSh6!]D$D$}Љ|$ D$D$4 4$3EЉ$EąD$D$|$ ljD$D$4${}9E1E1Exu0P!uftf9XP 9rEMȃVUEЉỦ$]UAEET$D$ $M]ӦMMUfEMzu7Ju%uftf;rِz }p 9rMM̋Eĉ$]uFM9qFE1h[^_]@t`X Eua M̍LM9Bu7fE 9_19Wr fuu11ɉ ruu؋JM]΃vEtfEtu|}}̉}و]vtft}kKu̍\]r!󥍳u 9)jE $] EEĉ$]fH MEM1f]uutSXރ u]uE1f]] t]uӃ̋M؋}OM܉OGJOr u1ɋ}tރ uE1ۉU‹Et-EtMtkE uЋU}O M 9t"vtZ붻u}̉~ utftuN yu M}OElu}̉~utft֤ӻ]9(bM΃EMu}̉~utftEEEủp1MrEtfEt}}̃Eju]]]Lu'u MmfmKM뿋Eĉ$]YUSBçE$[]USÄED$E $)[]UWVS XE}} 'v?NBCDt]T1 [^_]ÁB u$<ƋEEFGEFWUV O MN$W$=WV(F,}E=V-~U V O(N1t)NEȉF99U9} 9U4E E= =w=w=?w=ED$D$ 11 +D$$D$]-JWF4N:V;m]豹4$P]ۃV(F,}EF-~E F O(NEEfE= =w=w=?w=ED$D$ 11 +D$$D$]IPGV0N8F9/r<11͸11UWVS/D$E$rRƍxD$4$ʼn}и9ED$D$t$D$ D$|$$Tt4$RttFD$pD$ E D$|$$t Ĝ[^_]É|$t$%1߉4$uRQ1ȉ4$^R1UE@ ]UWVSEEU ;P snH,X<3t;t-?19r09Pr+HE)E1[^_]?SӋ?̋]讶Ӌ]虶UWVS$fuF$ED$ F(D$ED$E $N~;N:]f4)ЉMЉF$)É]]]f4)MЉF$)É]Ef4E)MЉF$})lj}F-VMуtitT <ωf0ED$ ED$)N8N9^ )߉|$4$K$[^_]Z D$D$$e9ԋD$ D$D$c$f1&D>DBu.L$$9ċ[$ D$D$$蠓:UWVSEĉED$ED$E $>]&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,+\D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[ẺEEfEEEfEEEfEEEfEEE`t2 u&F UgLU x;uED$|$ &D$1D$E$ˑE`t jED$$;E`FED$ D$D$­$cD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,bWu Wz?uED$ T$t$E$E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$D$ D$D$<$f D$D$ D$D$$UeU D$D$ D$D$4$e D$D$ D$D$$UveUP D$D$ D$D$4$>eKś$tD$D$E$ Ĉ[^_]ËED$ D$D$$9]ED$ D$D$$]ED$ D$D$߭$\ED$ D$D$ۭ$\ED$ D$D$׭$\dED$ D$D$ӭ$g\ED$ D$D$ϭ$=\@ED$ D$D$˭$\ED$$ IUWVS$uE }Ǡ1U1D$L$ t$U‰T$$xVD$t# $U+u#$[^_]$.1%0UED$ D$E D$E$]UWVS}ED$|$ ED$ED$E $x8Ɖ<$GuH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$-ÒEƠ1E1D$|$ D$E D$E$&…tD$<$qE+u Ё$[^_].UWVS}u Gu 4 Gt*D$4$}uUt E[^_]ËEtE[^_]UWVS)Îut\~M u ( ~t9uUt E[^_]Í L$D$ D$D$<$`EtËE[^_]UWVSu} [Vu + Vt!9>uMt Ev[^_]Í|$D$ D$D$4$`EtËE[^_]UVS`uF[ Bt ;2u[^]Ét$D$ D$D$ $_v [^]Ét$@D$ D$D$8 4$L_[^]UWVSDéU} tdLUZ~U ~t;u[^_]Í T$D$ D$D$<$^[^_]Í UVS!uZ Bt ;2u[^]Ét$D$ D$D$ $N^v [^]Ét$8D$ D$D$$ 4$ ^[^]UWVSjuPYw$ wWvK B  v|@vF[^_]ÁvfN[^_]Á ~[^_]Á v,y낃@t9u~@jtuciO_D99.G#sͨ k1t$D$ D$(D$<$S\#37UUWVS r}XWYD$t$<$Wx [^_]É|$D$ D$(D$4$[[^_]UWVS}VL rt;:u[^_]Í |$D$ D$D$4$*[[^_]UWVSL!ÆƠ1E1E <tmD$D$ D$.D$M‰ $MZMt#PT$UL$<$RU0E+u4L[^_]D$ .M‰L$ME D$$sM'UWVS4VûEEEE$E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMB&DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVSѻ.EM HMHMHMXˁHɁ@ =+-EE-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$#EE4$ #EE $"EUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$1D$u 4$RE$Et $Et $߯E Ĉ[^_]ú)‰U:EESEW)̐ u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]Í5DE5D}\$DD$@5DD$t?1ɀ:.u9u*u|.t A[^_]Éȃ[^_]1[^_]UWVS0薷ME荰EEEE$RhPlPHH8|$ x|$x|$@ D$L$T$ D$D$4$s~ Eƀ0[^_]UWVSVu Gt-D$4$nu?E tE [^_]Ë?D$D$4$}9}uAP9s:)؃UvM {9Cs1[^_]É4$Ewx+[^_]ÉM]{EEMUWVS+]EuE(},M }0tǠ1xU1҉M$tt$$Cƀ?vE4$t^򋅤t)t"<.g]<0M|0.7h0J1U4T$L$E$?ƅ)‰U4E$kE$T$D$8D$ D$dD$$C‹ $a{t$ $ K}Mt}w} M$:U$D$T$L$ D$ D$dD$<$DB‹$9v|&f @)ȉ~ DžƋD$D$<$W9u׋)$$|}|$ $1ɺ0-kf; F01x JDNu.9uҋ‹)‹ $9Vt)ЋxU+.Ġ+[^_]Á}o}$M$*U$ec`E4$trx.D$$1ɺDž@f; @E4$j벍D$D$$U &yt)}$<$WD$D$ D$dD$<$>‹4$t$D$E|$D$$U O<$wg|$L$$D$t$ D$dD$$=‹ $ GGD$t$ D$dD$$I=‹ $G$D$t$ D$dD$4$<‹$E_wG9D$|$ D$dD$$l< $y}$C4$ fN~F$$T$|$L$D$ڵD$ D$dD$$;‹ $$n9%4$N $D$|$ D$dD$$;‹ $o4$$GD$|$ D$dD$<$:‹ $ $4$kD$D$ D$dD$<$V:‹4$t$D$$U >)D$ *@t$L$$ /&w1E)0~0 $09t4$#d‹$y}$!<$WIL$T$D$D$ D$dD$4$8‹$.E$HD$ *@t$L$<$-B$$$#w1E)0~0 $w09"4$b‹$@yY$ƅ-lj$w}u9e$>7M$)*<$WD$t$ D$dD$<$6‹$4D$t$ D$dD$$w6‹ $GD$t$ D$dD$4$)6‹$}99D$|$ D$dD$$5 $yw9u$VƉ9?$wy}+}$=|$D$$U 6<$w|$L$$U <$m)ƒ|э*}$ }4|$ t$D$$4$^Ɖ)lj}4GD$D$ D$dD$4$3‹$G9!Dž1pƀu1$TnDž |$D$ D$dD$$2‹ $QP9 ~F$B= $I^|$t$$U %<$w4$L~$D$D$ D$dD$$1‹ $m<$ݽ~$KD$T$ D$dD$$0‹ $<$efF $SF $ED$|$D$D$ D$dD$<$!0‹$u}$<$G$購D$t$D$ D$2D$@4$/‹$4$flj4$w$}lj$,F$"_lj<$|$D$$U kE<$G$QT$D$t$D$ D$(D$4$-‹$7U$r VUUU)ʉЃ=J$n}$S4$F$$QD$t$|$D$ D$2D$@4$,‹<$"<|$D$D$D$$U )1LM9/t؉4$D$D$ D$dD$$+‹ $y6$~@t$D$E$$%4$.V‹$C}$.t&#E4D$ t$D$$4$UE$ VUUU)ȃ=Y $  E$ *D$D$D$ D$ D$dD$<$C*$|$t$$U p<$w9SF$葶t 4$肶4$wD$D$4$]4$STD$D$$U n94MF9Gt1Gt`$D$D$ D$dD$$y(‹ $uPED$SD$ D$dD$<$ (}$@<w}$iD$t$ D$dD$$'‹ $ GGD$t$ D$dD$$H'‹ $GD$t$ D$dD$4$&‹$NhGG<A}4|$ t$D$$螔4$bQƉ)lj}49a)=$w}$E4D$ t$D$$4$P@t$$K}$<$fWD$D$ D$dD$4$Q%‹<$<a}$@*ct9$:"<}3$w xYG GGDž====Dž$1lj9Mw>9Gt1Gt`$D$D$ D$dD$$"‹ $-GuP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$ Dž====fDž==e)*3|$D$ D$dD$<$‹$9SD9D$|$ D$dD$$^ $yD$ @t$L$<$T o w1E)0~0 $+094$fI‹$yD$ @t$E$D$$=q .w1E)0~0 $E_094$H‹$y'D$D$ D$dD$4$d‹$?9@Dž@DžDDžHDžL@)‰t(19rU4T$ D$t$$}4$;G)ʉU4@9<$w^x|$t$$,4$|ljF$|$=D$ D$dD$<$$Nj$rD$ $1ɺ%c$ q"<<$茧Nj$M4L$T$<$d‰)M4|$ $1ɺI<$ {F`$谦NjB $M4L$T$<$‰)M4|$ $1ɺm<$j$ԥNjB$"Ɖ)lj}4S$c&*$trD$ @t$L$$Rw1E)0~0 $-094$h=‹$y|79S$c&+*D$cD$L$ D$ D$d1ɉL$<$‹$"7$ UWVS8vަE  U8utrE}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]Uu@M8E#,0]UWVSuu})R|EtG9E r'Gf|t+E D$<$膚yF([^_]9} r+E[^_]UWVS&uEEu} lj~P9rCffVP9r1PffV 9r1Xff\V t9s]BF(?1ۉ}D^ fu61ɉLu}9uF$F(F,1[^_]ÉD$ \$ED$<$xUWVS9tEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$uF,F,^(NMD$]\$ D$ED$$] 7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~GF$gF(F,bCM]C]C(UWVS rmEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$F,F,^(NM]T$D$\$ D$ED$$]蚣;F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,cAN]mA]]A(ffUWVSo&EM} QyYm M0ȈE<ƒ?ك}Cu썶,ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u;Eu[^_]} Oσ7M)11}U+u\[^_]ø'UWVShCEE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EEu}: w( ]u#M EÉ$SrE}~=Ut3}& &w\DAtu܋E })[^_]ÍM U$WE6M E$DxgEEM E$HEx>EM EÉ$MM|xEM?fffffUWVSf6u4$,H9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} _7(qUWVSe!E Ơ1E1D$|$E$xFD$T$$zxT$<$U+u [^_]XfffffffUVSegEuUMx#L$ T$t$$y!x9s[^]ÉL$T$$+[^]fffffffUWVS dutcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#f5UWVS cdutcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$" 5UWVS ocԓu t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!4UVS bLuD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVSbu} tAv-u3D$4$$tD$4$`%F1[^_]3USbxEU tttu P1[]f3UWVSa.}u t' t:@trt0 wvONuI3[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVSaj}u tPD$<$#tD$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$t7D$t$|4$bD$|8(D$tـ\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$t@"݄$4ݜ$D$P-otj݄$D$tl1ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$t~("݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$Mt$ $D$|$$$\$t ݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$tD$`$D$h${D$8$oD$T$c\$P0D$tـ܌$T$`ݜ$D$d\$tK"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـ\$HL$H\$LـpOD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$t@"C$D$\$tDD$4$h$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tD$T|$h|$$$ځ$|$P3'p$\$tD$`$D$h$D$8$D$T$$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$nMA=w$ʋ]Z ] Z]ZA1[] UEt u]ø]UUt< t< u u]UVS=Dnu>t'4$D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US-=ÒmEM t.9t**D$ DD$D$p3$=[]US<6mM E%t.9t**D$ DD$D$p3$[]UEt t]ËE ]1} ]US4<ÙlUE ~;u;t5*D$ DD$D$p3$<[]ǂ[]Ãwǂ[]US;lEU tt 1[] UWVSj;k$ \)Etc@@ D$D$4$ u E[^_] 84$1r 8EE[^_]UWVS:3kuF~O9tHNM 1[^_]ÉU ED$|$E$U uFUF맸UWVSH:íj}t;t-M tWt1$0;wr$0<$0[^_]UWVS9OjEPt7E1U9}t#E4E D$4$u߉[^_]1[^_]UWVS9iE@EEE19ut|E}1thSH|$ D$t$E D$L$T$ 4D$D$4$PD$t$$虢.ljUED$ D$E D$E$4UWVS874hEu}1E1>'SHT$ t$D$E D$D$|$ 4D$D$$Yu(u~E+8[^_].|$D$ ED$D$4$D$t$$<tlH󥋅D$ D$D$$l5:ǃU$c…1A<+wuىD9u˃u뷃z럃b뇃Jl蔝UED$ D$E D$E$R]US!5eUM˃w<BtJ[]ËE E @%]3 ؉BtBt븋E E @BtBtUVS8u4dEtyE5EEEEEUT$u܉t$U؉T$ D$E D$E$T=tD$ E؉D$t$E$؃8[^]ÍXUE@%-@~1҉D$$$]؉=?w1҉D$$$]Ã1D$$$]ú1UWVSut%ӃKE tx9uu 1ۉ[^_]CfffffUWVS$3vc}EU܉Mtȃ"uFEML$$]8u]-K+EE0YEE E 1009]~Dx99Mع_SЀ vȍSW9]]؅t U܅t}܋u7$[^_]ExEFuu1UGM9\]-"LSc7؋M܅u}bxEE܅t}818A V1ҍ=tftH<@ lj)99_ ΃r뀃< t< tD$4$1Ҁ8 Ht$$t9$7%$< tW< tS< 9szwD$ $&H< u땸1$@ z)׃ (D$$tljKD004$n@9]‹tft‰)‰ DžNtftR :)944$@9o‹fBf 0mDž1 P$uTfF()׃ (D$$Tlj$df\UWVS`) ÎPEEEǠ1U1ҋ@E` D$ .u‰t$L$E$(}rEE4$ML$ML$D$ t$ED$` $t\E$E@ U+u_`[^_]ÉM` $]MB΍eEfMUEFƋE$u4UWVS(POE8@E苳` }teUE<$ML$ML$D$ |$UT$4$t,E$E@ ([^_]Í뙋MUE{ƋE$t([^_]Í` $8t ` DUWVSxugx ua@@ HtHӋ}‰t"ƃ))u)9|[^_]UWVS\zMEuE 1NjE1Pt/1Dž9E3wG D$.$ &8tGt3W\_u<.uuy.u}fD$:$蒮'tOfu:t .\uـx.H}OAuVGq ExA9t$D$$!q@0@Ɖ $@)9P‰ȉ@ M:E<$#t$D$|$D$D$ D$LD$$jU+,\[^_]Dž9E%1D$ D$D$$F/sfcui=x.Af~D$:$\Z1flUWVS\H׉E UEE1E1} t>M1U+ \[^_]b$( 9ƉyfQffQ 9>f4ED$D$ T$t$ $;@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$:Dž@ u4$Ѕ{8L8 9v<$9=fG$!=Nj$=Ћ9f}}$} - t$$}D$t$ L$D$$u9Džz@  99uQd 04$j=$ CGvT'tO<$ONjE$N$+P|$t$D$ D$(0D$$%1t9s;)d}dDž1 019tl!9hu狍Ƌf4JutJ9}A9p@ &‰))9V׋{z$|<))9zrtft1iX@t$$9P Y}u,04$tx9_9v8Љ΃tft4$#=Љ>9}ձD$|$ L$D$$n4…s@ 89F9EP04$G=+Ɖ<$-P)9| Yt$ D$lD$$% ,4$p)9g[T$T$<$Q8f~<$Ѕ)"Dž$1΋_9S GƋȉfpfJ2r 9t H0f9ًF9랉t$ FD$|$ L$D$$1…@ 9<$P9_SD$|$4$]1@ yyy G7)ʉ (D$ $T‰pX<$2\D$|$4$>0111fR9s<0t4$`01*s)׃ (D$$ljUWVS$  ;}EM@Bt $[^_]øEB $ZE=ƅD$ED$ED$ D$ED$4$!…xkG D$GD$GD$ D$t$E$ME2EE$X4$Et;$[^_]øE9E$ 4$G tE$G UWVS@M 9}E 1֋UHJ @BPƋ}ۉ\$D$ D$)D$4$W~HƋ9sED$ ED$ED$E $Elj4$[^_]ËED$ ED$ED$E $EDžt뼋E1UWVSJǧ4,t@ËED$ ED$ED$E$ًU E|Ɖ$9[^_]ËE1[^_]UVS044Eu t2/10[^]Ã} u{MMUUUUuD$E D$ED$D$D$ D$ D$E$SuE0[^]Ã} t`M9tPMZQOQt)ЋU9t|~&učDUM؉E 9uuM؋EEAEAEA EM.u&UȍrUU9rM؋UMn1et$ $M豊tM:fuM܅tRM؀9t‹uȍFU9rUffMEEEx:uPU؃:IUąmE؉EEȉEuȍEE_E91ffUWVS8'։MǠ1M1HL$HL$HL$D$ ƶD$D$M $MU9ЋMs!T$L$4$ƯU+u8[^_]16_UWVSO'Eu uu|}}Ơ1uU1҃t+tO//1uU+Č[^_]Ë}E+M|EČ[^_]M11rEEM Tu11MUut&tt}t~U9wuڋUuu}t 9|uU}E1E‰xEEB:u}tA}u}XǾL9}}t}u>Pu9:x)‹u9$t$D$|<$-"uE1E‰xEEE)ЉNjMD$ -D$|$$Ua9UЃ7}Mt9 U9}P}9sm:u}yEttq}b}UM)ыE UOtU$谹UPu9rH1u:}뚉}f[UWVSy#c1qD$E$[E@(t}}tlpdh9Ɖ|X1lp9cE@Lؙdh!l!D$ L$t$E@$t!Ѓ\E@@}G0tO@9t$SE@0Ef` ߋdl)‰lt1E$E@l9})ЉGD$E$茑1TE$艉E@ 6D$ D$D$E@$tЉlp!ЃE@ E@)lplpE@0tE@<)׉lplpE UucEEPd$݋dE@fu`xT$$\E UEUԉdh`}wPTlp6E)}+GlpE@0LP}OtșX\GM8E8y}u]9s@zM 9hPEM8HuUЋM؅tJEԉ9rAE9EEt(9%BEԉE:BEuEЉUԉ9sM)M6uD$E$lEE}D$<$l|uu܋}}ԉu}U؋M܉A8uMFEM8M88MuEuuȉMBEBE؉M܋uEB]ωE$EE E ]E4[^_]ËM؅t$E9r9M1EUE<}܍DUԉD$E$UVMUωuszEudEuH}8}EEE)9EM7E#E\E\Zuऋ}8}ErufuEtfUыuuZE8EtS8MuTu8MCE9EM܃9uu8ME}}ǃs)EtfEtEUuuauGM뽋MufumuumfmmffffffUVSuF0t$ UT$T$$*tM F0[^]ËE F @u1Է8Tuʷ1fffffffU EE D$E$U]øU Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]U Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]UUM ttt1]ø]ËBM U]BM U@]UUM ttt1]ø]ËBM U]BM U@]U Ut)t?t1E EBML$$P]ËBML$$t͋EM ]U Ut*t@t1E EBML$$P]ËBML$$t̋EM ]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1U Ut2tOt1]ËE 1EBML$$P]ËBML$$t1UM ]U Ut-tCt1t&E EBML$$P]ËBML$$tɋEM ]UWVS 4]M Eƃt )֋t4utSD$L$$R totNCuU ]@ .SD$L$$Rt?tCud U ]@ [^_] [^_]1 [^_]1 [^_]UWVSfuE 8t8tZt 1[^_]ËEEFUT$4$PtڋMFUT$4$tUE9Us!ut<$E 됃tQtڅuET$|$4$o>bZ}N<$E 8tuT$U$+NjE 8Ut E덍D$g$UE D$ D$D$E$]UWVSu} EE]EE|$4$ot2Cu Ct9 uUU u[^_]Eu1[^_]UWVS)ÎuEE 8t uto<$ΣEED$4$BtU9UrtOt,t1ET$|$4$>t>[^_]É<$,E [^_]ÉЃtt,E뭅u}u<$E 1룉UD$$jNjE 8Ut E뱍D$g$1ZU D$(#E D$E$]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]G=UVSf uED$t$ ED$E D$E$~>.t[^][^]USx ED$ED$ ED$E D$E$[]UVS8 uE D$E$tE)[^]UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]US` E D$E$[]US6 E D$E$[]US E$r[]USE$@[]c`1UR³E M91]UEf]UE]UEfU f]UEȋU ]fffUWVS(Fu}E EEGE؋U uу"E E1ɍEM[<U|$M $eUt~UM)ȍ<FD$ $eUUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$dUEE})C~x9F&}ȋ?DG~ruE9E9EEEE1ȉU}f]tEEwUD$ED$ED$ ED$E D$E$]UWVS4F E܋EEpu؋EkE@u8uEU1Ã}@9؍sL^uʋE EEEEȋ} EEEċEOuE;EU}ԋ M]È}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuẼ;E]U}ԈU]GUEFFEE]{+E fEp}1EpBfUWVS$ Eà1E1D$D$|$ ED$E D$E$t>ED$D$<$tE+uЁ$[^_]ú.UWVS$* E MUà1E1D$ D$|$E$t-T$L$ ED$D$<$U+u $[^_]Éb-US]E M9r 9s9su[][]UWVSN EU} E9slUP0ك@t$tNt<]"([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVS'DŽ uE t*X?w#9r6 )ЍXt9Aхu)[^_]É[[^_]ÉD()[^_]UWVS EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]HuU270:ۅt9u1[^_]Ë]z[^_]Ë]_(1[^_]UWVS  u}E9E |2&6D$D$$HumtF;Gt1 [^_]ø [^_]UWVSUDz U2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]ÉW(뗉C4?UWVS EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]Éْ[^_]ɒ(F[^_]øUS E D$E$c[]UVSW uD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS$h uE܉U؅t A"}܉MGEML$$]腃u]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0$[^_]ErEJ0AL$ D$D$${oGEME썃!E荃;Dž|Em2mDž|EnnlwVwgED$ ED$t$$ڋp5Dp5D_5D5Dl)Љ$I)ЃJEED$ ED$t$$1ɉڋpD$ElD$ ED$D$ Uډ$UTE]9M 9Pu1D$E$Dfe\$ED$ ED$D$ Eډ$ T-UWVSU eh0E] ]ED$ ED$\$E $MUEy9tEh0E+E [^_]Éh"1[^_]Ug &D$ED$ED$ ED$E D$E$7]UWVS#È &<$ D&D$ED$ED$ E D$ED$1$Ɖ<$ [^_]UWVS貕 &<$ DED$ED$ED$ E D$ED$1$hƉ<$Q [^_]fUWVSMƦ uU΋}JЀ wK1ZЀ w( 0ҍ J9~]}fT1[^_]9| u[^_]Ë]TfUWVS-tX+tL1u$1ɉN…M)::t#tЃ[^_]Ã1믃륍B$;1ɉ…t4M)::uB$<1ɉ…tE1҉Ѓ[^_]USJMt50 wsS$m1ttX8/t}C []S $ At%8.u S$!t8.t:1[]S$mzS[]cS$1QUWVSk uÉ։M uXi)\P=(\_NQDDD);QEN My *)R)ǃQ))|gfff)DQ)))Љ$I)))GF)4V}Ou} }싌)Ӎ\9K@9|)}] [U썒Ӎ | )Ѓ9uF}[^_]øQ))ƒt1EUV)F}[^_]ËFPLLD)F}[^_]ÃF)XENYDDD)sB9At DËA+BuA +B uA+Bu A+Bu+UWVSC |$@ƉD$T$`L$D} L$t@^~ VT$8VT$(V T$$v$t$$D$XD$\}t34 )Ɖt$XT$\))L$t\$0\$4L$X\$\ ʁыT$\))șL$ T$$L$X\$\)iiƸD$P%D$TD$PT$TyD$PT$Td$PD$ yމ\$0t$4\$Xt$\y<\$Xt$\D$x|$P|$TL$X\$\ʁ??ыT$\)уș׉L$0T$4D$XT$\)iʫiЪD$XӋD$XÉȃD$H%D$LD$HT$LyD$HT$Lt$H|$LD$XD$0yt$P|$T߅y D$|L$(*D$8D$8)‰T$XЙӋT$XRT$8)‰ЉT$0y D$0T$0$19>kL$X\$\1ҹ1)ӉL$H\$LD$@D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$[S\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$81ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$)QT\$ Q\$UWVS rϯ }썙]| uu [^_]Ë}|:dNu쉼0uMTډ ?-00tċu! [^_]UWVSt~L \$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$XD$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$XD$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$XD$(iT$h)\iD$d(\ )\d$dQ\D$dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉0E܋؉ }<$11ƅE؍hF(EỦ9sUWVSPo \$|ljD$xT$pL$P1D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|D$xD$P{D$D$x$\$|L-[\$|,;8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|^(ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|Xf1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVSau \$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$d$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$dD$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$dtlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$dD$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$d$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVSU }ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$] =v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjEL49tUD$4$]Uu_ɉ1DžuUWVSvTτ Nj U$=EU~|$ $! 5}# l40dž _y>u E [^_]ÅxE P$RPAÉ 2h40dž 1뒋WZytىugb1ɍ`dN}D$|$ $LUVSR 4$z uƃ 4$b[^]UWVSTR EuM V~6hFhF1P9u dN9ut [^_]Ë]#1[^_]UWVSQM UM Z~/dFdFP9u09ut[^_]É!#[^_]UVSQ 4$a$4$F[^]UVS=Qâ 4$14$[^]USQl $[]qUWVSP@ $R>t6ÉǹUu [^_]ÉE$$G"U1US}P E$F[]UED$ D$E D$E$1]UWVS-PÒ <$$, D$ D$ED$ $Ɖ<$[^_]UWVSO" <$ u$E D$ D$ED$ $ZƉ<$S[^_]USHOí E $11ҋE3t hP([]US Oq [ $11ҋEt hP([]UVSN1 u  $1ɉEt tlP([^]ÍhUVSN~ ] E$1ɉڋEdt tlP([^]ÍhUWVS.NÓ~ D$$ $) t1$\EgƉ׋D$$[^_]$1ɍE\E/ƉUSM} ME tE\[]$E1ɍE\$[]USCMè} ME t@ tE\[]$cE1ɍE\$[]pUEt@ E]UWVSL-} ]} tC }1ɍE\[^_]UVS0L| ]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍE\L$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS jK{ u} D$$A t[ t$RXPL$ ;p H}yD$$ [^_]ËL$RlP)Ӎ$\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVS,IÑy D$ $ t< tOUM T$L$$Ɖ׋D$ $ϼ[^_]Í$C uu} UWVSHy UE &9t%\_ptwf9t)[^_]1[^_]USIHîx  u#$ tЋE$UWVSHgx e=t:F$V FtD$$%4$H>uƃ[^_]UWVSGx }ƃ $5tCƉxtD$<$|%E FEF e1[^_]ÃUWVS]t1U׋u ։t$E$Ut!~uu u1[^_]É뻉[^_]UWVS F-w EU΍, <$Ѹt?$4tYMHMHp L L <$蘸1 [^_]Íl 1 #txu8u막<$\UMU E]HUWVSFuv }, E$H L 1ɍl E0EMt"L Ct\9S t~ߋuMMH E$贷H uMtω?$;u[^_]Åt+L { uSUMCЋUML 9uYH uE9rHE9sAZtҋL UMCK $ЋMUL 9tE]U11ҋE]UWVSD u }E0E,UƠ1E1M (hEED$E$'D$h8$hE (E ǁPǁTǁXDžD8H@LT$ ,D$0D$8$!8U+u*[^_]Í71rT蚫UPCs UT$UT$ &D$E D$E$o]UC{s UT$UT$ &D$E D$E$1]UED$ED$ ED$E D$E$]UWVSB s D$&FX$F`F`y ;Fp|4} t.FXPVX}D$FX$[^_]ÍFXD$E$USBÄr E&Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US A,r E D$ED$&X$l []USAq ED$ E D$ED$&X$l[]UWVSPAõq } w}vE tE eFE EEu 1[^_]D$E$E@ E@U~1M19sIE}EtfEtME)‰UE$ U E@뮉Ћ}tftE)PD$$E[^_]ËUu G)t[7wWU<$Ut݋E)1u EEPCP@@D$$#E[^_]ËE\TEfH @urMuMu4 UD$E$EU)1u MfBfmyMyHMXUS ?lo ED$E D$E$i []US>;o ED$ ED$E D$E$i[]UWVS>o ED$E $%ƅD$ED$E$=ifFf~ v_mF$mF,inF(nF Eu [^_]D$ D$D$4$[^_]É$rNfF 1[^_]UWVS= n }D$<$w fD$<$[^_]ffffUWVSQ=öm u 4$9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfϤUS <m E9ErD$E D$E$ݪ []蔤f!̀rS[l [UWVSA<æl u F0u ǀFFF tBNt;})9F~JnJM 9FtHF t t=[^_]É4$u:N})9F4$ru뤉4$]t  UWVS};k Ӊʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVS :}j UM9 ?p9s΃ttUUn ED$t$E$oMJ U)UD$D$$E}E01 [^_]ÉUE ED$t$E$M uUEU JHJHJ H JHJHJHRPVU 0U$/y 0`UWVSL8?i ljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw01ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%0L$1L$ 9<΃t$  9D$uʋt$L$9t4$.1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$$L$L$'~D$|$UUU>D$;D$(` D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(\D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUL D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUU D$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*C PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$cD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUUs D$;D$(D$9D$D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(FD$9D$QD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$f|$UUU D$;D$(L$(T$$D$@D$L|$UUUDD$;D$(hD$9D$sD$D$$L$ D$ AD$oD$D$c|$UUUJ D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU D$;D$(`D$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$L$|$UUU D$;D$(rL$(T$$D$wD$9D$sD$D$$L$D$ AD$rL$@D$D$D$D$3D$OL$(T$$D$L$(T$$D$rL$(T$$D$SL$(T$$D$4fL$(T$$D$.sL$(T$$D$TL$(T$$D$5UUU< ;|$(rL$(T$$ 9|$s|$D$$D$ t$4D$|$UUU D$;D$(rL$(T$$D$@D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$GD$ |$UUUD$;D$(CD$9D$sD$D$$L$D$ AD$D$ |$UUUvD$;D$(RL$(T$$D$!8L$(T$$D$`L$(T$$D$A994$w"+L$(T$$D$ L$(T$$D$~D$ v|$UUUD$;D$(rL$(T$$D$JD$9D$sD$D$$L$ D$ AD$D$_|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$QD$|$UUUD$;D$(lD$9D$sD$D$$L$D$ AD$D$Y|$UUU!D$;D$(rL$(T$$D$/u<$vt$1UL$(T$$D$X_|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$>|$UUUSD$;D$(L$(T$$D$zD$|$UUUD$;D$(rL$(T$$D$8D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$0L$D$$9 $_L$D$$9$BL$D$$9$%L$D$$9$D$@tb|$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$~D$ |$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$fL$D$$9$L$D$$9$L$D$$9z$mL$D$$9]$PVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$5L$(T$$D$ztL$(T$$D$UL$(T$$D$6L$D$$9&$eL$D$$9 $HL$D$$9$+L$D$$9$L$D$$9$UUUwF;t$(rL$(T$$9t$st$D$$D$ t$L$D$$9G$:$f|$1늋L$D$$9$V L$D$$9$9L$D$$9$L$D$$9$L$D$$9$4$L$D$$9y$lL$D$$9\$OL$D$$9?$~2L$D$$9"$aL$D$$9$DL$D$$9$'L$D$$9$ L$D$$9$L$D$$9$L$D$$9t$gL$D$$9W$J|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$L$D$$9$L$D$$9$L$D$$9$xL$D$$9h$[L$D$$9K$>L$D$$9.$m!UWVSX!,R $]$U T$D}|$4UT$L1D$0Nj$TC0u ǀƄ$D$D$$<D$,$C Sf DŽ$D$LD$$$$$DŽ$DŽ$\$4$D$PDŽ$$D$HD$(D$tDŽ$$D$@$D$<$8e$%$)tc$1$$ C$$$${$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZwF$`1ۍFЍPwFЃ v$ H$FZv$J$Ƅ$$$DŽ$1$$D$xDŽ$D$pD$XD$\D$c$t$$$9}ڋ$T$TI0$$L$du$$)tE$$A$$$9$$tJƄ$0$D$<B$$$ $|$dK$D$x)Dž^$$$T$xPӉ$$$$$t$$)ƅD$T$DŽ$$$$8$b:t$PtD$P$$t$$@ @ft DŽ$t$09t$$1\$0$T+G$e[^_]Ë$<$$mDEG f /$fx$$DŽ$DŽ$ D$$$$D$$8$趎$ǁPǁTǁXy 1AAtft$A f$f$Af$A$A,$AD$$T$$DŽ$DŽ$DŽ$D$LD$ D$4D$D$DD$$$ $P:$@%$fH @>;$)@uDŽ$$$m$$D$$$$jDŽ$DŽ$$t"$D$c$2.D$d$$Z$$/R,ۼ$D$c$T$$T$$T$ \$d\$D$$$$KDž=$)D$HD$Pt$$<$$D$P=<$"~$$$tƄ$-$D$\=$$߃G|$c-$\$\\$xD$xt$d Ɖ$$L$t)T$\}.|$x$)\$P$DŽ$D$pD$XD$c<$8$FD$c$D$d$al0X$LD$cP$$=$$$y$$)u9 I,ۼ$$D$$D$$D$$D$T$ <$$FDžx;$)D$H$yD$HD$d$uƄ$D$Pt$$v <$$D$P3;<$${$$$D$c$,D$d$$$N$ '7v4\$$ $$$$$1۹ $ $$G.$t _5$DŽ$$X$D$xDŽ$D$pD$XD$\D$cDŽ$&$@.'ʃ⿀ $y$f$S$) $.$$$$$Q$$T$ 3$ [L$DL$ T$D$$4$$ o=D$x$y DŽ$$$Ƅ$1$$$$$K$ `'4[R$$$ Ƅ$1ۋ$DŽ$$$}$ $DŽ$DŽ$$$$y$$`32$[$$$$$DŽ$D$x${$$$$$$D$xD$Pt$$$0$@$$!$J4$p.$$$$‰D$Pw4$$$T L$DL$$TD$ $D$$D$$v 9L$PD$x$$i$$$Ƅ$ y$it$D4$$@$4$@D$t$8$Ѓ01 4 4Jу0 vꋔ$$$)$K0[$$$ۉ$$Ƅ$+mW7*A9FЉ1҃  4PwFЃ v뉔$3$$ $$$$K$ 5"0[R$$$$$$$S$ "0 [$8x$i$$$O-1҉$$$ƁƄ$x% À߉$$\DŽ$Ƅ$$g $$$$XT$tT$$T$ $T$\$$${$$)lj|$xd$$$9}$$$D$pD$XD$\D$cT$ $$$$D$x$-$+$@$D$x$$$$s$ |$D$$4$$0$)$9~$Ƅ$$D$x1$$L$$$$ʃT$x 4ʍRR$$$$$ DŽ$$w$$$$$$\T$LBJ$$$҉D$LaDŽ$$D$x$Ƅ$D$tu|$c$ D$PL$HȉD$xƋ$)ƋD$\9~ƅ~@$$q$$$$y1t$\)ƅ6L$\$$D$t$ $D$,$$$0@$$$$t$x$)Ƌ$9~ƅ~@$$q$$$$y1$)ƅ*$/$8$$$$Jƒ~I$G$B$vDž11ۋ$$$$8p$$w$XDŽ$$b$$$'$$)ƅ$@,$8$$|$d$Jƒ~E$G$B$vDžuZ11ۋ$$$$p$$t$D$dD$$$$詛DŽ$DŽ$jd$ $8$$$$Jƒ~E$F$B$vDžuZ11ۋ$$$$x$$$$D$$$$蓚DŽ$DŽ$gN$D$$$$ODŽ$DŽ$ yDŽ$1ۋ$$DŽ$1ۋ$$$$$8p$$:t?$D$$$$脙DŽ$DŽ$DD$T$$y$P$$p$$D$,$$$0@C$$$F|$HGF D$$ 11$$\$H)ޅ1$ \$(ZÉ$$gB$$D$$$$ DŽ$DŽ$$|%$H$D$8$$Jƒ~E$G$B$vDžub11ۋ$$$$8p$$$$D$8D$$$$DŽ$DŽ$b$D$$$$ĖDŽ$DŽ$$$$H$$$$Jƒv$G$B$vÅu11ۋ$뵋$D$$$$DŽ$DŽ$t?DŽ$1ۋ$$$D$$$$芕DŽ$DŽ$SE$D$$$$FDŽ$DŽ$7$$1۹ $ $$‰%D$p$DŽ$DŽ$$XD$tD$T$ D$pD$\$$$$$$$$X$8$$B$$$u$$ $tB$D$,B$$$$$$D$PL$HȉD$xi$Y$$0@C$$~ yt?$D$$$$/DŽ$DŽ$$$D$H$$yPm$ݔ$D$c$T$$T$$T$T$dT$ D$$$k1ǁ$'DŽ$$|$\ t$d9})t$d|$xD$xD$d|$x\8\$x$D$$D$c$ǁ|$p$$! j$X^$3$$$$ $u$$$3D$P8N$`R$ $$$|$d$DŽ$D$xDŽ$D$pD$XD$\b< DŽ$$$$$D$$$$kDŽ$DŽ$&$"$8$$$$ك~D:B$Y$uDžuUDŽ$11$$$r$$$D$$$$hDŽ$DŽ$l#$$$0 u䉴$$$t&0t!F0$$C$$$c$R$$$Ƅ$$11DŽ$DŽ$ @  !$[$$$ q$ $$y$Ƅ$-$$$$$1۹ $ $@$ h  $R$$g $DŽ$DŽ$$t$X|$p{l$pL$@@$$$L$t |$x)9~υ~2x$$$L$t y1)@ʋt$XVL$pV$$D$x9$x$$$8$$$$$у~D8@$Q$vDžu[DŽ$11ۋ$$8p$$$SL$t $D$$$$DŽ$DŽ$fu;DŽ$1ۋ$.u{DŽ$D$t$U$$D$$$$葊DŽ$DŽ$$tIl$tl$X{$$D$$$$4DŽ$DŽ$D$t1ۋ$$DŽ$$L$t ~$$$Z$$$Ƅ$-$=$D$c$%D$p$$F$$$$$$ DŽ$$X$D$tD$d|$\'L$x\$|$$ $$$ʁы$)уș׉L$xT$|$$)ii̍$ȿƉ׋$ljD$h%D$lD$hT$lyD$hT$lT$hD$x1L$x\$|$W0G$$D$pD$d<9 $$9r$PD$cCD$dxtD$d\$xt$|$$DŽ$G$|$\$$$$$袸$1it?$D$$$$蹆DŽ$DŽ$y$$D$(É$$DŽ$$DŽ$1ۋ$$ADŽ$1ۋ$$>$$D$$$$DŽ$DŽ$1ۋ$L$t $ZDŽ$1ۋ$$m$$8$$$$JƒE$G$B$vÅu11ۋ$뵋$D$$$$ׄDŽ$DŽ$tD$x$$ŷ$t$D$$$$sDŽ$DŽ$.|$ct&RD$c$D$\)-ODŽ$1ۋ$$#$R$$DŽ$DŽ$"$[$$$ $D$$$$UDŽ$DŽ$$1ۋ$$vDŽ$1ۋ$$.$$$8p$$$L$x$DŽ$ DŽ$[$| O$$$$@R$$$R$$$?$ ݔ$$D$$D$$D$$D$ T$$$$[1҉$$$$Z$$2+$ $$3$@3$ +$[$$[1҉$$$$ @* .$[$$$$$D$dD$c$+L$\$ /$Z$4)0ȉуcڋ$C0O$9$\)ډщ$$Nj$$X)Ћ$8D$(t$dD$( L$x$ D$xL$x$y DŽ$\$P$L$d$DŽ$D$pD$XD$\7_DŽ$$$7D$LD$L$`s$Ƅ$1D$L( D$L,\$t,11L$\ 9 )Su߃݋$$D$d$؃$$$1۹ ($D$$$$b}DŽ$DŽ$$D$$$$}DŽ$DŽ$$D$$$$|DŽ$DŽ$!D$HD$d|$c%D$HD$dD$cދ$$|$x$Jƒ^$G$B$vÅ11ۋ$뱍J$8$p$D$$$$>zDŽ$DŽ$^ $$$$aG $[ $$$$ . $[$ $ In $$$$ 3 $R1҉$$$]$u $vnWE $[ $$$$ $R$$$$$$$1۹ 5$D$$$$xDŽ$DŽ$1ۋ$$q$$T$ 󥋌$1$$9$rC$ǍA$D$DD$ $D$D$4$$[Pv$L$Ht$\)L$dAD$d4f$D$$$$vDŽ$DŽ$$D$$$$vxƄ$0$! 9D$c$D$HD$d,$0$$T$$D$4,Q$D$L8$D$LJ$$8p$$E$$ D$xD$$$$uDŽ$DŽ$^D$L$D$LD$L$D$LD$L1$$D$LQL$Ly|$Lp\$L\$L$t$\$y DŽ$L$P$DŽ$D$pD$XL$d$O$$={DŽ$$t$p$$Q$$$8L$\\$tt$X|$p7T$x\$x$y DŽ$L$P$DŽ$D$cL$\\$tt$X|$pT$x묋$$t$L$t$L$$$D$LX$$D$L$$}D$L0X$$D$LD$L8$D$L$$vD$LX$$D$L$$ T$LB$$҉D$LvD$L8$D$L$$ J$HL$LL$LD$LD$L{D$L( D$L\$L$st$LAJ$H*$$$T$ D$DD$$TD$ D$$D$$b$b$$fH @DŽ$$4\$$;$[RW$$[R |$L$_\$L$$ $X$DŽ$$$$$[RJ$8$(1fDŽ$9ƃ$$$ 1D$c‹$$3 DŽ$陾$ DŽ$钾D$L1ۉ$$D$L$$ \$L${|$L~D$L1ۉ$$D$L$$H|$L$$GD$LT$LB1*T$LB$$҉D$LD$L8t$Lt$LD$L8$D$$$$jnDŽ$DŽ$*$1ۋ$${fg P$8$I$|$LOL$LJ$8$D$(J$8$D$L8hT$L$rt$LT$L $$BD$L$$jt$L$$t$LFD$L$@6$ $f$*\$LKL$LT$LB$$҉D$LpD$L8T$L $$BD$L$$ D$LP$$$$$$T$Lw$$D$P$$V$WD$pD$X$ (1k$ $$֋$UB$鏷$D$L+Sf$$ލQ$薨 DŽ$ZL$LL$L_$fH @ٹOȃ0 [14ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSh }ED$E D$EE$ulE܋T\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$D$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$շ$5Ɖe[^_]ËED$E D$̷$5Ɖe[^_]ËED$E D$$5Ɖe[^_]úT$U~ t^E|tEXrUWVS, }m|$D$%U <$Lrm܋T|$D$$%-BuM7U$T$M4ƅNT$DV9‰T$s )HFL$D$$/D$VL$ 99sB\$L$9nك9uL$9ȃ9uUB]} ;tL$%ɋE$UE$tE$C9ruN9ue[^_]D$$%-@uMEED$E$D$շ$=3Ɖe[^_]ËED$E$D$̷$ 3Ɖe[^_]ËED$E$D$$2Ɖe[^_]ú$L$U~t^E|tE\pUWVS`I E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$vo¿፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$$>U:ue[^_]ø랸뗸1ffffffUWVSxC t&: =E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$D$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أ܋\܃d݃lT$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<@"\$X,D$(D$4D$hljD$@D$,} <$@/D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$uD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$vD$8"T$DT$$AuD$XT$D$drD$XD$D$tD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$շ$-D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$,D$`O}F|$T;|$PwHL$t |$@ @"D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$oD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$sD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$$ *D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $nD$XD$ $L$h)*0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$gsD$D|$X|$$ptL$T6|$`94 vP9t|$8L$8=D$`0D$E D$̷$(D$`|$PwuD$t(.D$0L$@@"ȃƉDD$XD$t"@"T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$q&D$,0L$hT$8T$4$qD$P|$D$X$Bq…@ fT$T$04$pD$DT$0$4iD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$oD$D1t$Xt$$pT$hV9zT$,1t$4FD$hD$X$VhD$h L$8tt$89tD$h4$.hD$hƉ|$8D$8$hF(MZD$PD$D$D$X$hD$XD$D$D$WoD$`p1D$@D$X$gD$8lD$hD$D$X$kD$X86+D$p[T$XBD$i¸ )6D$XD$D$D$nnl$@D$D$ D$D$ hD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hكpڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8@"D$Xr D$D$D$8$lD$81fu T$hvx0t|$8L$8 t$8F$Jd…Fz tftD$$kDžYD$PD$4HL$PD$h9L$("D$D$ 4$eƅ`D$8D$D$ 9D$8$eD$8,D$D$ <$eDž D$PD$4D$8L$؃\$HD$HT$LD$-@D$D$8أD$|؋t$`D$XD$8EЉD$@A$cD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@@"ƒD$X T$T$L$T$HL$L?@"\$81tD$8 \$8uT$D$8T$0t}D$`D$D$D$t$OD$tD$D$h$V|D$lP1D$DD$d T$`D$t$BND$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$@RD$t}t$tFD$OƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$PD$H#L$hL$$OD$tL$h $3LD$tD$h)t$4t$D$H$zRD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$rJKWx q tftD$$QD$d~D$<؋t$lL$dD$D$h$vQD$hL$tL$$RuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃\$TD$TT$XD$$-@D$(D$<أD$$wi؋D$8XVH؄tJuU tu ؃[^_]11US] EHP$/C[]UWVSD轚& Eċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tGz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVS< kv E1Ex0E }Uxx}؉EԋE@EA…uA…t v0uAE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]s4"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]3"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0q\֌ }u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSh[ы EM]E TsCD9sϥ9r)؃L9s&)D$D$ $]W[^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVSZ ?0)ˉލ u썊ٷa)ˉލ u썊~A)ˉލ u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rEu)} ȋ})B9>[^_]ÉB$MUVSYv UBJT19r & 9st9sEE$Ɖ[^]ffffUWVS X 91} w+ M4tetB`&$2E$ZFƋEFEFuFF [^_]úMU`E )ȉE w`|`&$"t`&$|UWVSW ut"F w"91u& 4[^_]É4$M[^_]`&$UeN? 4tU$C[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVSM CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSiK{ }tD$E $ƅD$D$E$]Džtt ʃ9t-xD$E$ t|E%=t`fp ttu ffp MfH@_mP$½mP,inP(nP Č[^_]1Č[^_]1O1US"JÇz E UD$T$ D$E$[]UWVSILz uD$4$nx$P8D$4$[^_]É4$mUSIy UjxH []É$6[]UVSUIúy UF0$k>F0ǀǀD$4$FFF [^_]ÿF tF$>p4$D ffffff̀rS[äw [UVS"GÇw uF0u ǀ4$cunP[^]øfffffUSF(w MQ 1f t[]É $[]UWVS Fv uc1FF uafF FF uwFVT$D$F$V$FV fV 1 [^_]ËF0tN@9t $mωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$e=<1ɋ8tBD$D$ N|$\$4$覽 y8t6D$D$ ~D$L$4$\W8t6D$D$ VL$\$4$W8t6D$D$ V\$D$4$Լ?O8t6D$D$ NT$D$4$萼_8t6D$D$ ^D$L$4$LW8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$Ȼu7O1$[^_]ËOu8,UVS =tE[^],[^]nUWVS23c } D$$$ƅǀM]8bL$ ED$|$]$ mF8FF F FFFF4& ~D1 󫍾󫍕xT$E$Yq]~^ $iF]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$薰BF0F(LN,NV<~$]9~s~G]WEP IT$4$i0}M1Q\$E$oKT$ ML$|$}<$ÉX TUMQ D$t$$ËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ <$ ;F@7NF(șdž‰<Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$>pTXMPx H fX%Pp[^_]ÿO$貗4$!81Ë&f\T$ ML$|$}<$8녋 8"8F8FF F FFFF4ǘ& ~D1 󫍾v1$F~ j5$811 8ED$4$dž0881UWVS$)zY uF(x~(V0!UN9F9MUD$N $MUF($N 9} TDTDF F,9sF0 F,|$}|$4$o$[^_]ÉUUE$>EEtlE܋UT$ML$E$oME)UЉL$D$$>M $oEUVU(_US]ED$U $ #C,9C(}#C0[]fffffffUVS r'W EpFtD$D$$۸F u  [^]UWVS 'nW ETPLx PpXxHPTt=kbPKҐ"DHD$$$xƅǀHDǀ$$ ljFHt dž wGPGG G GG]GE U%tAtCFt$t$4$1 xD$ ED$E D$E$HE EXuEX=DžX T dždž XTLtt!ȍDLX1PfffXL9aTȋX1D$ L$HD$$Ȱw 3D$D$$Qfxuu fx D$D$$!E t @E@t Ey [^_]Á1DžPDžXǏ)DžLDžT)DžP^Ǐ)KVp t$ |T$¨T$$AD$$;8D$\T$X$ TD$XT$$…\}@@f@fBB PD$D$T $XD$XL$$D$PT$$xD$$H XADžX2D$`D$H$bf` =b1`abcddefghhijkllmnoppqrsttuvw `b1uedu\hX=wCu>t_u1 ȉ lpHO )Ǐ)FUWVS$^O EpFtD$D$$bFUED$E D$4$XDžEtwD$D$ED$D$ D$|$4$Ʌ!@uFЃ$[^_]ÉED$D$$迯UЃ$[^_]D$D$$蚯Ѓ$[^_]vUWVSEU M wHpPPHHpPPHH p P P H H pPPpPPpPPH t tZ[^_]ftHҍtP1Q‹ˉZˉZBtZ ˉZ Z ˉZ 9uȃ[^_]ftxҍtPu,r utu΋ʉVʉVu9c7W‹ ɉ ZˉZZttr Ήr r ur Ήr ʉPʉPPʉPP ʉP PʉPPʉP[^_]UWVSEU U P׃X ރ HpPPHHpPPHH p P ˉX ffxPpP[^_]fzHҍtP‹ˉZˉZBtZ ˉZ Z ˉZ 1Q9uȋX x)ʉPʉPPʉPP ʉP PʉPPʉP[^_]fxҍLPM2r utu΋ʉVʉV7W9}q‹ ˉZˉZZttr Ήr r ur Ήr UWVS($ÉJ EpFtD$D$$荫FE  D$D$$Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$Ϊ$2u 1([^_]UWVSdI }wFtD$D$$hFD$<$tr$ctcFt$)t$t$E4$<$E$[^_]øUS 5ÚH E9ErD$E D$E$b [])UEtu]11ɍT9r]1]fffffffUVS*H UE Xt"1rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS4FG }E@Et M 9H 1uEEEEEEU@}WQ  R 2fuft trfu#tPMy MIыURU܃! M0u Uzu@G GGBPWxG8GsBW]O ME9KOft DAfEtD$D$ E܉D$L$4$ĒVEE@#E UJU ыU M׃}׃}uYM0ɉMuFBEFEEF0E4[^_]ED$$E6E@ D$$e‹EPpt EME A AEuth}OAMOEG8D$ED$D$ E D$T$E$虎E4[^_]Ë}GMOEG8D$ED$D$ E D$T$E$6!E ]M؉EEPD$D$ |$T$E$舐E@R$? USEP M TH}[]UWVS`B E}9UNFt%O L$D$$]hF$FA4$]E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$]0tUSUE @@ @HKYXBP[]fffffffUWVS !ÆA }ED$E @D$E$|t7ƅt|$$t [^_]Q84$f}B8UWVSD A uE 1‹E1[t$D$ D$D$<$#=5DžDžDžDžD$D$$z<$ƃtI<$D$D$4${tntD$4$ɲtSD$D$$6zE+uqD[^_]ÍwW$n8D$D$$y4${8?-wfUWVStF? ]u EE1EEExGtD$D$$.G %}(Et)]uU+t[^_]ËV]ċK9 E.D$D$$]6Gf_ @EQ)‹Eċ@F 9AfMGED$t$<$]vMefLJO fMEG(V]ċK9EM9r\L$MEĉD$<$]xEEEEȉEEċ@EME؉EċF9‹Ms]L$Mt$<$]ax8EEEEȉEFEMEċ@Eu9‹MG},D$GD$$]sGfEEA!LJD$L$$]聝ẺD$t$<$]E‰EeEJfMM }.EEFE]C EYf]QfU)Ӄ9f9UsCҋE)҉T$DAD$DQM$]yMAfEAfEFEUfQEf+EfAUfDQȉMMMċQP]XP FD$D$$U]*yMċAD$D$UV$ yG(Mtu 9Gt1D$L$$]}  1Q$Au9uLJEf  _EED$ L$Mt$<$]M91t$L$$]WYED$ED$ED$EĉD$ t$L$<$]2'vD$L$$]EuFD$D$<$]BAf}LJfLJjӋE9MGED$t$<$] rMO fMt fMfO Mf&Gf;EfGLJt]]pffffUWVS01Ö8 }E@(tEEEtG 7AuQ O)Ήt$D$ЉU$%vUfWE\GGMQft3ʍTOU‰EMMf9sf9uEMDHWуf+Uft"ҍ PPf9sf9uOfOE@(u 10[^_]èuE?9xuP9Us݃}fGыu9NV;UF(  }EfEED$D$D$D$ D$ED$E$mPD MD$E$;stۋMfA MD$E$stMA6E EuuKGfGG}EfEEEH(}EfEut$E D$E$nG9E49Eu녉}EfEEE D$D$D$D$ D$ED$E$lE}fEED$E D$E$MnGGV1҉T$D$E$ƅ5EfEED$E D$E$mE@(EMA(1D$t$$EuFEfF7}EfEt$E D$E$xm6EH(D$D$E$6ƅtE@fEED$E D$E$mtD1ɉL$t$E$?EH(81҉T$t$E$E@(EUWVS `3 }u FuIFu 1 [^_]D$D$$^tYVPD$D$$蘔D$D$$&t!VPD$D$$`|{UWVS,3 ljU,E싗E9BD$BUD$$袑ƅUtZBPUTFEDuIFfur>t$<$ut$<$g,[^_]ÉU܉M D$<$nMUuD$t$$V뻉ME EF )‰T$ȉL$Mȉ$oMfMfNEDFfENMMAftHЍDVEEufMډUUuf9sfMf9uuMڋUԋEDPEFƒ)ft;MAȉuu}}Hf9sf9uu}VfVD$t$$HE8tRED$<$1t#fFfFF 묋ED$<$ZD$D$$ؑ1=UWVS01Ö0 uExGtD$D$$藑G t>te0[^_]G(tި0[^_]EEEED$E D$<$9ƅEMu@E@  Nf9sit$E D$<$hu@FD$ ED$E D$<$tD$ED$$荐NE@AfFfzfMfUt$E D$<$ hJFD$ ED$E D$<$TvFHfu9fFE@4UtEfNpD$GD$$[…<@fGD$ T$UD$<$ƋUBuQD$T$$HfU 10[^_]ÅuD$T$$MUE@fUMD$ED$$轎MUf9D$T$$薎GEԍUUT$D$<$60O9fEW,Uʉ׋9AE؅mD$L$M$ E9}Mu25D$L$M$E9}MGD$GD$$]>GNjEA9Etf}ދ98}fxXDy|8f@D$L$$6D$|$$Ɗ1mЃ}uf}D$L$$D$E؉D$${\~rD$ED$$訌D$ED$$芌]D$t$$kD$GD$$… v}]D$D$$}t&bD$L$$贋ED$EԉD$4$4'0G,EJ9NMUD$t$$ZU싺1M9(/D$T$U<$)E9}U8EGD$GD$$蒈…sG>ft׉EfMދ?9}fyHUމMDFDED$t$$qD$ED$$ƅ@PMfPMsfUމ1D$t$U$1҉T$ED$U$葇ƅURjщEΉU*;fffff1̀ffff ̀rS[d( [USH( D$D$ D$ED$E$t E[]øUWVS' EpM dE 1l֋U1҅tUuMxIEGu@p:^)‰ЉhRp9\rD$/$kt)1lU+Ĭ[^_]Ã"`\%$>O`9;π?Xt։D$ h)ЉD$T$`\$d`p9r9>/u`tD$p$5/|%=@`tOfp:uыp)~2?MMXdD$E  D$p$%a8PXh9<Ƌ\"`)@u08p9hD$`$>uVEt)D$p$4JtD$p$4.8m`\ffUWVSDé$ Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xf[fUVS $ 4$eD$$D$F $3 [^]UWVS ^# }$K$K#1$KD$$D$<$h3t$<$2 [^_]USL# D$$d[]US# $d[]US," EEVEEED$D$ED$ ED$D$E$it}u E,[]ø,[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C9x@f;ErfGf;EE̋MAEHEUJ}}?]fC]f9]u]fCẼ@[^_]fEEMf9C1뿋M }Of+EfG1fE.&{UWVSl ƉUMED$4$S]ǍED$4$:]ÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]JMUBfFF F D$t$$]m1[^_]Ã}Qʋ]C ^)fFfF] H@ L$J UL$ $]IUBeD$B D$$]jtH D$D$$l&KUWVS,(Í Ɖ׉M܍ED$4$[,UUԉf@UfPWPM؉EH}O M}O }G} f9ED$$EUE؉EB}GBfBEfBG EB ED$E D$E$M}S‹utftE9UE$E܋u0E]UЃ,[^_]ÉUԋED$$EUME؉EA}GAfAEfAG EA D$T$$hUPD$D$$ju UuEԉFEf@f]܉3u‰Ѓ,[^_]D$ED$$jj1E$S1}kfcUWVS  uE]u BEfAȉE{S ts׋}GEfAfA~V tj׉CfAA A D$L$E$]{i1 [^_]ftC|{M 9uMfftF|~]9u]oUWVSpy E̋}u]E fEڋE M܃8M\$EډED$EE$U …B)fBMfDJ MQVP]XP AD$D$$Uԋ]1EFD$D$uEF$EuE܉EԋE 8 G,E9EEEEEEEBD$BUD$$]xeEЅUBfEfEڋN C<FE EËUBR)9UЋE:D$ED$E$MUЉrEЉE EF  Q])fQEfTAʉM\$ED$$UЋ]CUЉBE܉EЋMEEEIE 8u4 ML$MЉ $M Su[D$EԉD$$]TfD$t$$>f9UuEЉE'E܉EЋEED$EԉD$$]eD$t$$euEЉED$EԉD$$]eD$t$$eG$ҏp[^_]ËV]XVT$T$$]8B u EAf+EfAUfDQЍ\ UUċPURUЃPUċMD$Eă D$$]AM܉MЋE@MD$@ D$$]HbM|MH D$D$$]wdMEEED$L$$]JduEЉED$EԉD$$]%dD$t$$d1p[^_]ÃB]ڋU܉UfTYʋE@%EԋBAf+EfAfDYVP]f9s/)D$]ЍDSD$DS$]/@]KEfHEF #]ډ]U܉UfDYȉE]CCҍ\S1҉Muu9uMu]EԋCAf+EfA]fDYȉEFFҍ\V1҉M9uM]CFEċB Et{MAurMЋIMu f};]KLً] MUMčQ UML$M $ЉE M9s HˉELEE8E$MЋU c$RUPURPE{]C%D؉E6UB%TEMa u>4$MԋU 1~1E^t$Mԉ $M 1qt&(q.&vqfffffUWVS V ƉUMED$T$4$RNjE  EED$T$$`EGfEf}MA U9tD$ML$$_MAD$D$$[]…@UfG|$ED$4$A7U9;GfEf}VE붋Hf9OtWuV1 [^_]ËPUD$D$$_UuV [^_]ËE}?98tD$D$$^Eu0ufp1뒋E}?98t.D$T$$B\tfGID$ED$$r^UWVS05 }EpFtD$D$$6^F w8t<Jut(F(G Z#Gv՝Ѓ0[^_]F(ǀF,}`H8J@ TPTU䋖:fJD$D$$H]D$ED$$ZuGF,TP\@ P| fBD$D$$\D$|$$RZuME}}8FtM$}F FMF(~fNF(D$D$ED$D$ E D$ED$4$1!@EFЃ0[^_]ËE @EEE$U D…ME)tPEEVE$ƒMtEVUfVD$D$$k[D$FD$$Xk V(Nf\VxD$D$$ZtRD$|$$sXHEfM}}D$D$$ZU1뾉ED$ED$$[ZUyV(ENfM}}EfE1ɍ}}V(uNPf9Fǀ<xD$D$$YDD$|$$eW1EfEN,MMOD$D$$zYD$GD$$WzOf9}uD$D$$+Y8:fJTH|D$D$$XD$|$$}VH@ tEfMN,MUOD$D$$XD$GD$$VOPf9ukM9u:fJTH|D$D$$ XD$|$$U1Ʌ 8@ t%UVS?ä uFt$贼F FF(U VUfVF([^]UWVS,O }G,EԉGED$t$$T…G@fEEfEU܉GfEfft?fE<Ufy ED$E D$ $M.MUt(fuU܉B EftcU܉}B ueE苇20fHEDBtD$T$$UVB E1뭉ȃ,[^_]ËEMȃ,[^_]É  u$f}t3Af9EuAM]EEfG M뛋BtƉMD$D$$ZSEM]@fEED$E D$<$>-EMD$ L$M$YUEUGW E9uԋMu7?D$L$M$UE9uԋMEFD$FD$$RFfEftfm10ufpEpЉ&D$D$$REfEED$E D$<$,EMD$L$M$)TEUGW E9uԋMuUKFƋEA9ECD$L$M$SE9uԋMFD$FD$$5QuэGE  uKBfEeED$$LSMfE7ED$$-S>fE31mЃ}tYDqt0f@D$L$$RD$t$$iP1uD$L$$Rfu10ufp[u‹Uutqt1D$L$$CRD$t$$OJ@fE苇0fPUBuD$L$$Qfff̀rS[Ô [ÌrS[t [Ḉ̀rS[T [̀rS[4 [ḹ̀rS[ [薿 UWVSEU Mwv9tt*<9t!Xr8t)[^_]1[^_]ÐUWSUtmg jBgBrn(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVSUDz \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PP#}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVS訩 } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSl } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVSOô EDžDž<|<sL'z DE5N@(=' ==D$D$D$D$ D$t$$%D$D$D$ 0D$T$4$utp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$q3$?o&w̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$$ D$D$ 04$T$z1vpDžDžDžD$D$D$ 0D$D$$肟yPD$D$D$ 0D$T$4$0[^]ødj낺FsGdD$D$D$D$ D$t$$"`&C0D$$0D$$ah ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$;$^ /D$D$D$D$ D$t$,$ D$D$D$D$ D$t$$D$D$D$D$ D$t$$qBBp DžDž DžD$D$D$ 0D$D$$辚t0p ><S,BD$D$D$D$ D$t$k$`1D$D$D$D$ D$t$S$up3@@fED$D$EЉD$ D$D$)$Du}u tTE E E Dt DUWVS 賙 <$ Dt V6uek$Et+M<t V6u<$x E [^_]#4t V6uD$<$ E [^_]US$ n , t$[]EEED$D$ED$ , D$D$E$ړt, $[]UWVS苘 E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$:F]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $tljGUL$$tMVJ}OUWVS袖 uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 1 E}E pE0EEE90EuNEU9sщL$MFD$E$]0D$t$$K&M)Mt2MVD$T$$]#ƅu [^_]1 [^_]ÉUt$E$]蔇Et͋]E0U=UWVS(9Þ E }}8}xEEE3UHD$D$E$}%U)MMuE؉D$E$ƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$$1([^_]ø([^_]UWVS| }E pD$D$$("tW@ u^JM"D$ED$$!t&M)΋PUD$<$U9ur1[^_]ø[^_]D$D$$$ѐ̀rS[ [̀rS[ä [US #È EU D$T$D$ED$ED$ ED$E D$E$a []fffffS[. [.&f̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVSe tMƋuA~8t:F4@9s3`V8F4@9r$=F8[^_]ÉUWVS舐 E}}u1ENjE1txF8t1ɋ}E+wȁĘ[^_]ËF4E@E$]~F88]E F4F0E|U1E} OxD$`|D$}|$ F8D$L$$]UF8)UV4V0]|>D$ D$`T$ $~4V81}׍ @rPu B8~8BX]9uEl~t$]QF8]R9Ëtt]`8 t5UF8M]_8F8$_8F8M$]?|F8tgD$`|T$|$ D$xD$E$5uUN8]n_t?]U_{]UWVS<謍 EE M1‹E1%;E = l9ƅDƅdD$$ BƅC8DžD > BD$4$)D$ |$t$$Ƅ=D]D$D$$`IƉ׉t]g 8X9;-D$BD$d$ D$D$$  {tD$D$$Ct I\"U+ <[^_]Á}l@ Džh1Dždd <$xD$`D$D$ t$D$$~ 9WǸ։|>D$ D$`T$ $9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$@tYR etD$dD$ $s@tUt=6tftt\1Džp8H41`9t9F@FD$$Pu9;dt9FD$FD$$F D$ t$D$> tD$t$ $>9eu d3D$BD$d$5D$D$$@p8/tD$D$$=tVBDž.D$BD$d4$g89:y``9_$"{}d$?J4$z9U8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$I|tD$DD$$<tT?I‹uB8`9r勅9s$4`9u닅$Ny'$wHgtStD$D$ $:D$G$`oNj@8@P1f^$]GFU$=G=D$G,tLtD$D$ $9+_t΋$FUWVS蠀 L<$E D$ ED$ED$E$MU EƉ<$~[^_]US Cè EU BJ  D$T$$ []UVS T utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UwED$\$<$UED$\$E$UpED$|$E$UU؋M܉]ZGu]E؋}7ED$ED$ ED$1uD$E)ȉ$LMED$ED$ ED$E1uD$E$}MƋE]XQu]E)ًU)+U9sʅWE)Ӌ0wPu3U܋>xNuML$\$<$UXML$\$}<$U<5ML$ED$4$U ut$ED$<$UuUT$ML$E$UUT$ED$E$UxIEEYU܉u 0sHuuML$ED$E$UxEEED$|$E$UNu7};Uuuޥ UT$QD$ ED$E D$E$]fffUVS 2u× EU M9Mr/9r 4 9r$9fu49rL$T$$ [^] fffffUWVS$t6 lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$M1 ЋMu`EUD$ T$L$FD$$;u<tVT$VT$$$Ѐf1$[^_]EUWVSsK Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$eÅt@C؃[^_]Éډiu1V룃T UWVSsÀ u xD$4$1E%=D$($dDžts@@@9uE ED$D$ EЋUԉ$T$EČ[^_]C1Č[^_]UEU U U$]UVS%r~ ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D &D$ D$%D$4${U D$E D$E$]UWVS.qÓ E HMxPpt)rP@t3B E$g1[^_]ÃMt P@u͋MAUWVS,p }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$/1 ЋME܋UD$ T$ED$AMD$$9‹Mt+AMT$D$$&MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i=@1o$@1~BEH M?O1WUE PMt ʈP1]UVS@nå ut PtH J H $du4$d1[^]UWVSmW uu #[tCtډu[^_]Ë$[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS mm U Et7Mt.ZYutD$D$ $$E [^]UWVS l } uw vtօu 1 [^_]ËEEUUU܍EEED$E$HED$E$Ku#ED$E$CE܃ [^_]ËE+E1u=TEfH @jUWVS$k7 E܋E XE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1$[^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]GnE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]GUq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]k)EE9xsNMʋE9sBȋutftUE}8$]w)}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$]E[]+SSUSCslj;C ЉϋutftE)P)UKUE$]m1ɋU-Q]؋usStft]E)C=EE\D1.fvBvBAf9vEBf:X9f1vE3f+]]7]J7 UWVS }G tPwtI)7tI1Gu-)t'\$t$G$W,fO @ [^_]ËGDu1 [^_]ËG봋WU [^_]UWVS-eÒ utLD$4$F t$4$ED$4$$[^_]c6 @&4$i$"Plj4$[^_]ffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVScV uc1t\F t4VtCF uuIFF1[^_]FF؉Ft^u$VfF u4$볐1붋V0 t~@9t $YV0F FV멸{ffUVScÄ uFft]|T$$+xGE%1= ‹MUtJM VL=u,in9F(u!Ą[^]ËEE Ą[^]ËE UWVS|ubڒ uǠ1E1F t)fF FCFFE+|[^_]ÍED$ED$4$EF u9vtlEE$P*1K FEFEu E f F Fft$tߋE f F dFfxD$ D$D$@U$UPU$EFȸ$UWVSK`ð Ɖ׋@0$VF0PE9EED$$1F0Pt$T$8$aF0PuD$E$V0UgU쉂PF0ǀTu Xt$[^_]ǀX\D$$F0NjF0TXtXU,_ M91u]1҉]UWVS_g u918u [^_]ËF0$F0PwV09t'Pt($[^_]ÃT1݉U6UPV0ǂT1UVS]^Ž u91u[^]ËF0$VF0Tt$=[^]ǀP8${F0U]R MU 91u]É]sUVS]$ u91u[^]ËF0$F0U t XtTt/$[^]D$\$zF0ǀP8$F0UVS8]Ä Ơ1E1EȉD$E$KU+u 8[^]fffffff̀rS[$ [US \ E D$D$t,@E$t []UWVS4o\Ԍ D$$΋ED$ E D$ED$ED$O׋U6Et F"-D$-ED$ t$|$D$$$mD$(_-8Q-L$EuKD$$9t:D$(T$ 9ЉT$9D$D$8tEVtEWL$ 9L$(L$ET$(9T$L$tD$(4[^_],UOED$$D$(1D$(4[^_]ÍD$0E|$,E"D$ D$(t$D$(4[^_]ÅtD$D$(t$먋E"UWVSZ EU uM] $\$M] &}}$}M] $\$M] e[^_]UWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]lfffffUWVSY6 }D$<$`t(tt$<$#[^_]1[^_]UWVS rY׉ uD$4$tfUtf|$4${t>UT$D$E $;Es1 [^_]*"y*l*UE U9r 9]ø]UU E9r 9]ø]UWVSX 0 0 u0 1E1ɍt-ωD$4$u t 0 PEu׉MD$D$4$ MtMljMuD$|$E$ 0 8Ftt$E$. 4$LNuME8 9t$$.Nǃ8 ǃ4 [^_]É4 TD$D$$[^_]UWVSJWï u} t%eD$4$tt=t1[^_]À=t[^_]UWVSVU ED$<$tƉD$<$* 4$HM[^_]UWVSV }G$Dƅtx @D$$[^_]USYVþ ED$$mtU 9P []1[]UWVS Vz U1E8s7i1}ƉUE D$ED$<$u E <=,EV FfV fuUT$U T$$ӻ[^]ø"8u V F본UVSQ~ uFftAȋED$ E UD$T$ $!уN tFPVTfN [^]ù뻀fN [^]USP E@fu$%[]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu#B[^_]ÃHPtJ ȃB[^_]UWVSӉ΋t B SuUtBu{QtBunQu Q9tW[u믉 St2tAu(t@uAt@uSI[^_]ËtBuBB[^_]uUEU P@@ ]UWVSEpVUu 3t)+~E D$|$F $EЅu׉[^_]1[^_]UWVSExOtX1҉UM~]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSExOtX1҉UMy]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSEpEFM ]M19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)뵸6̀rS[dy [USHHy ED$E UD$T$ D$E$f[]ËL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffUWVS0MHx ƉE̋]E Ơ1U1xu2  t8u)؋U+0[^_]Í}1 r}̍)]ȉT=Ѓu]t; t\="t]y$]E k1d]̍蕯UVSu] U؅tHNtuxu)؃[^]UWVSHGmw |$4D$ T$L$@utȃ"=D$ uƉFD$8ML$$\$4 u܉t$DL$8D$-+|D$0|$@0D$8 D$<D$@ \$0ۈL$D$8T$Vo UM B=w B[]Í*[] U>o UB=w&B]Í*]USw>n UM B=w B[]Í*[]UF>n UB=w&B]Í*]WUS=bn UM B=w B[]Í|*[]U=!n UB=w&B%]Ít*]US=m UM B=w B%[]Íh*[]UN=m UB=w&B ]Í`*]_US=jm UM B=w B []ÍT*[]U<)m UB=w&B@]ÍL*]US<l UM B=w B@[]Í@*[]UZ<l UB=w&B%]Í8*]iUS<tl UM B=w B%[]Í,*[]%U;1l UB=w&B%]Í *]US;k UM B=w B%[]Í*[]U^;k UB=w&B]Í *]rUS;}k UM B=w B[]Í*[]3U:?k UB=w &B]Í)]US: k UM B=w B[]Í)[]UE ]UE ]ffff̀rS[äj [D$t8t9@€tuuuuH+D$US9=j ED$ ED$E D$E$[]UVS<9j uE EEEEEEN>wN#@ t$ED$EȉD$4$+xE<[^]EӸ<[^] UVS<8bi uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^] USj8h UT$$![]UWVS,<8áh 1EԉE1ELIBCE_ALLEOWCTEYPEAEBUSEfE=18t=u tD$t$$ u߸MԋU+u ,[^_]1US7h D$E $t []ËU$ []ø̀ffff7̀rS[äg [>̀rS[Äg [US7hg D$D$ ED$E D$E$[]ffffffSD$L$ T$.&&@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8tt& )[Í1[ffffffVS\$ t$tCFtU8tOu9vCV9u !€t.&CFt8t)[^fffUE1]øUE tUt1ɀ81U ]11U ]ùUU ]UE t&Ut1Ҁ8‹E1]úE1]1ҋE1]UE1]UWVSU ]E8tOt(G1Ht*t-Gu߉E8E1[^_]Ät1ݻ뮉E1[^_]UWVSU MuEEtxtAE1}EXt?:tWEt uԋutE}8E 01[^_]Ät)Etփ뢾u1ЋuE뼋u1UU Et$Mt!tȉ U1]1U]UU E=wMt1]ËEU]UWVSU ]Etttw1=w%tQzt.t&=vۋEUU2[^_]1ɅtE1U2[^_]Åt1뷻1UWVSU }uEt^tgtc1tt+9t#t=vٹUU [^_]1ۅtE1U [^_]þ1Ʌu1UE Utw1U ]11U ]ùUU ]UE =vU1]UE@E@1]1UEt2Ut/u }wE UM 1]øU]1E ]UEt7Mt"U tЋM 1҄‹E1]úE1]1ҋE1]UU E=wMt#Mt1]ËEU]ËE]UE1]UEu E1]ø-]UEUt(U JU1҅‹E 1]úE 1]UEt7Mt#U tЋM M1]ËE1]ËE1]UE =vU1]UWVSU }]tbtC1ɋ=w#tArt)t"=vݹUU [^_]11U [^_]Åt1ǻUWVSE ]tEt)uV1Jt%8tuE1[^_]Ätǻffff.&&$D$4̀D$̀fffffffT̀rS[_ [PS[^ [USu.^ 91u P1[]&[]f̀rS[ä^ [US#.È^ $1[]UVS-a^ l t t [^]É4$}fu`U1fUVSÉ1   lLLLL9r[^]UWVSTE8}x}x}@ EM]Br 2 r 9u֋EE}M1ˋu!1Eȉ1!1E1!1 u1!1 ]ĉ1!1Mȉω1!1֍ >Ủ׉1ډ!1ƍ> }lj1!1ލ> ]ԉ߉1Ӊ!1΍>M؉ω1!1֍ >U܉׉1ډ!1ƍ> }lj1!1ލ> ]1!1M1!1U1!1 E1!1 }7yZ !Љ! učyZ !É! uԍyZ !ى!  u䍴yZ !ʉ!  uyZ !Љ! uȍyZ !É! u؍yZ !ى!  u荴yZ !ʉ!  uyZ !Љ! u̍yZ !É! u܍yZ !ى!  u썴yZ !ʉ!  uyZ !Љ! uЍyZ !É! uyZ !ى!  uyZ !ʉ!  un11uԍn11 učn11 u䍴n11un11}܍n11 }̍n11 M썔n11U2n11U؍n11 ]ȍn11 }荄n11}7n11un11 uЍn11 un11}lj}uO}FEЉF T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPEE);UEމE} ]7Ey@9rE)uu U<u sCtft[^_]äftu^uE[uOuW] ]u\3]|fu SfUWVS 'wW EE} Ơ1E1WEE$G?7w}8)‰T$2D$<$D$ED$<$EX1u4u:tftE+u& [^_]úx)끪WtfpfffUWVS&V uN^~2S C1ЈC01 2 Ƀ9u߉u)1^]^D2VVҋM]2ӈ]9u҃t[^_]UWSUBBB Bz10u7u=˃1҉9ruu[_]ê[_]ft/tfUWVSE1 tftu؉ tO;Us]E )])9sˋu|}M щ؉΃ru.u<똉U4$MU;Ur[^_]CtfUVS :$›T u] +D$LD$$D$CD$$SSVSVC F ] [^]D1ø11# T ة1øUWVSH#S ` ts}1f1҉9r׃uFh E̋d Eb fE؋l EЋE D$D$(Ẻ$UH[^_]f불UU 1EEEu AfEEt%uыqEuۉt Eĉl }t Efb }d }t Eh t3b 9s#M>u +N 9rth Ӷƃ` =@AEĿ0AEE!d td xUWVS!6R \$(ED$XE }|$8}|$,à1\$$1҅ \$X؉D$DD$D$$D$(H5D$D$8<%t2XD$$\$X|$D9s CD$XD$8D$8<%u΋D$8P@D$71D$Tt$\HZw|$(3D$ \$0T$8D$`1D$HD$LD$\|$`D$T7D$\t$\T$09}L$$L$TL$<2L$D9L$Xs'L$Xq0T$D9 L$ Nt$X|$<T$L~-|$L|$DT$HL$X9s0r|$LL$Xt \$DT$X9s  sT$XD$TpT$0D$\)B[L$DT$X9s sT$X;1ۍHЋt$\ABHЃ vwD$ \$0T$8D$TcD$TuD$T|$,؃|$,mك۸D$7-t$\L$Tt$\L$TD$ \$0T$8D$,X\$<8 t$\t$D$<$\$()9؉D$L҉T$HCt$ h9q dqA1LƋE1D$<$mFw ^P $Pu atZ&pXt$ D$D$!$芠t$ h@D$D$<$o:Ww hx\f9w1~t bTtjDžL$L$$~ut Љ9x CPf@@Px Wf Nj@GGG1Džt<Ǎ L LL$LL(LL,Lzfz9t&ǹ BHHH fWDž\E<$2fLJWp ~p1fDŽBDŽ|:t&t:1t:qt:q|:y 9uf@@ODž@<Dž`DžH&XXW GlDžtlDxtЉ@<< DžP$t ЉoGah@p|l@\ t4F<<SDžtGD$ pt$|D$$Kq9OB0G10<$m0ttl9G eHH9G1$,0\m`<Dž*hL$L$dL$ L$L$4$ЃBw<$y/fLU+eY[^_]aËlF<.Dž1l@<cDžPf7H担tt ƍx$D$ t$t$$T$T$T$T$T$T$ $&XTdDžD$L$D$ D$|$$>pP |7f90ua tVXt$ D$D$ $Ηt$ ȋ9~D$|$$1Dž`x$D$D$D$D$D$D$ $/XC)ʍ‹fDž@D$D$$,o-8"0Gw0<$,u&L$$vOD$ |$|pD$4$ N@u a QTt$ D$D$.D$ D$D$$Ct@Gk <$*Dž`qD$t$D$ pD$|T$$lp9GD$$<$c*ua '&PXT$ D$D$$薔T$ D$ D$D$D$ t$PD$$蒪Ut$ tD$l7D$&X$$@;840@ 0$S)tߋjD$D$$itG&XD$ D$D$$DtDžDžPG&BXD$ D$ D$$ӒDž\Dž`D$t$$kGt0GR$3D$ Dǃ<$'Dž@(Dž`$D$ D$;D$&$sGGGG+t .n0G0b4R u6d@t* <$&Dž\Dž`Dž`N`!!4 t5&BXD$ 9~D$dD$<$*G\<$%tDž*L$t$dL$ hNL$L$ $Ѓ.&<$Q%`VWd@WO&BXD$ D$D$q$bG`D$D$&BX$Ƽ$D$ D$;D$&$臼Ji\OHuttЉDD@<.<mDžDžpxW<$#D$D$PD@$(dFD$DD$$g\D$ $^"D$D$4$&pD$|L$4$D$D$$Dd‹p9DžfDžd)ff҉T$t$$d@0G0<$"@6xk<$!Džd$ 9Gf\dfx‰)fftg҉T$|$$c̉@0G$xD$ rx|df9Gu a &&pXt$ D$D$$ t$ 9~ȉD$dD$<$$&PXT$ D$D$D$覊T$ 9~D$dD$<$$$WD$ D$;D$&$ݷff -$u\=$D$ eD$;D$&$CD$$j<$rdHf+f)fffv҉T$t$$4aDžT$t$$5xDDu<$/Y?&XD$ D$D$q$HDž@<g@8MDž&XT$ D$"D$7$T$ 9~ȉD$dD$<$!+&XD$ D$D$\$mMDž]WSq@dW0G$D$ X)+t .0G]$D$ 0GG<$Dž@(@t$D $MJ<$Rtvl8e0@1<$D$ 0D$;D$&$苳Z<$fD$ 뿋D$D$&BX$Fff̀rS[ä" [UEU UP]UEU MHUP]UWVMu}u }E E=ɚ;~ -ʚ;1yA^_]UVSUEu M ]+M]9|) ZB[^])ʚ; ZB[^]UEU +EU uE+Ex]ø]É]UVS 1Ö! uED$$&uEEFEF [^]D$E$Ex(E EUVN [^]FF [^]UVS  uED$$uEEFEF [^]D$E$\Dx(E EUVN [^]FF [^]USMEE UQY[]UVSMuMb)E UQY[^]ffUWVSL~ }E E1‹E0W`D$$D$ D$D$D$ED$ED$ D$D$<$ ƅIu G$@ED$D$ t$D$<$XƅZWу @ 1 $QED$ ED$D$$ED$D$ D$t$<$ ƅ~QG D$D$D$D$D$ T$t$<$sƅGD$<$E+RL[^_]ËD$<$‹Pu@fffuGtwp fHfHff$,t$ɉL$ T$D$7$褪PtGtftPD$<$$v$cD$<$D$<$D$<$TUWVS,7 }U MEƠ1E1GED$ED$ L$T$7$蘩L$T$ D$D$$=E D$D$ED$ ED$T$<$fU+,[^_]Åx$蚰=wttH|.uT$L$ D$D$$_UD$T$7$耨qD$<$9dRUWVS(} E E1‹EE@ I<$&9T$$E&D$ D$D$4$ DA@tD$4$KuDJ@utSFNu tDJ@tEpt$|$<${7$*$1U+u ([^_]PUWVSLg }u E1E1费D$<$11Ҁ.փu9rMd9G GDGDDžDž\x.uED$D$ED$ED$ D$D$<$zU+L[^_]DžD$ D$D$<$dt9^G#GDGD}1DžED$D$ED$ED$ D$D$<$+GGDGD1DžDžDžDž.UT$T$UT$ML$ D$D$<$tN8=^G1҃‹Otth uAED$D$ED$ED$ D$D$<$RtD$<$ ED$D$ED$ED$ D$D$<$PG tD$<$& 낀xbV1@<t 1ut$t$ut$ ut$D$<$moGDGDDž0ED$D$ED$ED$ D$D$<$)Dž;D$<$ eDžDžDžpKfffUWVSl!Æ u} FM(}, E(@@4$ fF@fM(fV  ЋM(qfuf fAMEtXl[^_]ËE$VEE$UT$D$ ED$&D$8$P},~q EEML$D$ E,D$t$E$mƉt$E$ EEFD$ $ E(f@UE(E,) }|$}|$ D$t$E$FƉt$$ 4 FD$E$" FD$$" FD$$E(f@  +E(l[^_]ËE P E, 9pE(@ D$E$E(D$E$E(D$$E(D$E $sE t*E(PE ׋us-tftu ։+E(}(fGl[^_]uu#}(GE(xE fUWVS Y U }E@4E)Ѓ FD$$)FD$E=b$VfFE@ uH1T$$]F D$$JG fffG F ) [^_]ø뗨u믍$aU >U$HU͸UWVSS M uU E@}ω}EE‰EPE)9UB9E9}}|$4$kGD$u4$YW׋u$sBu3u,u֋ED$+E$!+E[^_]äftˍvu4uC먉U$6UM MAyEfffffffUWVS( ljUM܋EGlE8u䍃"E6E썃NE< t< tD$ED$4$pD$ED$4$QD$ ED$4$2/D$kD$4$Gh$u< tt < u>:([^_]ÍF$~d ʈdGtD$)$i닍F$~GjD$?$4SD$ qD$4$)tD$ D$4$ uEO F $U~GGD$X$賙D$ͨD$4$訤tjD$~D$4$芤uXO@E܉D$ED$X8$JOWL$T$48$+yO >D$D$4$t*D$ D$4$ugOD$sD$4$u O@D$~D$4$薣u OD$D$4$luZUmxD$4$訑ƒ?v?T$U؉t$E$lEUƄD$D$4$uZExD$4$0ƒ?v?T$U؉t$E($SlEUƄ(D$ D$4$| D$D$4$Wu OWD$D$4$-5g)UVST0 $@XtA|xEEE%EEEEX5D$D$D$ D$ED$t$]stT[^]UVS"Ç Et4D$E$,EEFEF'AfF [^]Íp UWVSx*  1EEtbUD$E$+Ef3EfF}<$wD$t$<$|$4$FUM+ ux[^_]Íp s?UWVS*Ï }x$CLJft/1t$CDŽ9Ӄ[^_]UWVS u4$`t&tuOxu:<$džt$džf[^_]É$B뼋|Eo?9Eut$BUv Et]Í]UL Et(]Í]UWVSu] }4$sfdž1҅~1u{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVS q uD1 E1D$4$F u uD@@$D4$^4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$ WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$$yw`D$D$4$,fƇ_WHwDG` \Dž01'< t/t 201Ƀt&9n< [< uuDž(9D$$8Dž4DžHT,8D$ D$D$H$Ӧj<;t<#tH8domaH8searH8nameH8sortH8optigxionsZ< t< GD+<< ~< ufxinM< t< L( t t Dw`D$D$4$cƇ_D$4$QtDž0ft DF 4DdLʃ Јd8$VD$D$ $ЉT$L@$]Lt׋$ˆL,D$ $L)&D$M7D$4$*5 D$.4$8]D$D`$踟DǀtǀxDž0Dž(|8$D@Dt$D~DD$4$ku덃$g< tt< uDž0<4,LTDD|$@$ \<NFVe9xDw@ut;u㈕$<,t$$<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $4L{;$1!$tDž0pvLusL@DDu|uc' 0D$D$c1ɉfLu LVfqUD$E$#]UWVSX.Ó }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|E/9EttIX5D$D$ED$ D$D$t$oaBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[ô [UWVSd.Ó 9D$$T(@$ݲiDžDžDžDžDžx@ N L$T$ VT$D$$ZT$${@ 9@ωփsUtfth@ lj)#Pb덋ptŋ t|$$zu똋P04$و@9‹(tft‰)@0DžuY tftlj)@4#tF4$@9r1‹rf$y@ $o_1d[^_]U[‹);Wh@ 3ffk$Vx0P@~~ <9V) 9kVʉ)ȉQ1ҋ;tftH<@ lj)9ts9h΃rE@ $w4$R@9q‹ytft‰)‰DžHtftR<lj)944$t@9‹yUffR 3PD$xumuTk@ $:f+ f넋$t@ iUVS3Ø 1t$藕[^]Í9D$$P~[^]UVSI 1t$Kt[^]U豼 U]UVS蘼 ut$[^]Í9D$$}[^]UVSLñ ut$s[^]UEPM¸t]ËE@ ]UWVSL }E0upq @A9D$$}ƅu!yH L$UT$@$tEG D$GD$ GD$D$4$˸u4$rG [^_]É4$r[^_]ËG [^_]UWVS p E18 &:)lj}싓 u2E D$ $ [^_]Íht$E$qt$ $qt{ t1= ;txED$D$quًED$ D$ED$ D$8D$$ [^_]Í8D$ED$ D$8D$$訸 [^_]ËED$1UWVS 袹 ''w} )ƉT$U$般tn  UT$ $atG  D 1 [^_]ÿ'y qUWVS(ո2 LJ LJ LJ  11ҍL=EE5 )Ћ  ڍAw l5D>ЉD>]T>ӉT>=MHL>@CD> C k <;E֋ xzt =w ;5Et =w ;5 tH~k LJ yM !؉ MeM썇G$  MLJ  M싗 1ɍ5]MEUtwM<9ErMtu艷 Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>=L;<;D> rU7UsD>HL>PD>HL> H<7Ë ; e8H P H HLJ < MULJ D> UMD>ЉD>]T>=L;]ف958LJ 롋 LJ LJ D>ЉD>]T>=oMU&E1E䍇 $,UM>D$1ۀ} ËE)؉D$ D$8D$$߲UMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@pUM^D>E싟 ]X] É %LJ 8 f gUUxz Mt ; r tX8 H P H H< Ћ]!LJ D$.fffffffUWVS0- EЋ u䋸 }9E,Buԍ@>u썰L?u؍,Au̍AEE]]EfL?M܍AuE苈 UȉUE}uufUE7 >Eǀ  u ǀ E苈 E苐 U苂 t> t1P}艗 P  5R}苗 D$ $ 돋 uЋ Eԋu؋  À8 u }胇9u}U & E苐 &X U苂 }]苃 D$ D$ D$ $R=  >E苀 P[^_]ø]苃 $$E{o…MtO1E&} &E7LEDXtE7<$].oƒ9r̉E1R1KU} MԈ }ԋ EU}ԉ+ E Ћ U }Uċ:O, OŰU苂 U9E2\9ËU)Ӊ]W(EUȉ XND]荃QD$$!_E艘 G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]赚Gt/U艂 Uċ:MO u#O)ȉƋ_uGE荀91uȉMȁ vE W18 M苹 MċKщˋMD9UUċ]苃 $\UuUȋ]苃 $hUE苸 } M< ЋAE̅+}苇 $  <EU‰ŰY9Q MỦ @D@Eȉ EăU2ŰEȋUЉEu艆 EȋU}̋UUu艾 fEЋ }ԋUM‰T$Uȉ$]謘MAYۋUBA ,Eǀ GEU<A,E苀 E]vC]苃 $Gg]mv8B_v $}苇 D$ EȉD$D$ UP$0c tU苚 <AEE苐 U }< Mč[^] v e T ڟC ɟ2 U赟 U]U蝟 U ]U腟 U ]p U\ U ]UWVSJǧ u"$ uމ4$葕LJ LJLJ LJ LJ LJ LJ LJ LJ 1[^_]US蔞 E$臌[]USq E D$E$荑[]USGì E$Ô[]øUSà D$ED$D$ D$:D$$辜[]UVSʝ/ uD$4$?ff D$4$?[^]fffUVS 肝 EpFtD$D$$.F!u  [^]nUWVS~ uM.D$ ED$E D$E$赋Te>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$1uDžH V€ʀ UTPzmD$ D$D$T$RыU !ȃP{vmm0<$xT$l01[^_]À Vll0<$  PxD$T$1>P^E E DžTED$D$ D$D$$sDžt HƁ Zkk0Ek0 84G0G 2G (G ^G&G1GD$D$L$$)PLPP LЃHtfD$PD$L$)+H  D$ $PP D$돉Lj8PLen  PD$T$nMP@ ƒ@ ub+b"*fffUWVS葘 }EpFtD$D$$)F B  D$4$u_  t$ur  T$U4$Džu=U9B0E  i[^_]1UD$D$4$ot̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$;([^_]UWVS虖 EpFtD$D$$'FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$e !@MuFЃ[^_]úЃ[^_]ÉED$D$$ 'UЃ[^_]ÉfUWVS$_ }9EUEEEE;E MmG$Ju݋M…tUL$D$<$LUUD$ ED$}|$4$/u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$耇t㉇1UWVS(Ä uE䋆EMM܉;E E苷EHMU$IƃUtY9Euȋ})lj}苊U|$$谆U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$5.u@EE9E 1([^_]D$ ED$ED$4$-l([^_]UWVS(葒 EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$]LIMUD$ E܉D$L$M$U]-M9M Ut%E9s.E9hw1([^_]Á ([^_]É\$<$蕄DžUt([^_]UWVS(" EE] ;M sf]]9suE19r 9t[:u)ÈU]D$ E܉D$L$ME$]+uEFM9M Uu]1([^_]É)맋E ([^_]ø([^_]UWVSFë M EEEtA<1D1?QM )։t$D$$YM fyE\AA}?zft-}|y‰Ef9sf9uE}DxQ׃T)ft"ҍ]uU|$ $Y|tUx?UWVSS EE,E}1EED$ED$$]ƅ@ wXf]1 9M rTVÃf9EuUMUfY]][]]}tH}t8M[DF,D$t$$]E.D$DFD$Nj]NYE}E9}twu})D$D$$]9utAFD$FD$$]tVTP‹}u뙋u]X}8[^_]ËEpE )}fG w[^_]fUWVSV ƉU׃ VU)D$ED$M$GMf FE@)D$ED$M$UҋMf f>\?)fDfL[^_]UWVSFë E xfEEETf}tU)ƋUJ;MLW)ȉD$T$ΉMщ $7E9EU|6DU+UU\WPHftffP9uEftWf4T]TfTEfEh8E H1[^_]ËUƉE봋uv %E D$E$P[^_]UWVS$d E}EW u}EGft;f~su f ljEfGfEnMfyvE̍DTQ9>ED$E$E@EM $M̋UEHfEEf;EЃ<fD M)‰UύU)ȉEEċỦT$MȉL$E$L9E U/MfyvE̍DTQ9ED$E$E!@EM $M̋U+EHfEEf;/]tED$E$f1E$M̋UȋEE$M̋UȋEf9MsFfED$E D$}G D$|$ ED$ED$E$ uOEEtE@EEEt5@EEEIpEE@ =]c]cx[^_]|Af+EfTM)fLFMfLFD$ ED$ljD$E$[EtpE@ =tGNjUt(ED$E$f}EEEfEEEEMt봋EEfEE1UWVS$r{ Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$JhED$$cEu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$Z…t EME$EPEwD$ |$UDBD$4$Y tʋ@f8 $dž  BUWVS(mp֠ EE} w8}PUEEE@E|FBU M9sωU DF)fEȉ|$UT$M؉$]V)}}C}ffE‹M9sfUM9L>f+MT$U܋ED$M$]UU)UMfL>fD>}f)|FfLFE pH|FU҉׋]9s߉]9TF)ʉU|$ED$M$]}CUfFfۍD\M)f fTN)}uefDE H14rJ|F E9PfD>([^_]ËU9ZC8fDE D$E$]E tpHTFUWVSm EE @u E1Oft{DXND$ t$D$E$]Vƅt|$E$Ff]PMuJfwfuf|Xu E녋U R1M AMf E@ =fEɍ\)fDJMfLBE Ht$E$]t9t|$E$Eh81[^_]DXfBfBFi[^_]fEqUWVSGlì U EzMq uf+4GMM9U t$ED$DM$\u)uD$ U T$MDD$E$T…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$ƫUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS kv Eu} 'D$ D$DJD$4$]StDPfzuft,ˍ< fD$ t$MDD$<$R aLJ(@f8u$LJ 1;D$ t$DHD$<$TR…@ fEB@fE1fEE$MAE9F ED$EFD$$3M1U)fUN fMD$ t$MDD$<$Q…ZM_LJ $LJ(149UWVS(;hà E։Mz@ =uW)ЉEN MMȉEGfEt$k^ED$$YUE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$@P…t#M L$M $MEEvEz8UVSu]ED$E$1ɋU Ct1[^]øUWVS(f EuD$E$1ɉE--D$ED$E$]>EED$E$} fG fE @}E;EEHp@ˍQU40fUt0UfHUff]f\ftPE ]M HwOfw]E;EE t81([^_]ËE jx}D$ |$D$E$]_N] C$NfMЍLLXffFfLF|$E$]DžtMfNKf̀rS[4 [UWVSTd E؋}u1EĉËE1;FEE 9b}}TD$E D$<$]A@fEҋ9E E҉EBFEȃEYf]YfU])Ӄ9f9UsAҋ])҉T$DYD$DYMԉ$]MAfEAfEԋFEUЃfQEf+EfA]fDYȉMԋMȉ]XVT$T$$] D$MԉL$$1uċU+T[^_]D$E D$<$]M@fE҃}t>}ED$E D$<$] @fEfEEE܉D$t$<$]1EEEE܉EFEEuẺD$ED$ED$t$ D$L$<$]茊D$E D$<$]tK@fE҉ED$L$Mԉ<$]iM1D$L$$],s]UWVS(|a }EpFtD$D$$FG!9t~rd94D$D$ $jG)‰T$T$$2E䋆E} v&F2([^_]ËUE} wڋMBE 8t9  u|$4$tH9s`!EEUU,D$ UT$D$4$VOH9r!<ED$ ED$GD$4$u@}} u~$ D$E D$ |$D$4$"([^_]F(~$E 8EE 89뤋$U)ME\UUT$L$$NH(T$ $RGE$9U]]US^ ]}]ufffffe`[T$Hfffffff50+&!fff] ]UVS]= EEEEjuVjj < uǃ< 1tj%jj#jVj,j$j%UWVSEE] }3t>u2j/VZYtp`t0MPV'ZYMu}] EEAe[^_]VhhUhp&1UWVS]u 6ͅ_hVS tfu91&ۋ=&)u:2=&u hZt& &hj5& & @u5&hjch_Xu4'hjAMUW6&ZYMtUBk @u6h/jVKSWHPoUWVS] 3„hjGVhSu@t h&DPI=ě&Zuě&\1ț&ԛ&@5ԛ&@jjPț& y 5ě&&*@&_?=0%v&u hj&u#&&)&@&@&%H%hPRY& yT&P&%H%hP5&ң& & y5&hjl`&&u-x&u&H>&uj`&D&&9ӡ&&s>&táx&>`&t&&`&d&Л& ̛&tE& &tF&%h=`u; & x&|&&x&%&RP5&&P &t h jh@& hjGhūj;1=Ě&=Ț&=̚&&h0%P0%T5&t'& &&&;&&ss && u15&5&5ț&ԛ&P$ u15&5&\ě& rPPh˖KAY[&u5j5&5&5ț&ԛ&P  t5ě&h舖XZ&&&&&&&K&]&]&] &&9Uu/9Eu*&&ڣ&&&&6esEUӣ&& &&& &&t1&&h&l&jj<1=&=&XsE&&EUMt(&,&EU&uRR? &&&&=٢u9:=u\:=ul:&t=h& x&9ȋl&|&s")1=d&x&|&h&l&l& h&t jp;[Z&5& tH x&1=`&x&|&h&l& `& d&)։&5& u&=&ujPY@u&8th#5&&PZ@u hj^j UWVSX ] 3~hjOjKhSu G-$l<&1,&&8&4&1,&&@0&z&,&1=&Y(&J15,&&3$&$ &1ɉ ,&&&&&& &=&th=91tu hj1nuou&j,PYZFt@jVnE&^Zu hW8pj,WZYt x>1>(Phhp&j 0&&=4&t t9h0Buu/ (&t'hZ&=(&th&&jW&ZYu hy;O<&=$&t11X=&uمtՋ=&jW~Y[^t' 9=<&tЃ=$&t ]tljVJti ȉ=&\t 1Z01C PXjZP0P蔑t 1B"&~h u)VC_Zu hj15&DRPrZYyHƅu(3%=`uHƅu3i& PVXY_=&i = &t9PV(YZt=&Vh$}=$&t%" r=&ughg3h$ QHu =&u7hgV3h0~$ G=&=&u3h[XZ=8&t4011Dž8hhOP &58&8i& 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =4&u1&4&&=8&t50}<";&si \tj@u)Y[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtPE Z\tSd1XIEt'U)RPSS Ã~t C}u"hih2EZYu h"}uEEuh&WuuEpEP`uK9 yj=&y h}tLjuVjhSy hJXjVjh5&y h#XhijuVjpSjVjw5&,u!1ɉM̉MЉMԉM_1xH>v m DGu΍EPEPj =&t}t.D1}tEjEP4xz Gu踧Ey h(jVh~f5&FVh~fS:SMUE聓}u j u(XZjUE 0"jMjRUVSEU  J &uc1E1ۋ4Vh1uU  &H &Y^yh&j EXZ&P& Cu 1e[^]ÍL$qUWVSQxq1&&&& &&&&&&DžDžDž1|hV @I&/0$S'$1%%%s%d&jP591 :uy591h%& &&&&&&144hC u &w&l&91j/SY_Džu ;C3@;tGt@:t%t@tj/$[ZÅt8@tYt@t3t_@tij/ZYDžt+{tQt@tUt/{t@t)tG|hO&Ph&h&h&h 591mu91<t h+ju=&u&fPh &Ph$&hH591~!91<u &$&9shR뉅 &91j/S=Y_t6PS{_Zu#91%=@u %91i* &&%%91&}591Z%[=~ PZPhoj=&)ѡ&=&t & &  & &tWH=&t t$h4t= &t=&uh=&t=%uhI&u %iDžtDžxjjVjjtS5@t,O(YtjjVPjSf5@t=%%=&u/RPy_Zu%=u && & &1  &t1=&%=&uRjhh&PR%y' 8uh&hOtFh&he[^h2hYxh&jdh&6hۋuw1ۉ& &u %2=&=&%upÃ=&uMhdYtpjhXZؙjjjjjщڸ h*tt Sh^_1&@u &&  & &1=&&Džt~ Džh0&Y=tk jhjjjщ¸. ƒti¶ f&j&DPXZh]/Fjh[& 11"&tJ?tEWhV&&1ҋΉT 9u9u @u&1;=& &؀tet\PhV% &1Ӌ Ɖ\ 9u9uGtDžDž19~JCWShމD 9u9uG뮋y1RPjjjʉٸ TƉVf=&?&tu ù19rGD8&G&`&11ۀt,&t#u;u u@ $ut&u돋5&&19}{.tK;tFȉC219u9t&A뢡 & & & &=&uYh,^= &t-& ,&t h+[ha YtM&] &S2&G~ hOZ &.~ h6X0j񋅀Ɖ1ƃu hϡ&11;&ÍPPZYx+=w;)uv8&=4&50&jStP 1eY[^_]aUWVS}] 1ɉ1Dž1hASW# rfq1stwU1҉j P591U91 8t :tPh&8"[N591h!jqDž-Dž&)Ot/jhP6P29Ãy2 h&hedAP y hH=*&9 @f*&1ɋ8/Xu uXhR2jh&h&e7u2  tȸuPhvlZYDžf(&h&x2f(&h&-k~PSyhHju"PhwdS h(XS[1e[^_]US] 3KSu7US] 3KSux:US] 3KSuH?UWVS}1ɉ@j/E 0[^&t@E &~ Ph5"0rXZ1 $11<8,(Dž4h"u Wھà A6$Dž,jhjjh91-q8jhjjj91S"q&jhjjj91^"q&&Ajhjjj91^q $jhjjj91i"0q&`jhjjj91 qƃt @591hq"pY[91&jhjjh91$p&jhjjh91"p&jhjjh91"[p&jjjcjj91@7p%jjjjjj91"p&I@Phjjj91,o& jjjjj91"o4911҉j PSZa< 8u 8t Sh"hT< )Sh"h"jDž8Dž(&)Ovp< t5<@t<t#WVv P5v<$&j P591DE& :t591h|=h=Y591 'Zu591h=&Q&B9121ۉ%%&tRPh=j蔈&1ɉ %&h591&[Z591h=jhj P591/D% :t591h >jth$>A&^&O&@&&u h_>j譇=&u,LXZh>xj^_=&th&h>KY[hjjhhb:QW=&th&h>KXZjjU^_=&th&h>KY[hjjhhbzh>g j|XZ=&t0=&th&h?AK^_hsjjhhb$jh> Y[.h>d7h>jjh>?jkjXZhVsV9E thRPVOu u &=%tWoIZhbRPW.Nt(hWsWD uj X=&tjUWVS] }QC2'S2'jhh2'jP6'@u@m8u$jhh2'j52'6'@u52'hj2'2'h2'hQ@56'肴 %y@%2't1MPRUdZY UMu܃ SEPQjY@%uRPh\ej-qUWVSXu] 3&ø_tj1Phj91t8'hSV֙ Dtb$<'<'<'<'<'<'<'{<'l<']<'N<'?&9 m=<'t<' <'u <'=<'t=<'thl=<'t,=<'t#=<'tΩPhul4EP:hSW u$1ۉ<'<'EU<'<'ڀ;+u[CK&DJPk<<'<'EU<'<'Y}Qȋ=&DOt Bu/<:0RUZUBBBBhvEPn1Sn  $D0k SDЍ~=Pd80k SDkd-lGS0k KT ЉGW0k SDωG0k SDЉG 0k SDЉG0k SDЉGW荫<'<'_u uj+EU<'<'y hjFh*PxY[u~tO8't5P#Z)ǃv%8't CRU6SgUӃ f @8'h&<')PSu t!;t ~<'sC~<'uf~<' h8'裾[<'<' <'th<'Ph׶ hY"g<'u踍PZt<'jjjՎ =<'u6^uhjtPh-[jүSj jhc ,;<'<'| &k5<' <'9Ȼ} VG9ƉS}M)Mt1jjs s]M9ȃM} huAXSht,;C|js`A^C tn=<'u!c=<'t{=<'t_h8'5<'ShAjjAhN=<'thtji=<'t3hhhcbƃ xjhP aV'cShjQh6'P7'hڂjjh6'sjg@ h{[=<'u=<'{u nhEE=<'t EE=<'t =<'t "=<'t |=<'t \d=<'t =d t8'PtPH1ɉ h/ejEPSa0Sh%j50Sh:4$ jj5aXZjDhUWVS@u} E@hWV tTHth wT$@ЁȀπÀ591i%X뫡91|%1ɉM똋&)Hth4jVhe#ǽ tVhe#h!j h<'G<'jV`XZy Vhjwz ]1uȉuԉufE5%]SkSjW赧yh^jhyt W yo8th95|%hCt W yh}tjjԅY[t hjy1҉UUUUčEP+^XUWVS8]u 1E6}XhVSb x`At$M@'ăa$ A'@'@'%U덡91@'!@'v@'k@'`@'U@'J&)Ӄ=@'t=@'tiA' @'t&=@'utu@=@'u7@'+=@'u =@'t#u=@'u@' %&U1@'@'hXUu h j1x=@'tEPWjj11ҍE1@'tjhށP[Xu5@'hjw1ɉ @'jjh@'jVoÃt;tMΎSZVX"4~FM蝎K1=@'e[^_]UWVSE pDB'EX1=u΃=X~'t$.H~ 1X~'=~'u - B'=~'~jh葕j 蜑 jj jUWVS]u 6*L'H'T'茩P'WhP跷 u4'VS`[^~jZY1uh<j9~!vu0p'hcVSZ u%/~k |Љ=8'vhPXZš&)Kutm&DPu^SӲ_=vhhohSh'聥 ;tCP''58'hj ]S茩hjhjhjڲhjβ S^u hhjir@uhwjh&诌ha u '&D'hc[=,'t"5\'&JYt5\'&hjqt Phj=,'u5\'& Zu€='t8jj5d'W y h*Pj5d'W xh'j̎ '' '%,'% '%$'f@'' f>'8'hx'hp'ڄhh'ЄhjG/=4't#Ph QX'^_C6f=\(&t j4[E8'&utEڃ=4'u*t{8,(&u1f=(&(&< t< uG< t< uMjEP5d' f=)&{} urPC_8'&uXEE5'&PZYf=(&tCۡ&t &fEjEP5d' f=)&uEPЦXh*joUWVS E 0i'W1'4'h KY[t ^.h'!ZtTMBug918tpjRPj :uS1ҋ 'buV'' 'hRu u蔅à uC$`. 591h?'ė'먃 '륃 '뜃 '듺Y91o낃 'v91u#h\h/ h0W 'hkS^_À;1hoShZYƿ / t&VRS( u <2t&h\yS(^_SPhrP ' G'O3u8=eRh 8=tRhY[\3h\yS踞^ZƋtt ug(SYSOZhp_4jPSY‹ 3 9r(<,tuxG 'QRhSV7hNu591uhh. hKh蛭1k$'t!VP2ZYu''yGh)Vh,޺j諝91 'I=&u)' u~='u,PY@u hdjkt''Z!Ãt~ / t%Ft!á'0Rh|  s'0hXZ s'0h_Xt Shι[^j uh tth/蛹jhE uC'3hR舨ǃ u R3h#xPhPe tlj=''t [1 ȗ'hPWO' uR5'hej3jh'P%ZY@u5'h't&h'P_u_'05'hji'='t8'8th'PY'u$߃8u5'hjsi='uhh/ h0hjsN4' u shh8'PA_Z@u sh"@'%=tE'Bt,=@t shC\54'cO4'Y shn7C0''5'h谠'_Ztpp 0h蓠 'uB@'%=@uu0'uRPhF 't Ph/Y[''th'P Z8th'P_#Nu@u h jgh'P^#hu Rh6('%=u5'M[@u5'hT@K5'MY@u 5'hs4'tPMZ@u50'hjYgjɘUWVS}u 1ۃ~^;-t&11ɉ<8Dž4h"VW} it1҉4)&t+:t!;B uBu91B뵃Pr5σitot8DuFDž<늅u 91{ShJh cDž8Tudx1jSVrCtjjj@IǃuhVhiPÖ @u h:jeW[LY)&7tvFtjNt^HuTItBQ$Z.0Q豵Xɋ0u hIjRe돃넃8t4t-<t j謖UWVS$u] 3hj hSV{ Btb$$1 jj591 L'\'l'P'h'd'`'s\'dX'UP'T'vBeR0G.f"$1 H $1 a'''G'1''a'1' '?'1'1'"''1''1='''''&)Ӄ'='t*th' ' 'tbh jZt3='||='t=||)='||| Dž|4i'j/j'P$jCx<hSh-&=v ShP<h-&Y-&-&X/tK-&-&1hj]XZ='t.Ph-&.,x/uP-&@-&= -&wPh-&Y_@u78Uxt)o%=@xtbK='u='t' 't P6 P6_Z@u6hjcY%=@t /t 1ɉt4h-&hbjY' 'tDžt Džtt$P蝘ZPvЀ8/uj|Vg+x 1lpupCpQh-&b^Zh-&CHfuFs wPsh#pDžlpx/Xu$wfushxY[ftf tt)-&C,--&=~TSh-&hy o{DsC(huTttCpj/V!sYZpt)xphN>PLYZphp>h)8/t z/t/Bс-&vPh-&hť VPRp,p-& -&= -&vx/uP-&@ߋp='xt Ph-& Ph-&7^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-&h CP@% =@B%=@t,M1@ush-&h1Jp΁@tpw `~||t {DPS ZY/sH ' 'u&fNush2Y^jSx31*f5'V''lhRh$2 h6tCPph-&?^X='h-&shWЌ E%=@t %fuL='u%'H''yhzh2 h?jR ZYhe~shZY='t'PR ='tPR PS+|W8t hjSx)lYUWVS|]u >j/WFoYZtxh5W肗_Zu^hVSrj @ui&)Ãu]p0;ZY@u jjvSje;LtEPtIFu'(h%VSj w~ fw$,2 1(((1((((1((t(e(V&4)Ã=(t(-=(t,(=1=(=(u(1ɉ (ttu#hbV1ɋ, P|=(xt)SW YZuE%=u ?SWo XZt WhjQE%=@9t ÃSUWVSu 6]hjj`ЉÁp1thRVuh tVmtDžtptc591Xu591hjQhWzpWD 딡&7hߋ^Xt!DžtpSZY_yɾߋuڋtV|UWVS}] 3hjN hSWe tUit)ft5huP(σvu?(1((15((뗡&)ǃ,4jj(h<$ jh =(tuϋV .PFTtP2lpY[uNj|%=@luh2lQDà =lv2hjMltx/tlƄ/CGh>WZD>8/u 9tH@j/WhZYtPRdY dvWhɛXZ"@PRlA5, t DžphfpS~UWVS@] 3Z)p&Su]Sj(4uEUEUSj\^_Sj4ZYuEUEUSj\^_Sj3ZYuEUEUSje\_XSj3Y^uEUEUSjA\XZhJ lZ)Z)1=Z)=Z)=Z)Z)P]1E؍}ȹE uVSj舎xVSjx x"}ujVj_ y}tVSjD xjVj1 y}tVSj xjVj y{}tVSj xjVj؍ yP}tEVSj 蹍 y1jVj覍 yVSj蔍 xy y hR 0j ^=5&tUjhhb05&[^y Еhr 0jZ) #=5&u=x5&t O@hkG,jYt8uVʼnZÅt @|/tCPޱZ)_uh jjZ)ZYtlj؍PZ)/hȭ(h ; jމ5& t! ttBGuB(X@Q9=Э(t h j{I%V=5&u5&W8Ot Z)Z)e[^_]UWVS]u 6hj腽 1hVS_ tLtPt9&thTh_8/u|hP~Y^ukh S~_ZuZPSY^@tHxPhhb_Z@t2|9u;xuM9 u;EtjjèY^uj S1h&\XZ$&@t h)jHjtyUWVS}] 3hjF 1hQSW^ ft]/WPtwR)d[)벃vtbit6rtxu{[)[)1[)p1[)[)Z[)K[)<[)-&9=[)zu8Quth[Xt[)؋Ht ʉA?jb[)[[) [)u t1=[)t =[)t@jPWFǃ uh{C =[)t.u)WKXCHHf $8 PDs bPsh#j E=[)tC ?ƒuts !Psh#诓[)k=[)^KPSC.HjSW C 1ɉK +C  Cu>S=[)tCHSftYwifu`KPCusUZ=[)u&sh[)Y[R`+z8XC=[)usZuH1tm=[)t<8V.8?H 8r5[) [)$1[)sX8t hjCW+[hxVS|ZYu8=[)tCj`PSh#[)_u=[)EE%=@uB=[)uSh蝑[)Y[묃=[)t'E%=u,S)B=[)u=tىډuh=@uSS=[)u SGZtX't1=[)uSh^衍8 蓍8?腍8u=[)S&X5[)s1e[^_]UVS@jj^X1EĉEȉEEjEPjZ& PPDw¸9u Q9Eb)j j'Y[b)H b)jb)$j˵ZYh !>aV7&1ۉ]$hc)^Z\)tt3Hu:\).$=j)tzj:WEYZt@0j.WTYZlt!hj)W_Z@lu BJ/>t0<#u.j)hj)W裍ZY@u ۉ/8xPWpZY@u Whj8=j)tEj)Ej)jSVB ǃ 1uh>pu jSWj WAX CHHf wg$T s _Psh#Džl/=s 5Psh#ÆttDžlP. Džl/j)ht)KPt;Quj)t;Au A<5j)RslЃ t"`ush5Y[ds}Z贂8t hjU7VhUWVSu V{f)()z ) ʈ)$){) ʈ) )'z)%j)f))h V[t.hLAVYV t7GtPSWzYZu .Shz@Wh@j661h@Vu M A6$T L)%j)<) H)D)8)=91hWyYZuh@WyYZ;1-=91-.j j591~ǃ u軀8"u 591h@D=$)j j591~ǃ t =()u8"u591h@j5j j591g~ǃ u@8"t=j)591h@뺸Y591f5Z@u^PA4)I )=1 )4@)(0) 9tt/؉ j)v jhAuh%A )tt hYAj3j))ǃ;= )u/;$)u");()u)9rt1= 8&D)H)  8&&=4)tCP U)4uE=<)t=8)?8)4=8)tt  1Ljhh)PQƈPLy h)t=H)uJLxPPOZYLu&%=uD)H)w($|U J<)Pe7JPEChkG R^uhkAPh*hShSϳǃuShY[hFP`XZthW%h)h`)V[T5j)h`)VX VbX1\`dDžXhVXPj ]Džy0|8#tjVjh(j _jVj@P?P@haPƃun@SVh(TP蠯Tu hbjjPhhRhR.ÃuV譤YSxTPZ9ujVjTH hށV_kLY_uVhXZ`)e׋H󫋅L5L@aXtPADžu V蔱[ehxAgh&NDĐ&HĐ&ZYyh&?bX&P&0 t+@t( Đ&y h& b_&P&Ѓ߃NP^ JPG@=)u ) =)u ) Ph`)MY[J}L),)P?=,)X=@)t `)+,h)h`)h&NQ5j)h`)h&Uh`)~-Zxdhށvti[_uvhj(31JPhmdP> hL@j-m^~W.Yu Wh >P`)eȺx)t jSRF: h`),ZIP|?W^UWVSjj]Sjjh^ C@u hLj5-uYtjjSPjh^ @t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQMQhdU1G맅u) &yh&j jXZ&P& 1e[^_]UWVS ƅ]-ƅ_1ۉ) ))15)))1=)))1hmMu uB ycPtJTtgxPl$ ^  )뫃 )q ) e )Y )M591)Ye591>Vj:V7[Zuh7MSH)t)XV3 oZYXu C[Ӊ)=)t hj*91tuh1Ҁnuxou8&h\yPq^_t)1U֋=91u )i91)UO[h^ PhMMhp& ej[^])U)t))t )&M Tu)tP1ۉXhq ho 5)RV]XRrRhRLqmZYTLSTZjjLRPVT9X}XTPT0VhPfà uj/SDZYuShe#h!hS_VXu"VXu9S^ty2LhVsfà LVhjuhLRUlZYhLLR:lZYSh~MjjhVjS"~ǃu VhMj(h )hzd@PX uWoXБ)`PhedAWX @uVhMW>VhgH__9~VhM(NE X&&XZ^)_)`)}u >&x;&1ƅhB&u u4ǃ zI`Ntu&At/CcG6$y WBhk_ͨ)̨)w˨)ka)@&Z`)Nʨ)@& 6ɨ)*_)Ȩ)Pjhjjj j591;Ĩ) 6Pjhjjj j591;) 591hs^)_t9ƀ )xt!ƀ )l\m iuWƀ )Ct_L1>&%=&>&`;&@&ƅ>&@&@&=&=a)uu =Ȩ)Wjm^G=_):=^)-=a)uu =Ȩ)tEjLmY=a)t=Ȩ)=Ȩ)t Dž PPtVSE PE)P!&Džuhy hPV" @u h6t*HkttWPXZuhy hGSSYXuV&Z@u hy hSYuhy hjVOZuhy h*j@ uh>hy h*WSй%1󫍅PhZS@uh+S_XuzkhsSZYuhhy hqPwƍH_v󤍅PhiS( @uheYSjqJVZ thuhty hihYVƹ󥍅Phui S'@uhhUjmoZt h jhy: hШ)hШ) UhC&h)kh)hCP h)nh-P h)mh) h)XUh`D&h)h)EhY h)h8X h)h)S h)aXUh`F&h@)hF&hH)h@)hH)h_ h`) hGZ hP)h_ hX)h`)hP)hX)UVS8ujh) &[Zt\bjjÃt hj&y hwYhTZy h0]Xjhx TZYu[jj)hB) u=jhSY[ujh+hGPhhRj :jURPP @t-Et PhKXZjhxaSZYtj dXhbj SXj jh+ hKu V, t1ftsuG& )PhxCYX95&t hCZjj h.z pBjjjj j jjjh z VB0jjjjhxr ABjjhr 3BEEEE jjjjjjjj j j jjjuVJ8jVjn1EEEEEEjuVjyWjVjoW$jjj.JEE EjjEPEPjEPe$@u _1ۃ8É)G&t*H G&HE G&Ӊָe[^]UWVS]} DžhDžT1L11PXDžD> hWS* u~fFt/RkDžPgS$ 591IZDYu591hXu918#t591^Zu[ j dR@P d:u=@)qh5r@`)jxlP5`)ph@uph*b)@th<;7 jr HM1󫍝`4󫋅 =)u )tJ) )PH[^@=)))s=)u;))}hR @uhOP1ZY@uhb=)h0V;à uVh#jPh0PW ujhh@)jPSyh@)hx!Pn^_@tڋ%=`uh@)h1=)jjh@) yh@)hjP]Y[uh@)hjh@)he#? E)t#@)VRW@^ZtN xRjVhe#? u ƃrVW<@YZuSh@)hj&=P)u@P)`PP5P)h@)@uh@)h 1=P)L)=)u) hYtc uh@)hhfSd?ZYu&D)uhfS@?^_t t Dž@)?=D)th` h"S?Y[thh@)h Džt')RP5)5)!))5)=)19|Y<@ t )SQRP  5)=)19| ht5 ))9sSQRPh=jtd) )ˋ)%)RP) @u+5)5)hj'0P]{_Z@uh1[^  u hj X9iu RlPVhjh j 8&UWVSp])1hu SO ƃ gZ(CwFk$` Dž뷍FL$ jP591fM& :uPfnPh)=)I):jjjjj919M&Vjjhjh91ݱ)P591hj4jjjjj91B螱)jjhjh91$t)jjhjh91"J)jjhjj91#)ujjjcjj91@M&Tjjhjj91#ް)0Phjhj91,貰))91)8hDžDž}&)Ӄ=)u )Ktñ14`E =)u )1=)u;))}hP @uhOS?[_@uhb=).#jhh )jFyh )hxS ZY@t=)jjh )Aƃ yh )hdjP[_uh )h;Dž )jh )he#e3 u Dž%)xxjWhe#'3 u ƃrW3ZYtWR3Y_uSh )h 뀍`PPjh )s@uh )hԣ  =)u)u hj7t] uh )hu7h~P2_ZDž )t hh )h jDž )t()1RP5)5)))))19؋|i<@ t" )1SQRP ))19| ht5 ))9sSQRPh=jtM)) )mRPV[ @u'5)5)hj1$0PV0oY[@uhXZ HpX<wz<Xx^FLs3`ts)XhaZ XLu"LtkXD- 赴FLXxFv89~88X`;*uMSh*L u5`t hi X8N)XL**L󤃽`u!2hxE _Dž` hw. ^LI.8LtkXDX }뵃`uvh}[i`uPHxhfXfu(TPWDž`Ph_ZYXOFLXLe`t Ȳh&X5p*;*)]+UWVS}ӳÀ8-uCh{SZYu+1uuu'h_SlY[1ۅu+πhu WD t[dw<$ Eσ=+t 뾁북뮁ŻEE돡&19tcM E1WtUPZU<R6XEtPVhgVED>,tjFPhj\}tVSghnjn}踶DžuQP_t8=+tj jh{lFWh=+t j jh_MFWhjF8j jhn-F tVWhjFWhjrF hhch<^Gjjhhch<GG }u蕱jj jj jj jj jjx jj o jj@u h#j4jjZY@uo8th0=jX}uj_j j蹲ZY@u08t+hFvY2 u h\dZ W裐XVS蘴hD 0DjjTƒ BuSPh!j&)ƍ胮+=+tjjh Q+ >Ejjj"[+jURh@hP` @u h趃Y=+y hj;u=+3 @ W Z) (    mt /  =+t1ɉڸܾ1ɉMhje6E؉EhjS6E܉EhjA6EȉEhj/6EĉE hj6EEhj6ljEhj5EMU ʃ} ʃ} у} хuu hE1҉+8gtj5+_X1ɉMEEFEȅ"CEċS:-0BRUZH3U$H +"0V&+0V&+0V&+0V& +uj+[+L+A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸mECEu/CEċSEP1ɸ:X+uCEċCUEuKMċs t^P+hw$ ]1RX+F`+:h+ .p+@"x++ H+  + + +t# @+ D+@+D+t1+jjV1C R+u#EPM̉UEXUUuEPM̉URU_^uChs ZY=+uhhhSgM +CHw)=+uhhhSg 1+SEP1ɸJX]ċu+Muh5u>au uh8"+Eġ+}tuȉuthVjMu}t }EEă=+uMEȉE10E18+1atctguIE+E+++@+++++@+ ++U9sHxt)Ј+t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ ++tMutHXSVh+螫 =+t =+t+n+tE}tHpVWSL =+t =+t{蛱+tE}tHpVWS =+t =+tM+tE}tHpVWS谪 =+t =+t+tE}tHpVWSb =+t =+t豰+ tE}tHpVWS =+t =+tc+f+=+t!=+u=+t0+=+Sh+5+踥 u( 87t 舰PhXZ9~kPhY[]p 83u =+tH[ 8t+ + + +PSV` 11ɉډe[^_]WXe[^_]UWVS } zhPFZY…UhPWu+ Ut.at"t=4+914+뽺붡&])Åt>um4+t&hfuS^_th0SZYCt/=4+u&4 +ujRKuEVhhp&MVh2hp&=j=D+u.D+hHWu+ t@A3w$ z=D+uD+먃=D+uD+듃=D+uD+{=D+uD+c=D+zD+ G,+8@+)<+@+ =D+"D+@@+$+(+8+591V +X=D+D+=D+D+j=4+914+hPY[>0+/=D+FD+D+)&E)tH:Eu5=8+=,+t =(+=4+]=,+t =(+=4+txt4hfuWYZ!h0WYZu/ hfuWsYZ7h0W^YZ"hWI_Z,@JK E3À5<+jj58+5@+5 +t5<+jj58+5@+5 +;E5 +Sj7 0Shj肺 +E =0+mE5jEPj @u h^rEUuuhx9[Jh`RP8ht S8YyE  1SQ%1RPhG1=0+t!5Xh3SN_Zt#hS=ZYtujVhFj Vh7jUWVS u] 1hSV tRtfu2h+ֿϡ&9td1ɉ`lPV6[ZjxPP)rZY%=`=@uxhuxPh[^Dž`ddPhV _h\yPZYt"8u591hGujPW @8!-̢,fDž1,591訩XB1= ,=L,/ ,L,591JY(,y591h$,91?u&t1uPhXZp&tT591h-PhC/jjj5P,E&)ЉEE E 14,,t,,tq1,DžDžh,RjVt& u0W'P:_PVh1ɉ + +h}^t8t P Z+auPGXu;PXt߃=+uF t8t P辧_+6豧Y++=+utuh\菧Z+ghPh+ =v&j?w&$5+h +hhh+覩 =w=+tj 账$ hP j hbVh hX#rh,X,irh6X6MrhAXA1rhMrYMrhV_qh:X*qhXVqhX^qVVjXZhj~Y^hjr~_Xh3jd~XZh3jV~Y^h2jH~_XEt7U ESRPR3à +uSjj~^_jXE j:0脸Y[t*E 0蘞ZuU ERP1_X9jh,DY^uh(j}XZh;)j }Y[E 0j@V_ZÅt @ǏhPW3 E @1=,t1ɉ , ,ER@PTXZ=,=,uu ,ujSVq =,t 1ۉ,71҉ ,Ph5P, 5,nY=,a뿃jh,qCXZh(jn|Y[h;)j `|^_se[^_]UWVS}u 蔎hP`YZtWhSOYZthS>YZu,)~3ltXnuzh4!VW du,׃Vt1PσwB0^&뾃cu3,,h h9hp&jPh h9hp&~Sh!hp&nj%&9u,=,t 1Ix1ٴppt8-u ƀxu t1L=,t 1x1耴pp8u;J5^&ƍxPV}b_Zti=,tSuO&8uCVj ^&Dhl$}Ylhuhb1thD!vE@uVhS!xu /n=,tX=,tO%= uu-jV覍XZy Vhe!x豷Wd^ Vhn!聭ZYS2X5,?UWVSu 6Jhj1ɉ \, 1h"(Vu` ua`Gt+It2EtHa<$8  ,먁% ,뜡91u\,`,z,k,591$591PhW螘911  ,91u\,1҉`,jjjh&hS'/,jjjh&Shw'^X| PPh'hp&ju&4 ,ut 7>ttN1Bj5,h& t h)j若5d,UWVSP}1ɉMM1h)u W+ t3gt!utGu.91E91;u91E85&9t3SZt@E%UMM@uSh)j谤1}1ɉM}t EE1}t6h\yEP YZt"8tu h)jcGDʋE 46ҷZ@u6hjchhb&Y@ttEPW_Z@uh)}tu躋Y@u h)jtuZ@uh@FtVRPvhjh#XuRjh)SSShj赣UWVS$uE E1҉U0tFYthh0#1ɉMMMMEPj芳[_@u h0j\jbZth011E؉Eh0uV C3$Ա _Uq591,뙺 %591-P*ZYU91@uYPS'}_&1}591tE591\-PPS&Ã591:-P6%YZPCPn&XZK,}uZ591EX_&} E],RF&)ƋMԍ}uE}uEEt1Hvh08=,u9UЉEh0XEԋU =,tHvh 1 $ jSRV jjRVis2U+YUu#BU@uh.1AYEC S<Z,tCWv&X'VYuVSV$Í@P!C u:{ts s6 _Zt/hk17j C^u=,t"P!=,ts YS Zh1N?2U%XtdCU܅t#tuh1/V:@0ًFttۃt֋@0UVYUu2h1XZN Vj1yF3)s)6h)v^)CF C FC{uFCVXt\W$YtPEZUuRWh.X eSR:#Í@PfC uLWhI17{t'S)s sy =,t6sW#jICYu=,tP ZK Sj1fCjvs*GWCPj"S#uh2XE؉E ]e[^_]y&IYBщ؍e[^_]e[^_]Nh2h|* "E܍e[^_]Kh+2j-e[^_]UWVS 1EU1E111E1҉UhZu u UtZn`~3a w+$ ƒwt,=91볻1E1=EE눡&E؋EM)ȉEEt Ht[ӧ}~t*Ut#}~ t&[ׄUt@[˅t&uZa&EE.#Ea&`t&uZr&EEFEDs&6}t&uZ`&EEE`& 1ɉMM1ۉUuS۟jWLƃUy jW8XZUy Whj蓛tuC 1ɋ}9}uAVEY1E9C tU@URPRhb[%=u uSXZG벃}^E M؍}1}܋;j=WZYu h[j诚19s x+u@UU؍HM3ݞNjH XUt 3h[ujuW蜢W  8u 3h[O VEЁg juWbW W VEЁg E܃XM9M/~2UB@ _ǃUt 2h[GA EM9MuVEYs uS蔞XZGE9}"C t3h[j臙V1V 1e[^_]ÍL$qUWVSQ@Y1ɉP.1󫺬.1,0<48h=pS@ ,H01$ 0%0591f.1Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @f.F누0f.%1҉Lj LP591ƉPp 8u!918tL8u ;Phanpj LP591S ~91:t L:t591h|n4.z 0@n蓦thnjP 0jh&虱1ɉ Dy& Hy&Ly&^_91< 0j LP591RPy&91 :t L9t Rhnj@=Rhn914 0 0LP59191_Z8tL:t Pv)ݝ k݅ tjbPho!v591h&oAٽFfF fD٭D߽ ٭F $Dy&Hy&߭ ٭D۝ ٭F Ly&xy591hn uhqqPKfP@0؃^_u h[q u0Xy&1҃‰.0@s Dž@0 1ɉ .Xy&@ ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgfsckfsck_ffsgptifconfigmknodmount_cd9660mount_ffsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsswapctlgzipgzcatgunzipchrootcgdconfigwsconsctlping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %stotalcannot seek temp filecannot read temp fileinvalid addressline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark charactered.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicmbr_bootselmbr_extInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedasyncgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizefragment sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpare%d %d START disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered newNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]releasepreventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParameters%s, %sError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENALIAS, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexINTSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGTERMhcxndaNR@8MOUSE_STARTMOUSE_ENDcmsobc|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done_(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-c%s %s %slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshiftquotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] /bin/sh~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberhddvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratedialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftprawhdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymappasswordresetvideosunsummodulesbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... m:pusage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: not found%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil done; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %struePScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalchdirletfalsefdflagsgetoptsfcinputrcprintfsetvartestulimitumaskunaliaswordexpPPID20220122 BUILD:20260722052624Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrqfsck_%s-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinv7fs** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]%d%sGPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressvltimeinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEinetnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedmetricSIOCSIFMETRICmtuSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:N%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics 2easector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkexpirehopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesSO_RERRORassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen%s/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetformidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directoryopen: %s%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-ifailed to read passphrasepflag set inappropriately? (echo)%s's passphrase%s:failed to generate Argon2id key, error code %dfailed to generate PKCS#5 PBKDF2 keyusage: %s [-enpv] [-V vmeth] cgd dev [paramsfile] %s -C [-enpv] [-f configfile] %s -G [-enpSv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] paramsfile %s -g [-Sv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] alg [keylen] %s -l [-v[v]] [cgd] %s -s [-nv] [-i ivmeth] cgd dev alg [keylen] %s -t paramsfile %s -T [-f configfile] %s -U [-nv] [-f configfile] %s -u [-nv] cgd with alg %s keylen %zu blocksize %zu ivmethod %s can't open cgd "%s", "%s"%s (%s): clearing opendisk_werror(%s, %s, %zu) called. getfsspecname failed: %sfailed to parse key lengthfailed to read key from stdin/etc/cgd/cgd.confcould not open config file "%s"\\#action failed on "%s" line %luencblkno8encblkno1CGDIOCGETnot in usedev %llu,%llu keylen %d blksize %zd opendir: %srcgdbad name %sgetkey("%s", %p, %zu) called command failedcommand output too shortcommand failed with status %dunrecognised keygen method %d in getkey()failed to derive HKDF-HMAC-SHA256 subkeyunrecognised shared key derivation method %dinvalid parameters file "%s"nbits <= INT_MAX - 7/usr/src/sbin/cgdconfig/cgdconfig.cret == (int)nb64flags == CONFIG_FLAGS_FROMALLwrong number of argsdevice %s already in useparams invalidcan't read disklabel areapread: incomplete blockre-enter devicecan't read mbr areacan't read gpt areaunimplemented verification methodverification failed permanentlyverification failed, please reenter passphraseCrypto self-test failedCan't disable coresCan't lock memoryCGP:STUV:b:ef:gi:k:lno:sptuv-P is only for use with -g/-G action-P only makes sense with -S flag-S is only for use with -g/-G actionFailed to parse key lengthno keygen in parameters file "%s"Failed to generate defaults for keygeninvalid parameters generatedcan't preserve randomly generated keyinvalid old parameters file "%s"old filenew filecan't generate new parameters fileundefined actionout of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundout of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()foo%s line %d: %s at '%s'yacc stack overflow%s: failed to parse parameters file tmplen == PRF_BLOCKLEN/usr/src/sbin/cgdconfig/pkcs5_pbkdf2.cpkcs5_pbkdf2: calibrating iterations...%s %s; %*sshared "%s" \ %*salgorithm %s \ could not determine key length for unknown algorithm "%s"re-enterparams_setverify_method: unrecognized verify method "%s"keygen argon2id must provide `iterations'keygen argon2id must provide `memory'keygen argon2id must provide `parallelism'keygen argon2id must provide `version'keygen argon2id does not need a `cmd'keygen argon2id does not need a `key'keygen argon2id must provide a saltkeygen pkcs5_pbkdf2 must provide `iterations'keygen pkcs5_pbkdf2 does not need a `key'keygen pkcs5_pbkdf2 must provide a saltkeygen pkcs5_pbkdf2 does not need a `cmd'keygen pkcs5_pbkdf2/sha1 must provide `iterations'keygen pkcs5_pbkdf2/sha1 does not need a `key'keygen pkcs5_pbkdf2/sha1 must provide a saltkeygen pkcs5_pbkdf2/sha1 does not need a `cmd'keygen storedkey does not need `iterations'keygen storedkey must provide a keykeygen storedkey does not need `salt'keygen storedkey does not need `cmd'keygen [u]randomkey does not need `iterations'keygen [u]randomkey does not need `key'keygen [u]randomkey does not need `salt'keygen [u]randomkey does not need `cmd'keygen [u]randomkey makes no sense sharedkeygen shell_cmd does not need `iterations'keygen shell_cmd does not need `key'keygen shell_cmd does not need `salt'keygen shell_cmd must provide a `cmd'unspecified algorithmunknown algorithm "%s"(warning)unspecified IV methodunknown IV method "%s" (warning)unspecified key lengthcould not calibrate pkcs5_pbkdf2can't generate random bits for storedkey(u)randomkey keygen cannot be sharedstoredkey does not make sense as sharedkeygen already shareduuidgenuuid_to_string: %ukeygen not sharedargon2idpkcs5_pbkdf2/sha1urandomkeyshell_cmdunrecognized key generation method "%s"hkdf-hmac-sha256unrecognized shared key derivation algorithm "%s"/etc/cgdfailed to open params file "%s"keygen storedkey urandomkey; argon2id { iterationsparallelism}; pkcs5_pbkdf2 { pkcs5_pbkdf2/sha1 { keygen_fput: %d not a valid methodiv-methodkeylengthverify_methodunsupported verify_method (%d)could not open outfile "%s"encblknobits_decode: mangled base64 stream %sbits_decode: encoded bits claim to be longer than they are (nbits=%zu, stream len=%zu bytes)/dev/randomcalibrating argon2id parameters... failed to calculate Argon2 hash, error code %d failed to calibrate hash parameters: broken monotonic clock? failed to calibrate hash parametersargon2dargon2iArgon2idArgon2iArgon2dUnknown error codeThe password does not match the supplied hashSome of encoded parameters are too long or too shortThreading failureDecoding failedEncoding failedMissing argumentsToo many threadsNot enough threadsOutput pointer mismatchThere is no such version of Argon2Argon2_Context context is NULLThe allocate memory callback is NULLThe free memory callback is NULLMemory allocation errorAssociated data pointer is NULL, but ad length is not 0Secret pointer is NULL, but secret length is not 0Salt pointer is NULL, but salt length is not 0Password pointer is NULL, but password length is not 0Too many lanesToo few lanesMemory cost is too largeMemory cost is too smallTime cost is too largeTime cost is too smallSecret is too longSecret is too shortAssociated data is too longAssociated data is too shortSalt is too longSalt is too shortPassword is too longPassword is too shortOutput is too longOutput is too shortOutput pointer is NULL$v=$m=,t=,p=WSDISPLAYIO_GTYPEWSDISPLAYIO_SFONTWSDISPLAYIO_SBORDERWSDISPLAYIO_PARAM_BACKLIGHTWSDISPLAYIO_PARAM_BRIGHTNESSWSDISPLAYIO_PARAM_CONTRASTWSDISPLAYIO_SSPLASHWSDISPLAYIO_SPROGRESSWSDISPLAYIO_GMSGATTRSWSDISPLAYIO_SMSGATTRSWSDISPLAYIO_DSSCROLLborderfontbacklightbrightnesscontrastscroll.fastlinesscroll.slowlinesedidmsg.default.attrsmsg.default.bgmsg.default.fgmsg.kernel.attrsmsg.kernel.bgmsg.kernel.fgsplash.enablesplash.progressWSKBDIO_GTYPEWSKBDIO_GETBELLWSKBDIO_GETDEFAULTBELLWSKBDIO_GETMAPWSKBDIO_GETKEYREPEATWSKBDIO_GETLEDSWSKBDIO_GETENCODINGWSKBDIO_GETSCROLLWSKBDIO_SETMODEWSKBDIO_SETBELLWSKBDIO_SETDEFAULTBELLWSKBDIO_SETMAP +> WSKBDIO_SETKEYREPEATWSKBDIO_SETDEFAULTKEYREPEATWSKBDIO_SETLEDSWSKBDIO_SETENCODINGWSKBDIO_SETKEYCLICKWSKBDIO_SETSCROLLscrolling is not supported by this kernelbell.pitchbell.periodbell.volumebell.pitch.defaultbell.period.defaultbell.volume.defaultrepeat.del1repeat.delnrepeat.del1.defaultrepeat.deln.defaultledstatekeyclickscroll.modescroll.modifierunknown_%dBackSpaceLinefeedEscapeexclamquotedblnumbersigndollarampersandapostropheparenleftparenrightasteriskcommasemicolonequalgreaterquestionbracketleftbracketrightasciicircumunderscorebraceleftbracerightasciitildenobreakspaceexclamdownsterlingcurrencyyenbrokenbarsectioncopyrightordfeminineguillemotleftnotsignhyphenregisteredmacrondegreeplusminustwosuperiorthreesuperiormuparagraphperiodcenteredonesuperiormasculineguillemotrightonequarteronehalfthreequartersquestiondownAgraveAacuteAcircumflexAtildeAdiaeresisAringAECcedillaEgraveEacuteEcircumflexEdiaeresisIgraveIacuteIcircumflexIdiaeresisETHNtildeOgraveOacuteOcircumflexOtildeOdiaeresismultiplyOobliqueUgraveUacuteUcircumflexUdiaeresisYacuteTHORNssharpagraveaacuteacircumflexatildeadiaeresisaeccedillaegraveecircumflexediaeresisigraveiacuteicircumflexidiaeresisethntildeograveoacuteocircumflexotildeodiaeresisdivisionoslashugraveuacuteucircumflexudiaeresisyacutethornydiaeresisAbreveabreveAogonekaogonekCacutecacuteCcaronccaronDcarondcaronDstrokedstrokeEogonekeogonekEcaronecaronLacutelacuteLcaronlcaronLstrokelstrokeNacutenacuteNcaronncaronOdoubleacuteodoubleacuteRacuteracuteRcaronrcaronSacutesacuteScaronscaronTcedillatcedillaTcarontcaronUaboveringuaboveringUdoubleacuteudoubleacuteZacutezacuteZabovedotzabovedotZcaronzcarondead_gravedead_acutedead_circumflexdead_tildedead_brevedead_diaeresisdead_aboveringdead_carondead_dotaccentdead_hungarumlautdead_ogonekdead_slashdead_cedilladead_semidead_colongr_Atgr_Etgr_Htgr_Itgr_Otgr_Ytgr_Vtgr_itdgr_Agr_Bgr_Ggr_Dgr_Egr_Zgr_Hgr_Ugr_Igr_Kgr_Lgr_Mgr_Ngr_Jgr_Ogr_Pgr_Rgr_Sgr_Tgr_Ygr_Fgr_Xgr_Cgr_Vgr_Idgr_Ydgr_atgr_etgr_htgr_itgr_ytdgr_agr_bgr_ggr_dgr_egr_zgr_hgr_ugr_igr_kgr_lgr_mgr_ngr_jgr_ogr_pgr_rgr_teliko_sgr_sgr_tgr_ygr_fgr_xgr_cgr_vgr_idgr_ydgr_otgr_ytgr_vtShift_LShift_RControl_LControl_RCaps_LockShift_LockAlt_LAlt_RMulti_keyMode_switchNum_LockHold_ScreenCmdCmd1Cmd2Meta_LMeta_RZenkaku_HankakuHiragana_KatakanaHenkan_ModeHenkanMuhenkanKP_F1KP_F2KP_F3KP_F4KP_HomeKP_LeftKP_UpKP_RightKP_DownKP_PriorKP_NextKP_EndKP_BeginKP_InsertKP_DeleteKP_SpaceKP_TabKP_EnterKP_EqualKP_NumbersignKP_MultiplyKP_AddKP_SeparatorKP_SubtractKP_DecimalKP_DivideKP_0KP_1KP_2KP_3KP_4KP_5KP_6KP_7KP_8KP_9f3f4f5f6f7f9f10f11f12f13f14f15f16f17f18f19f20F5F6F7F9F10F11F12F13F14F15F16F17F18F19F20PowerHelpExecuteFindSelectAgainPropsUndoFrontCopyOpenPasteCutStopMenuPausePrint_ScreenCmd_Screen0Cmd_Screen1Cmd_Screen2Cmd_Screen3Cmd_Screen4Cmd_Screen5Cmd_Screen6Cmd_Screen7Cmd_Screen8Cmd_Screen9Cmd_DebuggerCmd_ResetEmulCmd_ResetCloseCmd_BacklightOnCmd_BacklightOffCmd_BacklightToggleCmd_BrightnessUpCmd_BrightnessDownCmd_BrightnessRotateCmd_ContrastUpCmd_ContrastDownCmd_ContrastRotateCmd_ScrollFastUpCmd_ScrollFastDownCmd_ScrollSlowUpCmd_ScrollSlowDownCmd_VolumeUpCmd_VolumeDownCmd_VolumeTogglevoidSymbolL5_GbreveL5_IdotaboveL5_ScedillaL5_gbreveL5_idotlessL5_scedillaparse: %s [%.*s]keysym %s not found%d: keycode too largekeysym expected%s: not a keysym%c: illegal character in input%03o: illegal character in inputcould not list calibration samples%s%d,%d,%d,%dWSMOUSEIO_GCALIBCOORDS%s: invalid calibration dataWSMOUSEIO_SCALIBCOORDSWSMOUSEIO_GTYPEWSMOUSEIO_GETREPEATWSMOUSEIO_SRESWSMOUSEIO_SRATEWSMOUSEIO_SETREPEATresolutionsampleratescroll.reversescroll.distance.xscroll.distance.ycalibration.minxcalibration.minycalibration.maxxcalibration.maxycalibration.samplesrepeat.buttonsrepeat.delay.firstrepeat.delay.decrementrepeat.delay.minimuminternal error: field_by_value: not foundkeycode %u =internal error: pr_field: no format %d%s: not a valid number list%ld: number out of range%s: not a valid encoding%s: not a valid variant%s: not a valid color%s: not a valid attributeinternal error: rd_field: no format %dhilitblinkunderlineblackbrownbluemagentacyanwhitenodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdepcolemakukczbeponeouadec-pm-monodec-pm-colordec-cfbdec-xcfbdec-mfbdec-sfbvga-isavga-pcidec-tga-pcidec-sfb+generic-pcinext-monodec-pxdec-pxgdec-txgeneric-hpcarm-vidcdec-spxdec-gpxdec-lcgdec-vax-monosparcbook-p9100egadreamcast-pvrhp-gatorhp-topcathp-renaissancehp-catseyehp-davincihp-tigerhp-hyperionamiga-ccsun24sgi-newportsgi-gr2suncg12suncg14suntcxsunffbhp-stihd44780vesaxilinxsgi-lightgenfbsgi-o2pxafujitsu-ag10displaylinksun-xvr1000omron-lunagrfvncapple-valkyrieimx-ipuvideocore4omap3530windermereclps-711xallwinnerssb-mgxamlogc-mesonnvidia-tegraplatinumprimcell-pl11xssdfbvideocore6dec-tcps2usblogitech-busms-inporttouch-panelarchimedeshildec-maxinemaplebluetoothlk201pc-xtpc-athpc-kbdhpc-btnriscpcadbsunsun-type5sgimatrix-keypad%s: %s Usage: %s [-kmd] [-f file] [-n] name ... -or- %s [-kmd] [-f file] [-n] -w name=value ... -or- %s [-kmd] [-f file] [-n] -w name+=value ... -or- %s [-kmd] [-f file] [-n] -a /dev/wskbd/dev/wsmouse/dev/ttyE0adf:kmnwonly one of -k, -d or -m may be givenexcess arguments after -aonly one of -a or -w may be given"%s" not shown with -a; use "%s %s" to view.'=' not found%s: read only%s: can only be set%s: write only%s: no kernel support%dx%dx%dIVMVendor: [%s] %s Product: [%04X] %s Serial number: %s Manufactured %d Week %d EDID Version %d.%d EDID Comment: %s Video Input: %x Digital (DFP 1.x compatible) Analog -0.7, 0.3V -0.714, 0.286V -1.0, 0.4V -0.7, 0.0V Blank-to-black setup Separate syncs Composite sync Sync on green Serration vsyncGamma: %d.%02d Max Size: %d cm x %d cm Features: %x DPMS standby DPMS suspend DPMS active-off Monochrome RGB Multicolor Undefined monitor type Standard color space Preferred timing Default GTF supportedChroma Info: Red X: 0.%03d Red Y: 0.%03d Grn X: 0.%03d Grn Y: 0.%03d Blu X: 0.%03d Blu Y: 0.%03d Wht X: 0.%03d Wht Y: 0.%03d Horizontal: %d - %d kHz Vertical: %d - %d Hz Max Dot Clock: %d MHz GTF2 hfreq: %d GTF2 C: %d GTF2 M: %d GTF2 J: %d GTF2 K: %d Video modes: %dx%d @ %dHz (%d %d %d %d %d %d %d %s%sH %s%sV) Preferred mode: %dx%d @ %dHz Number of extension blocks: %d %08xDELUltrascan 14XEVSC17GS17PSAACAcerViewAPPApple ComputerAST ResearchCPLCompalCPQCompaqCTXDellDPCDeltaDWEDaewooEIZEIZOELSAEPIEnvisionFCMFunaiFUJFujitsuGSMLG ElectronicsGWYGateway 2000HEIHyundaiHITHitachiHSLHansolHTCHitachi/NisseiHWPHPIBMFujitsu ICLIiyamaKDSKorea Data SystemsMEIPanasonicMELMitsubishi ElectronicsNANNanaoNECNOKNokia DataPHLPhilipsRELRelisysSAMSGISNYSonySRCShamrockSUNSun MicrosystemsTatungToshibaTSBViewSonicZCMZenith1280x1024x751024x768x751024x768x701024x768x601024x768x87i832x624x74800x600x75800x600x72800x600x60800x600x56640x480x75640x480x72640x480x67640x480x60720x400x87720x400x70640x350x85640x400x85720x400x85640x480x85800x600x851024x768x851024x768x891152x864x751280x768x751280x960x601280x960x851280x1024x601280x1024x701280x1024x851600x1200x601600x1200x651600x1200x701600x1200x751600x1200x851680x1050x601792x1344x601792x1344x751856x1392x601856x1392x751920x1440x601920x1440x751152x768x541400x1050x601400x1050x741152x900x661152x900x76320x175x85320x200x85360x200x70360x200x85360x200x87320x240x60320x240x72320x240x75320x240x85400x300x56400x300x60400x300x72400x300x75400x300x85512x384x87i512x384x60512x384x70512x384x75512x384x85512x384x89576x432x75640x384x75640x512x60640x512x70640x512x75640x512x85800x600x65800x600x70840x525x60896x672x60896x672x75928x696x60928x696x75960x720x60960x720x75416x312x74576x384x54700x525x60700x525x74576x450x66576x450x76-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype truncated no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedIPv6 addressIPv4 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlpunctxdigit%s%s%s 646tolowertoupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signleft-parenthesisright-parenthesisplus-signhyphen-minusfull-stoptwothreefourfiveseveneightless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflex-accentlow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaymondaymotuesdaytueswednesdaywedneswedswethursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselectmanual10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.NAME=sysctl hw.disknames failed/rdk/rno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format stringsysvv71kv8otherhpfshfsraidframejfs2minixfs3vmwresv%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%s^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$acosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llx%llirpn == pn!((*cp) == '\0')?xml !DOCTYPE plist